3OW5A

Crystal structure of the y200a mutant of gamma carbonic anhydrase from methanosarcina thermophila
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
205
structure length
204
Chain Sequence
SNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALTINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVAVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase
publication title Crystal structure of the Y200A mutant of Methanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 71
structure length 204
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ow5A00
4E6UA 4G3SA 4EQYA 3Q1XA 3FS8A 3OW5A 3TDTA 3TV0A 2VD4A 1QQ0A 4DCLA 3FSXA 1V3WA 1S80A 1QRLA 4KQLA 1YP4A 3MQHA 1G97A 2OEFA 3VBPA 1FXJA 3EH0A 4EAAA 1MR7A 4M9CA 1V67A 4HZCA 1SSQA 4IHGA 1HV9A 3FSYA 4AAWA 3TISA 1MRLA 2WLDA 3P1BA 2OI5A 3R8YA 3VBIA 2ICYA 1T3DA 3BSSA 2I5KA 5U2KA 4E75A 3GOSA 1HM8A 3BSWA 4MFGA 1FWYA 3VBNA 4HZDA 2WLCA 4G87A 1J2ZA 4HURA 2QIAA 2P2OA 2WLGA 2V0HA 3BRKX 2FKOA 2TDTA 3OUPA 3TK8A 3FWWA 5AFUU 4K6RA 1MR9A 3OTZA 4IHHA 2OI6A 2RIJA 3FOQA 4N69A 1KHRA 4R37A 3TWDA 3VBKA 2GGQA 3C8VA 2V0KA 4FCEA 4M98A 2V0JA 2WLFA 1QRMA 3FTTA 2OI7A 4J18A 2IC7A 2OEGA 2VHEA 3SRTA 3VBJA 3R5CA 1KRUA 2QIVX 2ICXA 3VBLA 1KRVA 1XHDA 1XATA 1YP2A 3R1WA 4E6TA 4EGGA 2IU9A 3R3RA 4M2AA 3MQGA 5E3RA 3FSBA 3R3IA 2JF3A 3D8VA 5ADXU 4MYOA 2NPOA 3JQYA 3MC4A 4H7OA 2QKXA 1KRRA 3NZ2A 3I3AA 1KK6A 2V0IA 4KPZA 3I3XA 5F42A 3OU9A 1KGQA 1HM9A 2IUAA 3DK5A 3KWEA 4KPXA 5DG3A 3T57A 2V0LA 3PMOA 4MZUA 1HM0A 3VBMA 3VNPA 4EA8A 2W0VA 4EA7A 4N6BA 4EA9A 4AC3A 3FSCA 5E3PA 4HUSA 3R0SA 3R5BA 4N27A 1LXAA 1G95A 1KK4A 4E79A 3EEVA 1QREA 3IXCA 4EABA 2XATA 1KQAA 5L6VA 3IGJA 1TDTA 2Q4JA 2AQ9A 4G3QA 5L6SA 4J09A 2WLEA 3F1XA 4R36A 1SSMA 5DEMA 4IHFA 4HCQA 3HJJA 1OCXA 3GUEA 5DEPA 2JF2A 3R5DA 4G3PA 3TIOA 3R5AA 1KK5A 3SPTA 4KNXA 4M2BA 1Z90A 3BSYA 5ADXV 4E1KA 4AA7A 3D98A 3EG4A 4ISXA 4KNRA 1SSTA 3HSQA 3CJ8A 1QRGA 3GVDA 3KWDA 3OTMA 4N6AA 3KWCA 2W0WA 5E3QA 5AFUV 3BXYA 3BFPA 3DHOA 3R2WA 3ST8A 3P47A 4M99A 3V4EA 3ECTA 1QRFA 4R7PA 1KGTA 2GGOA 4M28A 1YP3A 2IU8A 3DJ4A 1THJA
