4M9CA

Weei from acinetobacter baumannii aye
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MTMIIGVYGASGFGKEVMPLVRQQFPTLSKEQFAFIDDGLSGTTLNGYPVLSYLDFISKPADHKAVTIAIANSVVREKLVSLLEKDGVQHLAVQSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVAHDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQGTPDKPLIIGKGAIVGMGAVVTKSVPAGVTVVGNPARILERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial transferase hexapeptide (Three repeats) family pro
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 74
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m9cA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9cA01
2V0JA 3TISA 1KJIA 3VBKA 1FXJA 3P47A 2RIJA 3VPDA 1TDTA 2R84A 2FB9A 2R85A 1G95A 2W0WA 4KNXA 3DHOA 5DEPA 2R87A 5U2KA 2YW2A 3IGJA 3CJ8A 1HM0A 1V67A 2V0LA 2NPOA 3D8VA 1SSQA 2Q4JA 4HR7A 3FSBA 4HNVA 2I5KA 4MV8A 3R5XA 1YP3A 3TV0A 2IU9A 4HNTA 3BXYA 1KK4A 3R3RA 4EA8A 2CZGA 2OEFA 5ADXV 2V0KA 4L1KA 3FWWA 1PX2A 1T36A 4M9CA 3SE7A 1MR9A 2YYAA 4MAMA 2YZNA 4DCLA 2I8CA 3BG5A 4EGGA 3BSSA 2IU8A 4M9UA 2P2OA 4GGMX 2W6OA 2OEGA 2XCLA 2OI5A 4N6BA 3VBLA 3VPBA 1UC9A 5E3PA 4E79A 3SPTA 4M2AA 3VBNA 5C1OA 4M2BA 1KGQA 2OI6A 1KQAA 2QKXA 3DK5A 1UC8A 2ICYA 1HM8A 2PN1A 1SSTA 4M28A 1EYZA 1MR7A 1GSHA 3FS8A 2WLDA 3VOTA 4KNRA 1E4EA 3R3IA 2J9GA 2ZDGA 2W6PA 2IP4A 2I87A 3KWCA 3FSCA 1AUVA 2WLEA 4G3QA 2YRXA 1PK8A 3JZIA 3R23A 2YS6A 4H7OA 4R37A 2W6MA 4DIMA 1S80A 4G87A 1QRLA 1KJ9A 3EEVA 2P0AA 5D8DA 3OTZA 2FKOA 3E5NA 3N8DA 3VBPA 3BFPA 4E4TA 4M99A 1GSOA 1B6SA 2W6QA 4MA0A 1XHDA 4FU0A 3BRKX 1QRFA 4MV9A 4ZQIA 4MV1A 3LP8A 4MFGA 4E1KA 4J18A 3TWDA 3WNZA 3HB9A 2QIVX 3G8CA 3EH0A 2V58A 4AC3A 3ETJA 4N27A 3Q2OA 5C1PA 4EQYA 1CE8A 5DG3A 1GSAA 5L6SA 4EA7A 1B6RA 3G8DA 4KPZA 4HNUA 1KK6A 3VNPA 5F42A 3R5FA 2GGQA 1KJJA 3ST8A 2C00A 3OU9A 3HSQA 5AFUU 2VR1A 2ICXA 1OCXA 2YZMA 3VBJA 2DWCA 2AQ9A 4K6RA 3LWBA 1J2ZA 3GOSA 5DMXA 2GGOA 3JQYA 3K5IA 3VPCA 4HURA 1KRRA 3JZFA 1DV2A 1KRUA 2W70A 4WD3A 3TW6A 2VQDA 5DEMA 4E6TA 4EA9A 4MV4A 1KGTA 4R7PA 3VMMA 1KK5A 3MQGA 3TQTA 5L6VA 4HZCA 3P1BA 2WLFA 3K3PA 1MRLA 1QRGA 4MZUA 3R0SA 4N69A 5ADXU 2DZDA 3OTMA 3HO8A 3V4SA 3T57A 4G3PA 4IZOA 3F1XA 4AAWA 1HM9A 3U9SA 4MYOA 5E3RA 5I47A 2ZDHA 4IWYA 4C5CA 2QF7A 2WLCA 3OUPA 3R5DA 2R7MA 2JF3A 3KWDA 4MV7A 4IHFA 1SSMA 2YS7A 4EGQA 3TIOA 4ME6A 3U9TA 4AA7A 4E75A 3IXCA 2VD4A 2R7NA 3C8VA 3ORQA 3MJFA 2YZGA 2XD4A 3R5CA 3MQHA 3VBIA 1V3WA 4HUSA 4KPXA 3GVDA 1IOVA 4C5BA 4QSHA 3R2WA 4FCEA 4HZDA 5K2MA 1KEEA 4KQLA 3TK8A 4G3SA 2GLTA 1KJ8A 2I80A 3ORRA 2PBZA 4EAAA 3VBMA 3RV3A 1YP2A 1VKZA 1QQ0A 4J09A 3R5AA 3R5HA 1M6VA 5BPFA 1YP4A 3EG4A 4M98A 4EG0A 1KHRA 4IHHA 3TDTA 4MV6A 1IOWA 2R7KA 3OW5A 2V0HA 2IC7A 1JDBB 2W6NA 4ISXA 