chains in the Genus database with same CATH superfamily
4E6UA 4G3SA 4EQYA 3Q1XA 3FS8A 3OW5A 3TDTA 3TV0A 2VD4A 1QQ0A 4DCLA 3FSXA 1V3WA 1S80A 1QRLA 4KQLA 1YP4A 3MQHA 1G97A 2OEFA 3VBPA 1FXJA 3EH0A 4EAAA 1MR7A 4M9CA 1V67A 1M8NA 3GQAA 4HZCA 1SSQA 4IHGA 1HV9A 3FSYA 4AAWA 3OH1A 3TISA 1MRLA 2WLDA 3P1BA 2OI5A 3R8YA 3VBIA 2ICYA 1T3DA 3BSSA 2I5KA 5U2KA 4E75A 3GOSA 1HM8A 3BSWA 4MFGA 1FWYA 3VBNA 4HZDA 2WLCA 4G87A 1J2ZA 4HURA 2QIAA 2P2OA 2WLGA 2V0HA 3BRKX 2FKOA 2TDTA 3OUPA 3TK8A 3FWWA 5AFUU 4K6RA 1MR9A 3OTZA 4IHHA 2OI6A 2RIJA 3FOQA 4N69A 1KHRA 3GQ8A 4R37A 3T57A 3TWDA 3VBKA 2GGQA 3C8VA 2V0KA 4FCEA 4M98A 3SUCA 3OH4A 2V0JA 2WLFA 1QRMA 3FTTA 2OI7A 4J18A 3GQ7A 2IC7A 2OEGA 2VHEA 3SRTA 3VBJA 3R5CA 1KRUA 2QIVX 1EWWA 2ICXA 3VBLA 1KRVA 1XHDA 1XATA 1YP2A 3R1WA 4E6TA 4EGGA 2IU9A 3R3RA 4M2AA 3MQGA 5E3RA 3FSBA 3R3IA 2JF3A 3D8VA 5ADXU 4MYOA 2NPOA 3JQYA 3MC4A 4H7OA 3OH3A 2QKXA 1KRRA 3NZ2A 3I3AA 1KK6A 2V0IA 4KPZA 3I3XA 5F42A 3GQ9A 1KGQA 1HM9A 2IUAA 3DK5A 3KWEA 3OU9A 4KPXA 5DG3A 2V0LA 3PMOA 4MZUA 1HM0A 3VBMA 3VNPA 4EA8A 2W0VA 4EA7A 4N6BA 4EA9A 4AC3A 3FSCA 5E3PA 4HUSA 3R0SA 3R5BA 4N27A 1G95A 1LXAA 1KK4A 4E79A 3EEVA 1QREA 3IXCA 4EABA 2XATA 1KQAA 5L6VA 3IGJA 1TDTA 1N4IA 2AQ9A 2Q4JA 4G3QA 5L6SA 4J09A 2WLEA 3F1XA 4R36A 1SSMA 5DEMA 4IHFA 3OH0A 4HCQA 3HJJA 1OCXA 3GUEA 5DEPA 2JF2A 3R5DA 4G3PA 3OH2A 3TIOA 3R5AA 1KK5A 3SPTA 4KNXA 4M2BA 1Z90A 3BSYA 5ADXV 4E1KA 4AA7A 3D98A 3EG4A 4ISXA 1L0SA 4KNRA 1SSTA 3HSQA 3OGZA 3CJ8A 1QRGA 3GVDA 3KWDA 3OTMA 4N6AA 3KWCA 2W0WA 5E3QA 5AFUV 3BXYA 3BFPA 3DHOA 3R2WA 3ST8A 3P47A 1Z2FA 4M99A 3V4EA 3ECTA 1QRFA 4R7PA 1KGTA 2GGOA 4M28A 1YP3A 2IU8A 3DJ4A 1THJA
chains in the Genus database with same CATH topology
4E6UA 4G3SA 4EQYA 3Q1XA 3FS8A 3OW5A 3TDTA 3TV0A 2VD4A 1QQ0A 4DCLA 3FSXA 1V3WA 1S80A 1QRLA 4KQLA 1YP4A 3MQHA 1G97A 2OEFA 3VBPA 1FXJA 3EH0A 4EAAA 1MR7A 4M9CA 1V67A 4HZCA 1SSQA 4IHGA 1HV9A 3FSYA 4AAWA 3TISA 1MRLA 2WLDA 3P1BA 2OI5A 3R8YA 3VBIA 2ICYA 1T3DA 3BSSA 2I5KA 5U2KA 4E75A 3GOSA 1HM8A 3BSWA 4MFGA 1FWYA 3VBNA 4HZDA 2WLCA 4G87A 1J2ZA 4HURA 2QIAA 2P2OA 2WLGA 2V0HA 3BRKX 2FKOA 2TDTA 3OUPA 3TK8A 3FWWA 5AFUU 4K6RA 1MR9A 3OTZA 4IHHA 2OI6A 2RIJA 3FOQA 4N69A 1KHRA 4R37A 3TWDA 3VBKA 2GGQA 3C8VA 2V0KA 4FCEA 4M98A 2V0JA 2WLFA 1QRMA 3FTTA 2OI7A 4J18A 2IC7A 2OEGA 2VHEA 3SRTA 3VBJA 3R5CA 1KRUA 2QIVX 2ICXA 3VBLA 1KRVA 1XHDA 1XATA 1YP2A 3R1WA 4E6TA 4EGGA 2IU9A 3R3RA 4M2AA 3MQGA 5E3RA 3FSBA 3R3IA 2JF3A 3D8VA 5ADXU 4MYOA 2NPOA 3JQYA 3MC4A 4H7OA 2QKXA 1KRRA 3NZ2A 3I3AA 1KK6A 2V0IA 4KPZA 3I3XA 5F42A 3OU9A 1KGQA 1HM9A 2IUAA 3DK5A 3KWEA 4KPXA 5DG3A 3T57A 2V0LA 3PMOA 4MZUA 1HM0A 3VBMA 3VNPA 4EA8A 2W0VA 4EA7A 4N6BA 4EA9A 4AC3A 3FSCA 5E3PA 4HUSA 3R0SA 3R5BA 4N27A 1LXAA 1G95A 1KK4A 4E79A 3EEVA 1QREA 3IXCA 4EABA 2XATA 1KQAA 5L6VA 3IGJA 1TDTA 2Q4JA 2AQ9A 4G3QA 5L6SA 4J09A 2WLEA 3F1XA 4R36A 1SSMA 5DEMA 4IHFA 4HCQA 3HJJA 1OCXA 3GUEA 5DEPA 2JF2A 3R5DA 4G3PA 3TIOA 3R5AA 1KK5A 3SPTA 4KNXA 4M2BA 1Z90A 3BSYA 5ADXV 4E1KA 4AA7A 3D98A 3EG4A 4ISXA 4KNRA 1SSTA 3HSQA 3CJ8A 1QRGA 3GVDA 3KWDA 3OTMA 4N6AA 3KWCA 2W0WA 5E3QA 5AFUV 3BXYA 3BFPA 3DHOA 3R2WA 3ST8A 3P47A 4M99A 3V4EA 3ECTA 1QRFA 4R7PA 1KGTA 2GGOA 4M28A 1YP3A 2IU8A 3DJ4A 1THJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6U A;  4G3S A;  4EQY A;  3Q1X A;  3FS8 A;  3OW5 A;  3TDT A;  3TV0 A;  2VD4 A;  1QQ0 A;  4DCL A;  3FSX A;  1V3W A;  1S80 A;  1QRL A;  4KQL A;  1YP4 A;  3MQH A;  1G97 A;  2OEF A;  3VBP A;  1FXJ A;  3EH0 A;  4EAA A;  1MR7 A;  4M9C A;  1V67 A;  4HZC A;  1SSQ A;  4IHG A;  1HV9 A;  3FSY A;  4AAW A;  3TIS A;  1MRL A;  2WLD A;  3P1B A;  2OI5 A;  3R8Y A;  3VBI A;  2ICY A;  1T3D A;  3BSS A;  2I5K A;  5U2K A;  4E75 A;  3GOS A;  1HM8 A;  3BSW A;  4MFG A;  1FWY A;  3VBN A;  4HZD A;  2WLC A;  4G87 A;  1J2Z A;  4HUR A;  2QIA A;  2P2O A;  2WLG A;  2V0H A;  3BRK X;  2FKO A;  2TDT A;  3OUP A;  3TK8 A;  3FWW A;  5AFU U;  4K6R A;  1MR9 A;  3OTZ A;  4IHH A;  2OI6 A;  2RIJ A;  3FOQ A;  4N69 A;  1KHR A;  4R37 A;  3TWD A;  3VBK A;  2GGQ A;  3C8V A;  2V0K A;  4FCE A;  4M98 A;  2V0J A;  2WLF A;  1QRM A;  3FTT A;  