2QK4A 1T3DA 3OUZA 1I7NA 2W71A 1BNCA 3BSWA 2WLGA 4R36A 1KJQA 2VPQA 2DLNA 2YRWA 2V0IA 2IUAA 1Z90A 2ZDQA 5H80A 3Q1KA 4EGJA 2GPWA 4MA5A 3QFFA 1C3OA 1EHIA 2OI7A 4C5AA 3AW8A 1EZ1A 2XATA 2GPSA 1THJA 2TDTA 1DV1A 2V59A 1HV9A 2JF2A 3V4EA 3NZ2A 2R86A 3OUUA 3Q1XA 5JQWA 3DJ4A 3FTTA 2VHEA 1LXAA 3FSXA 3AX6A 2V5AA 3N6RA 3RUPA 3ETHA 4HCQA 1QREA 2Z04A 1QRMA 1XATA 3I12A 3RV4A 2PVPA 3ECTA 1I7LA 1CS0A 1AUXA 1KRVA 1GLVA 3V4ZA 3WO1A 3R8YA 3I3XA 4MV3A 3BSYA 3PMOA 3KWEA 3K5HA 3R5BA 3R1WA 2R7LA 1G97A 3FSYA 4E6UA 3GUEA 5BPHA 2W0VA 3HJJA 4J6EA 3MC4A 1ULZA 4N6AA 3I3AA 1E4EB 3FOQA 1A9XA 3HBLA 3D98A 1FWYA 2W6ZA 3VA7A 3SRTA 3WO0A 4DLKA 4RZQA 4EABA 1BXRA 1C30A 2QIAA 3RFCA 5E3QA 4IWXA 4IHGA 5AFUV
chains in the Genus database with same CATH superfamily
1KJIA 3WLSA 5K45A 1J6UA 3OCVA 4J0KA 1I51A 4MYDA 1E2QA 1PZHA 2BI4A 3OHMA 1LBIA 1QQ5A 1WD7A 2GAAA 2KWIA 2Q1YA 4IIEA 4CR6A 5C7OO 1EA7A 5ENDA 3ZWOA 3P19A 5IMBA 2QRVB 2EQ5A 4YJ2B 2I4NA 4CMEC 3D3WA 1YH3A 1JT2A 1NUSA 3CCBA 4BE4A 1JYEA 1VE7A 3PUWA 5AUOB 4CG0A 3OSZA 3W4IA 4ZI3A 2PZEA 2H2FA 5BY2A 1QTNA 2NPOA 4R8SA 4RW0A 3RS7A 1NJFA 4E2YA 2XCTB 2ZXEA 4GUDA 2NYRA 1ZIXA 2UUAB 2AG8A 2G9ZA 3SHTA 2Q4OA 5HJ2A 2FPRA 2HHHB 3ED1A 3LGAA 4MV8A 2QPOA 4Y2XA 3MGGA 4UOZA 2XB2A 2QVZX 1L1RA 5FORA 3GOHA 1J2JA 3BREA 3OT4A 4JQSA 4KWHA 4WZAA 4A1FA 4AO8A 5CB0A 4BO8A 1CRLA 4NJMB 1DFHA 2ETVA 3DBHA 1M6NA 2PT5A 4Q3NA 1AM4D 4XJTA 2JZCA 3KBBA 5JBNA 3KXKA 2DP4E 2G9NA 3LSYA 5E1MA 3PKIA 4MS4A 1T6ZA 3X2SA 2NTYC 2O1WA 2AEMA 1T5OA 5HKOA 2XUPA 1UXKA 2D1SA 3MUEA 4QPJC 4UVGA 3CZCA 4Z9AA 1QP0A 1EJBA 1PQWA 2QI9F 2OV8A 2ERCA 3MJ4A 1WPRA 4CG2A 5K7SA 5EKDA 5IF9A 4POOA 1XMQB 5KVSA 3N39C 2Q2QA 4MAMA 2WWVD 2A9RA 3VNRA 5K0BA 1RYYA 4DCTA 5I51A 1OI4A 2Q29A 4ZT7A 4PG8A 3H19A 3J7TA 5I4CA 4EGGA 2CLLB 3DMPA 3ICEA 3TJMA 2GSDA 1XYYA 1XNHA 3DAGA 1ND5A 4I2NA 3NATA 5IH3A 3T7IA 4QDUA 2ZYRA 3AEUB 4AKSA 1L7AA 3E8MA 1MLDA 2I67A 2ZPUA 4X8HA 1NVDA 3IV7A 2G6BA 4NH4A 1FMLA 1HEUA 4WY2A 4MROA 4CQNA 3C14C 2R1VA 1S2LA 4LOKA 2CWDA 2VRCA 1EFKA 1A4XA 2VPXA 4N54A 1U4NA 1XZHA 1Z75A 4O2RA 3Q9UA 4RJKA 1XVLA 2YL2A 5K0TA 3H9GA 3BD6A 3WSWA 3HO1A 3IH5A 4UDXX 5ULLA 3SZ3A 5TT0A 2HWYA 4DLUA 1IMOA 2HQRA 2X22A 3ND7A 3NEYA 4MQUA 1IXRC 4YRPA 3D4OA 1P8JA 1NN0A 2WEKA 2QKXA 1RP1A 2D1RA 1UC8A 2ZBDA 2VXBA 3FR8A 4R2HA 4B7ZA 3LXRA 5CFMA 3OVMA 3ZXIA 3VX4A 1DIBA 2QLBA 3CU5A 3K73O 4ZKDA 2Z43A 2ZIWB 3VH3A 5IRCD 4ARBA 3PHJA 4TKMA 5HBGA 1VZ3A 1WWKA 4GH5A 4BPRA 4URZR 4AM8A 2WTEA 3LE8A 1HTBA 1Q0HA 2CXXA 3HJGA 1GU0A 2PEYA 4TZKA 2OHFA 1YQQA 2FR1A 1WZUA 1ZNXA 3LRTA 1GG9A 2IHKA 3T8YA 2J3LA 3H18A 4EMBA 3H3JA 3SF8B 3HR7A 1WDKA 2I6QA 2ZRCA 2I4IA 1I7SB 4Y3UA 1II8A 2XAAA 4HGYA 2VK8A 2Y71A 2JFOA 5AW9A 3LQKA 2HBRA 2ZSJA 5IYZB 1A71A 1U81A 3DKRA 1TQDA 3QXSA 4DB4A 2G40A 2C4HA 1GRVA 1J24A 1MJNA 2ZBGA 1FUUA 4OV6B 2LNDA 1VPTA 2NXEA 2XQIA 4MR7A 3RK1A 1Z17A 5CDFA 4ZVNA 3ICOA 4R2XA 5CDYA 4MRSA 3DAPA 3B20A 1SKAA 1VSVA 1P1HA 3F8WA 4B2IA 4O1HA 1C2TA 3U3JA 2IXEA 3W1WA 5A4KA 5KSWB 4O02B 3FDZB 5FJIA 1NP3A 1I4LD 1RKQA 1WO8A 3EFOB 4RTLA 3OX2A 3NHLA 3GLSA 2P5SA 3N8DA 3FOCA 3ZTYA 2VDMB 5IVPA 2ALJA 1MEJA 2PQMA 2J31A 2WIDA 1P5JA 4J7CA 4UCXA 1GSOA 4Q9JA 1SXQA 1RXVA 2RI0A 4IFBA 3NEPX 4EPYA 3CVWA 1P3DA 3BXFA 3CLSD 3GUHA 4PSVA 4RPKA 1U98A 1JEEA 1XKLA 4URFA 5E8RA 4BVEA 3AHJA 2ZR8A 4Y2YA 3RUDA 4E33A 3REGA 3G1TA 4ZAXA 3U4AA 1YFJA 1OUMA 4XEHA 4DLYA 1D2CA 4MV9A 3W9SA 4ZQIA 5E2IA 5K6TA 4KAFA 3JQBC 2D5CA 4Y6GB 2ZROA 3RK0A 3EPJA 4DCMA 1BQ3A 2GASA 2HU2A 3P4YA 2H0AA 1OWPA 4F8YA 1Q74A 4FXOA 3ASVA 5DCWA 4Q3OA 3HCNA 5J59A 3WGZA 1TTTA 2W4IA 2WJIA 1J2EA 1M1UA 1ZIDA 2OQIA 3BZWA 2Y0DA 4MWCA 4US0R 1Z6PA 3R7LA 3P96A 1E4YA 1UIRA 4IHAA 1NVWQ 4KN8A 4B6GA 1G20B 1RLUA 2CLEB 1EXNA 4IG4A 4HX2A 4OMDA 5L3QB 2L19A 3W5HA 2O2JA 3AZOA 3D6MA 4DSAA 1DS6A 1HT2E 4J0HA 2X1HA 3MOSA 1N9GB 4N27A 3MCZA 5K8UA 7ADHA 5TDHA 1K08A 3KLMX 1IQUA 1BXRB 1QE0A 4EYQA 2FGJA 1II0A 3NHMA 2A8YA 5F76A 1VXOA 1EGHA 3MQ2A 4HPXB 1YQ9A 3VTZA 5J63A 2AOTA 3QVVA 1RXWA 2P3SA 4NDZA 5AQEA 2QP9X 3LNCA 5EJIA 5DRTA 3TTTA 4HNUA 3AFHA 4MWDA 5HE9A 3R5FA 1G9TA 5IC5A 2UVQA 4CBVA 1AKUA 1K98A 2GD1O 4MWTA 2WU4A 3MSCA 4ZPJA 5AFUU 4Z9XA 4ZVOA 3TBFA 4ZZ1A 2VZ8A 3PFKA 2DWCA 1RWQA 3AI7A 5CX4A 5G4KA 1KE1A 5G3ZA 3DE1X 1MRNA 4ZXFA 2QSUA 4O0MA 1RTKA 4PFKA 3W3AA 5KAMA 4F7WA 3PIIA 1EBUA 1MOQA 3LDUA 2Z6VA 3Q6MA 4J16A 4WT7A 3MWLA 5DCLA 2Y2VA 4ZVMA 1O6BA 2VPZA 3UN1A 1VIYA 2G7MC 3CF2A 2XNDA 3CLUC 4J2OA 4AO6A 4COKA 1P7VA 3DDOA 4ZEOA 4RKEA 3N28A 1FNNA 2VFAA 3GRFA 1K2WA 4HC4A 3U7FB 1YZKA 3JCZA 4CR8A 2O4CA 2B3DA 4J8PA 4KDRA 3N05A 4MS1A 4X3CA 1Q77A 3WWOA 2O23A 3AVXA 4RF3A 3EXEA 1L4FA 2PT7A 3SQMA 5JNLA 1TUBB 5DEMA 4JEUA 3TDKA 3WMRA 5IEJA 2AOWA 5DK4A 4C3ZA 1TEZA 5GWXA 3DVLA 3TN7A 1P2FA 5KSPA 2P9CA 1G16A 3MXTA 4HI0E 3S29A 4PXYA 3I01A 3T38A 1OHHD 1SO8A 3L02A 4R7PA 1IQ0A 1YV9A 2EX1A 3FDIA 1SAYA 2FFBA 4NQRA 2I22A 3MNFA 1VMIA 3RIHA 1PS0A 1EDEA 2C2WA 2XQJA 3KQQA 2J4FA 4NBRA 4HZCA 1G3IA 1YHZA 4WNAA 1XLVA 3A6HA 1KI7A 1VBMA 3AB8A 2I7VA 2NU8B 4HH0A 4MS3A 4LGCA 1BDBA 1L5OA 1SOWA 5KSZA 2ZYVX 4LTDA 3U48A 1UZAA 1RLOA 3ZVRA 3HK2A 3B7GA 1Y4AE 3QFSA 3R44A 1E2NA 1PG2A 4KGVA 2AR0A 4YIKA 1G3RA 4DV6B 2Y99A 4LRXA 4UU7A 3IEVA 3ROKA 5FF9A 1K4MA 3MCVA 3F1XA 3QKTA 2O8FA 1UK7A 4ODIA 3JD0A 1NQTA 1C7FA 2CMGA 2EZ8A 3IQXA 5LQRA 2H7YA 4HAXA 5A0TA 4DG9A 3KAKA 2VA8A 1LD3A 4QXOA 1RJDA 1D6SA 3I01M 2QVLA 2ZQZA 4AY5A 4P4LA 3ZHYA 4KO4S 5K3FA 4TM7A 2A9FA 4RLSA 1KSJA 5GGXA 4CLRB 