2OI7 A;  4J18 A;  2IC7 A;  2OEG A;  2VHE A;  3SRT A;  3VBJ A;  3R5C A;  1KRU A;  2QIV X;  2ICX A;  3VBL A;  1KRV A;  1XHD A;  1XAT A;  1YP2 A;  3R1W A;  4E6T A;  4EGG A;  2IU9 A;  3R3R A;  4M2A A;  3MQG A;  5E3R A;  3FSB A;  3R3I A;  2JF3 A;  3D8V A;  5ADX U;  4MYO A;  2NPO A;  3JQY A;  3MC4 A;  4H7O A;  2QKX A;  1KRR A;  3NZ2 A;  3I3A A;  1KK6 A;  2V0I A;  4KPZ A;  3I3X A;  5F42 A;  3OU9 A;  1KGQ A;  1HM9 A;  2IUA A;  3DK5 A;  3KWE A;  4KPX A;  5DG3 A;  3T57 A;  2V0L A;  3PMO A;  4MZU A;  1HM0 A;  3VBM A;  3VNP A;  4EA8 A;  2W0V A;  4EA7 A;  4N6B A;  4EA9 A;  4AC3 A;  3FSC A;  5E3P A;  4HUS A;  3R0S A;  3R5B A;  4N27 A;  1LXA A;  1G95 A;  1KK4 A;  4E79 A;  3EEV A;  1QRE A;  3IXC A;  4EAB A;  2XAT A;  1KQA A;  5L6V A;  3IGJ A;  1TDT A;  2Q4J A;  2AQ9 A;  4G3Q A;  5L6S A;  4J09 A;  2WLE A;  3F1X A;  4R36 A;  1SSM A;  5DEM A;  4IHF A;  4HCQ A;  3HJJ A;  1OCX A;  3GUE A;  5DEP A;  2JF2 A;  3R5D A;  4G3P A;  3TIO A;  3R5A A;  1KK5 A;  3SPT A;  4KNX A;  4M2B A;  1Z90 A;  3BSY A;  5ADX V;  4E1K A;  4AA7 A;  3D98 A;  3EG4 A;  4ISX A;  4KNR A;  1SST A;  3HSQ A;  3CJ8 A;  1QRG A;  3GVD A;  3KWD A;  3OTM A;  4N6A A;  3KWC A;  2W0W A;  5E3Q A;  5AFU V;  3BXY A;  3BFP A;  3DHO A;  3R2W A;  3ST8 A;  3P47 A;  4M99 A;  3V4E A;  3ECT A;  1QRF A;  4R7P A;  1KGT A;  2GGO A;  4M28 A;  1YP3 A;  2IU8 A;  3DJ4 A;  1THJ A; 
#chains in the Genus database with same CATH topology
 4E6U A;  4G3S A;  4EQY A;  3Q1X A;  3FS8 A;  3OW5 A;  3TDT A;  3TV0 A;  2VD4 A;  1QQ0 A;  4DCL A;  3FSX A;  1V3W A;  1S80 A;  1QRL A;  4KQL A;  1YP4 A;  3MQH A;  1G97 A;  2OEF A;  3VBP A;  1FXJ A;  3EH0 A;  4EAA A;  1MR7 A;  4M9C A;  1V67 A;  1M8N A;  3GQA A;  4HZC A;  1SSQ A;  4IHG A;  1HV9 A;  3FSY A;  4AAW A;  3OH1 A;  3TIS A;  1MRL A;  2WLD A;  3P1B A;  2OI5 A;  3R8Y A;  3VBI A;  2ICY A;  1T3D A;  3BSS A;  2I5K A;  5U2K A;  4E75 A;  3GOS A;  1HM8 A;  3BSW A;  4MFG A;  1FWY A;  3VBN A;  4HZD A;  2WLC A;  4G87 A;  1J2Z A;  4HUR A;  2QIA A;  2P2O A;  2WLG A;  2V0H A;  3BRK