2ZRPA 5BSTA 4CLOB 1R4NB 3ZC3A 2WHEA 3K9GA 3E3NA 1RHKA 3TAXA 2W4QA 4BJ1A 5ERXA 4IS2A 1R64A 2O8BB 1FLAA 5E0KB 1H94A 1VG8A 2O2DA 3EZ7A 5EPEA 5K0ZA 4HLDA 1MORA 2OD2A 2PWYA 3M5DA 7REQB 1U0JA 1LQUA 2UYOA 4E5MA 3HU1A 3Q6IA 4C7MA 3LVQE 4MWEA 2OP0A 3VKVA 2SHKA 5MN5A 5E9JA 5TRTA 2L17A 3D6VA 2YBDA 3NIBA 3PLAE 1IEXA 2WIFA 2YZGA 4U7JA 1OBCA 4PCUA 4C29A 5A0FA 5FWYA 3MQHA 3HFJA 4MI9A 3JQ8A 2YWXA 1K8RA 2AJTA 3N0RA 1H65A 2E82A 4FLEA 1W93A 3SXJA 3TOVA 4P7GA 3VR0A 3C98A 4G8CA 4JP8A 4YRKA 3IOBA 3S4YA 2J6IA 1I6LA 3TK8A 1YKFA 4ZAFA 4HKTA 2BCJQ 3QU2A 3IUBA 2XE4A 5TQVA 1RZRD 1DCMA 4TTSA 5HQ3A 2XCSB 3CZ4A 1J06A 2I4MA 4C7KA 5BUSA 2CUNA 1ID1A 3G2PA 3QXGA 4GF5A 2VK1A 5AOVA 3RPEA 5CDGA 2QM7A 3ZGYA 1SB8A 5BQXA 3B89A 1LBSA 2IYSA 4G01B 2Y9MB 5I7EA 3V2GA 1CF2O 5GONA 1PKXA 2R11A 1GAXA 3BB4A 1T0UA 5ALQA 2DERA 1D4ZA 3W5IA 4C0WA 4FKBA 1UM9B 2HQOA 3P9SA 4NNOA 3WLMA 4LBVA 4OBBA 3LPLA 3KYCB 3UQYS 4BO7A 2CT8A 2ACKA 2BFCB 1WVMA 5KSOA 4HDRA 2J87A 1XTRA 3KSDO 1W581 4MLCA 2HQ1A 4K88A 4K8OA 5BNFA 4TXMA 2X5OA 4Y9RA 3DCIA 3H11A 5F1KA 4Q4HA 4O6VA 1JKJA 1SCDA 1AKVA 1Y6GA 3IQIX 4KBGA 3BMNA 4ZCSA 4B6FA 1V95A 3BSWA 4KX3A 3HU5A 3SBEA 4M55A 1Q3TA 3ZK9A 5A2QA 4R71A 4GMGA 4DJEC 4R16A 4BE7B 1BE8A 4CKEB 2ZDQA 4OHKA 1SCAA 4DLLA 3AHFA 2HO4A 2D62A 3CCFA 3MT7A 3GNTA 4Q7EA 3CRZA 4YV7A 2GPWA 1E8DA 4EM6A 1DIRA 6GPBA 3DG9A 5F4BA 2DQYA 5DBEX 3LFHA 1Q16A 2BI8A 4R2JA 1O4VA 2QJWA 3PNYA 3ANLA 3IRVA 3LDHA 1I3CA 1BCRB 4EVSA 1OOEA 3IURA 1V3QE 2XR1A 3BERA 2TDTA 3A14A 4YCAA 1CUYA 1X7ZB 1J70A 5BNZA 3F6EX 2BHTA 4B73A 1HV9A 3NVAA 2GRAA 2A0WA 4IFEA 1BCSB 1Y7HA 4MVCA 4BVGA 1JSRA 3LBYA 2PUFA 3EGOA 4IJKA 1SBNE 1MT3A 4FEGA 4EJSC 4I4LA 4DHWA 1OB5A 2CXQA 5EJ6A 2OHGA 2WG1A 2X9GA 1UIMA 3K96A 1Z15A 2V7VA 3T99A 1X74A 3OF5A 4R9VA 5LC1A 5BMVA 3QA9A 1T4MA 1DB3A 1R7RA 1GRNA 2ANBA 2JJMA 2ZYSA 2MTBA 3ACDA 3GO4A 4J07A 4R9UC 1XVAA 2J3JA 5CPFA 5E4TA 5EHZA 3GAZA 5B3AA 3ZIDA 3ZU2A 3UMVA 4QUBA 4BKUA 4DS3A 1NUAA 2HUNA 1ECFA 2R60A 3HKEA 3KUUA 4NATA 2E2WA 2NXWA 3DEJA 3I45A 3PNPA 4LZNA 2EWMA 5LZ9A 3HABA 1RZUA 1PFVA 1AK1A 4L9SA 4C4TA 1XALA 2QW0X 3FPCA 4DCSA 5C35A 3WBJA 1OZ0A 3ND8A 3GBSA 1TUGA 3NUGA 4KNVA 1CV2A 4R2KA 3LH5A 4RD3A 4WASA 2NSHA 1V5GA 1X0XA 1ZSNA 2ADFA 2R00A 3SC2B 1DKUA 3C8ZA 3QWIA 3RSQA 4XR9A 3HDVA 5A03A 3AQIA 3NJRA 3R1WA 2DBRA 3AEQB 2PY6A 4QUJA 4MR9A 3FUXA 4Q6WA 2GSWA 5JJCA 5HRCA 2R7LA 5THXA 2NTNA 4PFJA 5A7GA 1J2YA 3VSCA 1ZA2A 2D0PB 2GX6A 2FWRA 2GNPA 3HA5A 1XDDA 1Z0JA 3D3NA 5L95A 1DRUA 5C5DA 1WHSB 1YZNA 5AI8A 4NNPA 1D9XA 3ESAA 3NCTA 4KG7A 4ZAYA 4F1JA 5K09A 3TBHA 5EXXA 4UNIA 5JC8A 3DE7X 1UPCA 1JUDA 1MX9A 4EFMA 5DTQA 3MBKA 3S81A 4KQ2A 3LY5A 1ZICA 5L6MB 3FOEC 5L51A 1XDSA 2Q3EA 5ECGC 4Z6KA 1EFCA 4OSOA 1E7WA 4QDZA 4OOEA 3B6IA 2RGNA 4L5IA 2XITA 2GESA 2Z6QA 2B99A 2OYRA 4IEEA 1G38A 3SVZA 1XDBA 4HRVA 3BCUA 1SD1A 3ISVA 4Y98A 2QYOA 4YAEA 2ZIXA 3RVQA 4FS3A 2XB6A 4J0FA 4XVRA 2QTZA 4O2BF 4KHPB 2G9RA 3G0DA 4HYTA 1O8CA 1V0JA 4YJ3A 1FS5A 2XZPA 3P9CA 4IH9A 3P47A 1YNOA 3TAUA 4ZZIA 4II2A 2IUEA 4KQHA 3WZLA 2H2IA 2L0XA 2WJ3A 5NULA 3GBVA 3NFYA 3OIWA 4EI8A 3LI2A 3TUZC 2ZCJA 5I6DA 4K2AA 1UQRA 3M6IA 2QGNA 3DPSA 1DIAA 5BRNA 1N8KA 4B76A 1NTOA 3L82B 4CN8A 5DM70 1YKGA 3CF4G 1D5WA 5E6SB 3JYQA 4OHRA 1GPNA 3C1OA 1I01A 4X66B 3FKQA 3TCXB 1L4UA 1MCZA 2VF4X 2X40A 4CMIB 1ISRA 3C1TA 2D2IA 3HYSA 3RABA 2H1OA 3HU3A 1FVHA 1ZU5A 1SSQA 2Q4JA 3VYRB 4WJLA 2PLRA 3YASA 3KUXA 4G1UC 1RFLA 4N03A 2VPIA 3TLEA 4UUQA 1YR6A 2J0UB 3K1TA 4FYJA 1UT8A 4BJ5A 4ER7A 3U31A 1ZK4A 4QT0A 1V47A 4N8SA 1PTJC 5A9SA 1JSCA 2WHPB 5AICA 4BKQA 1LRJA 3TUIC 2GUWA 1Y3HA 3IVRA 3L0CA 1I0IA 2HQBA 4GI1A 1IM2A 4IRXA 4W9NA 2FWAA 4JSTA 4M1QA 4EHKA 5C52B 2JFVA 1U90A 3AJDA 5GOTA 4ZJUA 4AKGA 3QX3A 3WLOA 3BD7A 5CAEA 2Y8EA 4JLJA 3U7RA 2EFCB 3OZIA 4Z5XA 3ZWBA 5ALGA 4RIHA 1XTQA 2E21A 2ID7A 1HA3A 4GSLA 3ADDA 4MMYB 5IN5A 1F9AA 1AZLA 2QT1A 1MO2A 1WQ1R 2HCTA 2IPNA 4CRWB 3EW9A 4DM7A 1R37A 2WB4A 4BKRA 5KQRA 2OK8A 3H2HA 4EG5A 2OCAA 3BA1A 3QKSB 1PQ4A 4CV2A 3STTA 2VYQA 1C3JA 1RWBA 3I9OA 4DCLA 1WW3A 3BSFA 1O6CA 2C2YA 2KHZA 3HVHA 4GZ3A 4MQ4A 3RVPA 3CVXA 4Q1EA 2VP5A 3QWBA 2EIXA 4PTLA 1V11B 4JLOA 4JCCA 1BKDR 4HSGA 1L5FA 1WLYA 1QQ7A 3DV2A 3O8OB 2OCDA 4IAOA 4OYRA 4PR0A 1OASA 2MINB 3CZ9A 4HGPA 4TWAA 3BXXA 1A2KC 1OC4A 4WXRA 4WCFC 4K1LA 4K26A 1OAOA 1KDTA 2CLIB 2WMDA 3OZVA 4C04A 3A6EA 3MWEB 5ED4A 4KYIB 5IKPA 3QXJA 1E69A 3KEOA 1DOHA 2CL0X 4O8ZA 1GPDG 4MW1A 5LIRA 1A4IA 1WNFA 5FPQA 1EINA 2XRMA 5ALRA 4CLXA 5AVTA 2GZSA 3EYAA 3AIOA 3HQ4O 1YUNA 4X1KA 3N8IA 1FSFA 5AVJA 3QVUA 1JHRA 5FPSA 3V8MA 2VL7A 1Z4MA 4TOIA 5K51A 1VE5A 1KO7A 3FD8A 3WX0A 1UK8A 2HV8A 2DWUA 3EG5A 1NR5A 3QYFA 3BGDA 1HURA 3QG5A 3I4CA 4M49A 3ZK7A 4A4DA 5KYNA 2QHXA 1Y89A 4IJVA 5IH7A 3F9CA 4RK4A 3R8CA 5I7AA 3C16C 3INRA 3IVCA 3KR2A 3CNOA 3IRUA 4PQYA 2W22A 2WLDA 1ECBA 1E4EA 1ACJA 1Q19A 2OFFA 1GLNA 1IJFA 4BC1A 4ARCA 4OXNA 1KO5A 2I2BA 4LIPD 5DO9A 2V0GA 1QP8A 1M75A 1OHHA 4LI3X 4Q4DA 1EVZA 4LSGA 3V46A 4MRAA 5JS6A 3W7VA 3CS3A 3OEWA 1C4KA 3CHYA 4G5HA 2OAGA 2A5GA 1Y1PA 4FS8A 4N9QA 5AHWA 5D3ZA 4MOWA 4PYIA 1YRAA 5DH9A 3U4DA 4YAJA 1P7CA 4BBPA 3VU1A 4XVQA 2YY7A 3HPRA 4DCVA 4DF3A 4EG7A 2PGXA 1D5CA 3L4BA 3OO1A 3S0JA 4YUWA 3OZWA 4NHOA 4P3KA 4OP2A 3ZW8A 4CFYA 4HAUA 3T3NA 4ZCMA 2AN5A 2LBPA 2ZBUA 3DD5A 2CXUA 3JAKA 3KT3A 3ILVA 4LZZA 1XQ1A 2FCAA 4UE2A 5AM0A 2R7AA 2ZRDA 5F1YA 2F3UA 4TT8A 4W6QA 4G87A 1LTKA 3EDOA 3MAGA 5D3QA 4Z0TA 3UWOA 1WTAA 1Y33E 1U7UA 3RC2A 3VKHA 4PZPA 4RMNA 