X;  2FKO A;  2TDT A;  3OUP A;  3TK8 A;  3FWW A;  5AFU U;  4K6R A;  1MR9 A;  3OTZ A;  4IHH A;  2OI6 A;  2RIJ A;  3FOQ A;  4N69 A;  1KHR A;  3GQ8 A;  4R37 A;  3T57 A;  3TWD A;  3VBK A;  2GGQ A;  3C8V A;  2V0K A;  4FCE A;  4M98 A;  3SUC A;  3OH4 A;  2V0J A;  2WLF A;  1QRM A;  3FTT A;  2OI7 A;  4J18 A;  3GQ7 A;  2IC7 A;  2OEG A;  2VHE A;  3SRT A;  3VBJ A;  3R5C A;  1KRU A;  2QIV X;  1EWW A;  2ICX A;  3VBL A;  1KRV A;  1XHD A;  1XAT A;  1YP2 A;  3R1W A;  4E6T A;  4EGG A;  2IU9 A;  3R3R A;  4M2A A;  3MQG A;  5E3R A;  3FSB A;  3R3I A;  2JF3 A;  3D8V A;  5ADX U;  4MYO A;  2NPO A;  3JQY A;  3MC4 A;  4H7O A;  3OH3 A;  2QKX A;  1KRR A;  3NZ2 A;  3I3A A;  1KK6 A;  2V0I A;  4KPZ A;  3I3X A;  5F42 A;  3GQ9 A;  1KGQ A;  1HM9 A;  2IUA A;  3DK5 A;  3KWE A;  3OU9 A;  4KPX A;  5DG3 A;  2V0L A;  3PMO A;  4MZU A;  1HM0 A;  3VBM A;  3VNP A;  4EA8 A;  2W0V A;  4EA7 A;  4N6B A;  4EA9 A;  4AC3 A;  3FSC A;  5E3P A;  4HUS A;  3R0S A;  3R5B A;  4N27 A;  1G95 A;  1LXA A;  1KK4 A;  4E79 A;  3EEV A;  1QRE A;  3IXC A;  4EAB A;  2XAT A;  1KQA A;  5L6V A;  3IGJ A;  1TDT A;  1N4I A;  2AQ9 A;  2Q4J A;  4G3Q A;  5L6S A;  4J09 A;  2WLE A;  3F1X A;  4R36 A;  1SSM A;  5DEM A;  4IHF A;  3OH0 A;  4HCQ A;  3HJJ A;  1OCX A;  3GUE A;  5DEP A;  2JF2 A;  3R5D A;  4G3P A;  3OH2 A;  3TIO A;  3R5A A;  1KK5 A;  3SPT A;  4KNX A;  4M2B A;  1Z90 A;  3BSY A;  5ADX V;  4E1K A;  4AA7 A;  3D98 A;  3EG4 A;  4ISX A;  1L0S A;  4KNR A;  1SST A;  3HSQ A;  3OGZ A;  3CJ8 A;  1QRG A;  3GVD A;  3KWD A;  3OTM A;  4N6A A;  3KWC A;  2W0W A;  5E3Q A;  5AFU V;  3BXY A;  3BFP A;  3DHO A;  3R2W A;  3ST8 A;  3P47 A;  1Z2F A;  4M99 A;  3V4E A;  3ECT A;  1QRF A;  4R7P A;  1KGT A;  2GGO A;  4M28 A;  1YP3 A;  2IU8 A;  3DJ4 A;  1THJ A; 
#chains in the Genus database with same CATH homology
 4E6U A;  4G3S A;  4EQY A;  3Q1X A;  3FS8 A;  3OW5 A;  3TDT A;  3TV0 A;  2VD4 A;  1QQ0 A;  4DCL A;  3FSX A;  1V3W A;  1S80 A;  1QRL A;  4KQL A;  1YP4 A;  3MQH A;  1G97 A;  2OEF A;  3VBP A;  1FXJ A;  3EH0 A;  4EAA A;  1MR7 A;  4M9C A;  1V67 A;  4HZC A;  1SSQ A;  4IHG A;  1HV9 A;  3FSY A;  4AAW A;  3TIS A;  1MRL A;  2WLD A;  3P1B A;  2OI5 A;  3R8Y A;  3VBI A;  2ICY A;  1T3D A;  3BSS A;  2I5K A;  5U2K A;  4E75 A;  3GOS A;  1HM8 A;  3BSW A;  4MFG A;  1FWY A;  3VBN A;  4HZD A;  2WLC A;  4G87 A;  1J2Z A;  4HUR A;  2QIA A;  2P2O A;  2WLG A;  2V0H A;  3BRK X;  2FKO A;  2TDT A;  3OUP A;  3TK8 A;  3FWW A;  5AFU U;  4K6R A;  1MR9 A;  3OTZ A;  4IHH A;  2OI6 A;  2RIJ A;  3FOQ A;  4N69 A;  1KHR A;  4R37 A;  3TWD A;  3VBK A;  2GGQ A;  3C8V A;  2V0K A;  4FCE A;  4M98 A;  2V0J A;  2WLF A;  1QRM A;  3FTT A;  2OI7 A;  4J18 A;  2IC7 A;  2OEG A;  2VHE A;  3SRT A;  3VBJ A;  3R5C A;  1KRU A;  2QIV X;  2ICX A;  3VBL A;  1KRV A;  1XHD A;  1XAT A;  1YP2 A;  3R1W A;  4E6T A;  4EGG A;  2IU9 A;  3R3R A;  4M2A A;  3MQG A;  5E3R A;  3FSB A;  3R3I A;  2JF3 A;  3D8V A;  5ADX U;  4MYO A;  2NPO A;  3JQY A;  3MC4 A;  4H7O A;  2QKX A;  1KRR A;  3NZ2 A;  3I3A A;  1KK6 A;  2V0I A;  4KPZ A;  3I3X A;  5F42 A;  3OU9 A;  1KGQ A;  1HM9 A;  2IUA A;  3DK5 A;  3KWE A;  4KPX A;  5DG3 A;  3T57 A;  2V0L A;  3PMO A;  4MZU A;  1HM0 A;  3VBM A;  3VNP A;  4EA8 A;  2W0V A;  4EA7 A;  4N6B A;  4EA9 A;  4AC3 A;  3FSC A;  5E3P A;  4HUS A;  3R0S A;  3R5B A;  4N27 A;  1LXA A;  1G95 A;  1KK4 A;  4E79 A;  3EEV A;  1QRE A;  3IXC A;  4EAB A;  2XAT A;  1KQA A;  5L6V A;  3IGJ A;  1TDT A;  2Q4J A;  2AQ9 A;  4G3Q A;  5L6S A;  4J09 A;  2WLE A;  3F1X A;  4R36 A;  1SSM A;  5DEM A;  4IHF A;  4HCQ A;  3HJJ A;  1OCX A;  3GUE A;  5DEP A;  2JF2 A;  3R5D A;  4G3P A;  3TIO A;  3R5A A;  1KK5 A;  3SPT A;  4KNX A;  4M2B A;  1Z90 A;  3BSY A;  5ADX V;  4E1K A;  4AA7 A;  3D98 A;  3EG4 A;  4ISX A;  4KNR A;  1SST A;  3HSQ A;  3CJ8 A;  1QRG A;  3GVD A;  3KWD A;  3OTM A;  4N6A A;  3KWC A;  2W0W A;  5E3Q A;  5AFU V;  3BXY A;  3BFP A;  3DHO A;  3R2W A;  3ST8 A;  3P47 A;  4M99 A;  3V4E A;  3ECT A;  1QRF A;  4R7P A;  1KGT A;  2GGO A;  4M28 A;  1YP3 A;  2IU8 A;  3DJ4 A;  1THJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...