3OTZA 3SFTA 3UFBA 3V7UA 4LHSA 1MQAA 1HGXA 1B4DA 3EVBA 2KB0A 2XPCA 3FG9A 1B42A 4EELA 1JN0A 4ZGWA 4OI1A 1ZD4A 1P19A 1U1FA 3PXBA 2WYUA 1BGXT 1MOPA 1V7PC 1XWFA 4GP9A 5ELLA 2VDVE 2DPYA 2ZIZA 3ADPA 3IULA 4GPIB 4IDOA 2D5LA 4MA0A 4AG5A 3PITA 5I4BA 1C3LA 3OLWA 2QOEA 3D2CA 1LI5A 1NMQA 3H99A 4IQ4A 5ALKA 2GBLC 2JIBA 3PXEA 1V1MB 1RMYA 3R2JA 4BGUA 2XGGA 2ZYWX 1PW7A 1PT8A 2QYSA 3N7AA 4R69A 4CTJA 3U3OA 3LW8A 1G9SA 1IHUA 4R3WA 1EFVB 4J0EA 2YYZA 4YK7A 4MFGA 5BR1A 1MX5A 1S1CA 1DZ3A 1JQDA 1K2VN 2RHLA 1JI0A 4KYTA 1LSSA 3FBWA 4DG5A 1GPH1 3D31A 4B79A 3H8JA 3E9YA 1FVOA 5JVDF 1E1QA 4WBSA 1P2GA 4NBUA 4GPAA 1JBEA 2VYND 4Y9DA 4CF5A 4F6RA 4UTNA 2PUAA 2CN1A 2X1MA 1IJBA 5CFQA 2P6OA 1THTA 1J0CA 1P1BA 2ILTA 1JFTA 4WGFA 2O3RA 1L5YA 4CIVA 4IG9A 2JGMA 5E0OA 1MB0A 1XLUA 3DOOA 5BW5A 3W6OA 4U2GA 1LLQA 4CKYA 5EWJA 2QTCA 1VLMA 3H05A 2DR2A 2QKYA 5L6SA 1C50A 2JBWA 1OLSB 2IK8A 3GWGA 3PQEA 4AKEA 3F97A 1NQ5A 3G8DA 1RZRA 3U7GA 3SFVA 2DULA 3KZCA 4LC9A 4BFYA 1DQYA 5CYFA 3RHFA 3RVDA 1NRJB 4D96A 2HH9A 3RIEA 2G80A 1ZPDA 3H1TA 4B3SB 1PJAA 1JHDA 1KARA 3SU8A 3VAZA 2TS1A 3EIQA 3OQHA 4OFZA 4TYWA 3HJRA 4Y0VA 2GCOA 3CEPB 3GFTA 4LF4B 2Y1DA 4LECA 4I4NA 3K0CA 1UJ2A 3EQZA 2EP7A 4CM4A 5JNRA 1U8TA 2HPZA 1SVNA 3RYIB 1W1WA 3NLLA 4QQFA 3EIEA 3MMXA 3ANNA 4KIGA 5JALA 1KU6A 2QLNA 2VUIB 5KWSA 3PIDA 4RSRA 1Y42X 3ORFA 1NR7A 4EENA 2D0OB 3EQ7A 1T8UA 4GS5A 3FF1A 4UC0A 3I34X 3HJNA 4BN0A 1JJAA 1RM3A 3WB0A 1BN7A 3IA2A 5KB3A 2BM8A 1W1UA 5C8XA 3FMGA 3KQHA 1VXRA 3VKWA 2WOOA 4B8YA 4L6AA 2WG0A 5GVRA 2KBEA 4EZIA 3BDIA 5B2ZA 4L4ZA 5JJIA 3I9KA 4DEYA 3TR0A 4MRMA 3UJBA 4WLNA 2H1CA 5KX5F 2EBWA 2O8DB 2FW0A 3GEMA 4YI5A 2KM1A 2APJA 3A0UA 3ETCA 3VX3A 2YOHA 3HM9A 2BHRA 2V7WA 3A4NA 4NPHA 4W5QA 3MQGA 2IYPA 2XKJE 3TNDA 4F8EA 2G3YA 3VNSA 3WL6A 3A4LA 1AQ6A 4GL2A 1TJ3A 2K7ZA 3FUCA 4AJIA 1VKJA 1N6KA 1XBTA 1MRLA 3QW2A 2VHUA 3LQ2A 3RBXA 4JKIA 1KFJB 4NFSA 4N12A 5F2EA 3WDSA 4PHHA 2CFOA 2J48A 2OO5A 3GLFA 2ATVA 2AWOA 3ZKWB 1E2EA 1G1MA 5FI0B 5KYTA 1LV7A 2WSMA 3D43A 1QHIA 2ZUSA 4XXHA 1POWA 2Q2NA 1RIFA 3MSXA 1VE9A 3THOA 3I32A 1YOBA 1NSTA 4HN4B 4N5HX 3SJAA 1Z5PA 3RO7A 1XXHE 2MU1A 4MB2A 5JJBA 4ZP1A 1XZ8A 2EZ4A 5IVIA 2EKPA 2BUBA 4B4UA 4TLEA 4ZDWA 1E9CA 1XWWA 2QF7A 4KQ1A 4OJTA 5EGSA 5K0SA 1QOPB 3RJMA 1OKKD 2BKVA 1BFDA 3ZY4A 2CBZA 5TGZA 1Z0AA 1TTPB 1MFPA 1CS0B 3O83A 4F4IA 1ZD2P 3ZZNA 1F38A 1VLVA 2YXNA 5B55A 3DL7A 1OLXA 2P9BA 3R3SA 1V6AA 5A5VA 3NTQA 3MJDA 2GJ8A 5DGXA 2ONYA 4LDPA 3N5CA 1WU7A 1GPJA 3HKCB 3LP5A 2VJAA 2GHQA 1NQOA 1DWQA 5FAKA 4PYKA 1WSBA 4D41A 2GS9A 3TJRA 4EOGA 1YIDA 1BYUA 2MIIA 1EWYA 4X00A 3TDMA 3M82A 4URVR 3WRYA 2VDKB 4TKVB 1FIUA 2PJRA 2GK6A 3A1CA 1IPHA 1T8SA 4B34A 1C8BA 3H4MA 1CNEA 1Y0BA 3HS3A 2CJXA 2OFPA 2CLFB 1P2SA 5KYWA 4HWPA 4KRYA 1Q6ZA 1UQUA 4L8WB 3E84A 4I1PA 4DRZA 4GC9A 2LD4A 1KBOA 4TRRA 4V0NA 4LY3A 5KJFA 1QE5A 2RGYA 4UU8A 2CXNA 1HXHA 2QE7D 4HDCA 1PLKA 1G8SA 4EITA 2COEA 3DF7A 3ZQJA 3KLOA 3WMWA 2B61A 5IUNC 1JPVA 3JQ9A 4MCIA 3ST7A 3FJ1A 2PAAA 3LGXA 5IAKA 2DUNA 2YWBA 1IM8A 4C88A 4CIAA 2JIZD 2Q3HA 1YAJA 1PU2A 1MA3A 3EA0A 1P4AA 1ZRHA 1E1LA 4OHFA 4QELA 3RFFA 3IP6A 3NHYA 4MCHA 1AF7A 4ISCA 2Z3ZA 4GP6A 2GTPA 4LNUB 4YXFA 3K2BA 3OE7D 1W1IA 2OB1A 4IDNA 5H7XA 3HBFA 3ZHCA 1E18A 2JFPA 3CF4A 2O7RA 2P3LA 3TRDA 5I7WA 3AEUA 2ZM5A 4U9UA 5LLSA 5AIAA 5K0CA 3A1SA 3QVJA 1OX6A 5K0NA 3T3PB 1JDBB 3WHPA 4YRMA 3B6ZA 2HSZA 2WUVA 5T57A 2W83A 1C7QA 1PJBA 4O29A 2Q3JA 3RT9A 4DXAA 1UEJA 1I4EB 3E9MA 4D7AA 5B2FA 1CQIA 2WLGA 2BEVA 1XAIA 2O2ZA 5CGZA 2LIPA 1FFDA 4LXQA 3QI7A 4DV0B 2QORA 3SLGA 2IUAA 4LYEA 1NUQA 3SDBA 4C05A 2V4ZA 1W5EA 1ZOOA 2WUFA 2IWHA 1HEYA 1NR1A 3AP3A 1U7OA 3VHQA 2O19A 4TV8A 4KZKA 3G2MA 4X91A 4LV6A 4B8WA 4OJQA 3KZVA 3VR6A 4FFLA 1Z0UA 3FNFA 4TRMA 3EY4A 4QOGA 1JEYA 5T4FA 1TRHA 2B94A 3O2JA 3UUGA 5F5XA 2VJNA 1N0HA 1YR7A 5ITZB 4RK0A 1GWNA 3EDYA 4QDXA 3FCXA 4HUTA 1M6WA 1NLFA 2GDZA 2EJUA 2OG2A 5DW0A 1UWKA 4W1RA 4OUDB 1GNLA 3GCXA 4WCFB 1NOIA 3I83A 5D2CA 2DCMA 3HCWA 5FXMA 3BT7A 3F78A 1TIBA 1MZVA 5EQTA 1XRJA 4ZN6A 5FBZA 1YDFA 3IP5A 4DA0A 2A59A 1IXYA 2INGX 1T43A 1XVVA 1GEEA 2VJQA 2Y67A 3GZNB 3G2LA 3FVQA 1RBQA 1X92A 3C7AA 3OM9A 4H1TA 1E61A 2G5PA 5CFRA 3AG5A 4ZTBA 3UT0A 2BSQA 3RWMB 1G2QA 3A36A 1R8JA 3TLAA 4NULA 3RV4A 1XP8A 2KBFA 2IS1A 3IP1A 3PNLA 3PUXA 1L7NA 5C5EA 9ATCA 1I7LA 1KH3A 2HCFA 4RE5A 2G17A 1U0HC 2AR9A 3O95A 5LP6F 2VHCA 2QJFA 3VDMA 4Q9DA 1EWKA 2EZTA 4UHBA 4RTQA 4AWAA 4RY2A 3CEMA 3RRMA 4H7JA 4DQXA 3R0IA 2PQ6A 4M60A 3OQVA 1K86A 1AOXA 1SVKA 3V4VB 1AMOA 3DCJA 4X1IA 4BNGA 5LQCA 3DHVA 4WVFA 2EKLA 3CRQA 1ZS9A 1EK5A 1OFVA 3H8WA 1DP4A 1FYXA 1HE4A 3DTTA 2PSDA 1DNPA 1XK7A 1G97A 2WIKA 2BM9A 5EVCA 3JD1A 3T7CA 1Y1RA 2XDWA 3AHIA 2HQSA 1W34A 4X8MA 3LOUA 3SDZA 3FWNA 3TIGA 5SZKB 4LRUA 2GCIA 5LQNA 2JCXA 1EESA 3MQ4A 4FYKA 1NBHA 1ONNA 2ONKA 4L85A 5CPBA 5K3DA 4LX8A 1HG0A 4K6KA 2BFBA 5G40A 4IJ6A 2NZ2A 2QVBA 4OFBA 4AMZA 4KKVA 4MYHA 1XZMA 2CMFA 4TRJA 4P4SA 4E2WA 3E22B 4JJAA 4EX6A 1AUQA 1XO1A 5KPDA 4MVJF 1DO0A 4K6FA 1BS9A 1LV8A 2UZ1A 2OHOA 3E1KA 4ALLA 2OCLA 1Z2NX 4YCCA 4HHEA 3CLUD 4CGYA 4DSNA 2E5WA 1BXRA 3A9SA 1FFCA 1YZVA 1F2VA 1BWRA 1M10A 4II3A 2B4RO 2NP6A 4YIHA 4JI4B 3VGJA 3LPDA 3B53X 4X8OA 1XEWX 5JAOA 2PO7A 4TL6A 3QELB 2HL6A 5ESDA 1SU6A 5KYXA 3VBKA 4DR4B 1JG7A 4ZT5A 3PGA1 2W7TA 5IJXA 1S4MA 2BL4A 4HS9A 1S2DA 4J1QA 5GJVC 1GDHA 3WICA 4TXJA 3X1YA 1ZZEA 3QBJA 4MPDA 4AP9A 1NW4A 3L8FA 2GWRA 1JWLA 3MBIA 1NP6A 4CMBA 3IGFA 5J4YA 1O89A 2ORYA 3BTUA 2PCJA 3AI1A 2QBYB 4FI3C 3TSYA 4HDMB 1E9VA 2VDJA 4AZ3A 1EHYA 4NOKA 4TYMA 4HGQA 4ZC8A 2IYWA 1P5FA 4XI9A 4YYZA 4G0UA 4ETNA 3OPMA 4Q15A 4MMZB 1YQUA 5EC8A 1ENOA 1EXMA 2EFHB 1X1BA 4DRXB 2Y0EA 2VQ6A 5HSGA 4EKEA 1L5MA 3LU1A 3ZQKA 2I2AA 2VSYA 4JBLA 4AY2A 3PD1A 1N4AA 1TYEB 3E7XA 2NVUB 3VR2A 3TM5A 4FQ7A 4EEKA 5JADA 5DT2A 2E85A 2MJLA 4IIBA 4BGIA 5HEKA 1XNRB 2XMPA 4XGKA 4AXXA 3IAHA 3PHIA 2QX4A 1FLNA 5HQTA 5KTSA 3GFPA 2QRZA 3LPAA 4JENA 4DUYB 1GVHA 4CMHA 4XQGA 3K05A 4D9HA 2TMDA 1DUVG 3HXPA 4RABA 2X8AA 1IDN1 5I7RA 5A02A 4BMOB 1KAGA 2R6DA 3GEGA 1PVDA 2B69A 2JK1A 3JVEA 3NTUA 3QP9A 4MCAA 5AK6A 2PL5A 1NU8A 1KQOA 3KAJA 2V0KA 4QUHA 4Y0AA 2VDPB 3CSSA 2GNOA 5LB4A 3TLBA 1TYAE 4M1EA 4KN6A 3GG2A 5KSYA 2Q28A 2IH5A 1U1CA 2Y1EA 1ZK0A 1E64A 3AUXA 1CJMA 2QVCA 3DWFA 4CUZA 1GTZA 4P8RA 4S1WA 1PV1A 5CU7A 3N2LA 3RFUA 3F6SA 1E7QA 1LBEA 3WNDA 4DKJA 3NIWA 2RC5A 1X7WA 5BV0A 2O7VA 2OO7A 1E1YA 1MB9A 2PPLA 2EW8A 1NIJA 5HYVA 3ZZMA 3IE1A 4LJRA 3L01A 5DBIA 4P4NA 5LDDC 4BZPA 3UG7A 2PK3A 1JPNA 2CJWA 3VNQA 3DBRB 1E5VA 1L4GA 2FZ5A 4M83A 4LJ6A 4WEQA 1L5QA 4BEVA 1T6NA 3IOCA 4FJ0A 4ENSA 4YRGA 5ECYA 1ULAA 3OC6A 4QWMA 5AKZA 2Q0XA 4X3PA 3CG4A 4OKIA 4YLYA 3KT8A 1LTHR 3ZCSA 1NBOA 3B6KA 2QUZA 1OXTA 1U3VA 1S8OA 4E79A 2XE7A 3JY6A 3LKDA 3SPTA 1CY8A 1QYXA 3MOGA 3VBNA 3ADKA 3K72B 3QNWA 3DZFA 4JP5A 1ORIA 4LOHA 4UCWA 3I6IA 1TJYA 4TQ9A 4JQYA 3OX3A 4KO1S 1HI9A 2BEWB 3P9NA 3H2ZA 2WVGA 2O8BA 3UY4A 2HZ7A 2RJNA 3HJUA 3JRWA 3GEPA 4GLOA 1DAGA 4KUHA 4M1KA 4Q7KA 4WKGA 5F7ZA 3VPFA 2V9PA 1A1VA 2VTBB 2XQVA 2DY0A 1EYZA 3LCJA 5BT9A 1XPRA 2RC6A 4KQWA 1K5PA 2E87A 2JAUA 1JR2A 3G13A 1GPKA 1JKXA 3T5DA 4P3XA 1F3LA 2BGWA 1C7RA 1G20E 2VP4A 5B3JA 1YB5A 1TMOA 4EO9A 4CKZA 1YZQA 3C15C 2I87A 2GEFA 1RQRA 3L04A 3CINA 4XWYA 4EHIA 1XI2A 2CEKA 3ICVA 4Q05A 5TGTA 3FSCA 3IKLA 3DDHA 3BJEA 3OIVA 4IXMA 2GPAA 5AI6A 1X6VA 3JQAA 5IUJC 5KQPA 2GAJA 3KSZO 5DSXA 3U0BA 3U4GA 1USWA 2JVJA 2P0EA 3ZVMA 5CJPA 2ADOA 1VA5A 2X8JB 5C1IA 4NZ9A 5JZMA 5IM4A 2IYXA 3HM2A 3MERA 3SUCA 2VJBA 3PD0A 3IE0A 4L15A 4PHGA 2VH5R 1XRNA 2CD7A 2YXDA 5HTOA 3PFHA 2PL9A 3A26A 1SU8A 3F6PA 2EZ9A 3KT6A 2W6MA 3WWZA 1L4YA 2NPIA 2B3TA 5DF1A 3SS9X 3WK4A 2AT1A 3EHDA 3GJ6A 2HB6A 3CZAA 4M4SA 1KS2A 4Z0HO 2UAGA 3L7DA 4IPTA 1TCCA 2XBUA 4JJFA 3RAGA 4I55A 1E8MA 5AYVA 4F9FA 1VE1A 1YR2A 5DHSA 4I2VA 3RUFA 3AKZA 2G88A 4A26A 1E4VA 1M2OA 1W2HA 1V25A 2ILVA 4BVJA 2DFTA 4AKHA 2WIJA 1OKKA 1MC4A 3I6BA 4P98A 3TOCA 4DMCA 2P91A 1L7PA 4D9BA 3LBNA 4K9RA 1JDTA 2Q46A 4J90A 5BV1A 3VPAA 2AVNA 4GWKA 5HGXA 4JLNA 1BE1A 3QJYA 1LH0A 3Q0EA 1UBFA 4RGQA 2GFQA 2H92A 3ZE9A 3R6WA 1HDRA 3KTDA 2G8NA 3DUFA 4KXUA 2C3PA 5KVQA 3ZGLA 4AC9A 5CNKA 4HPJB 4BMYA 4EY6A 3I1FA 2JJ2A 2XBLA 1W36C 5FD8A 1U9ZA 3SHWA 4YWJA 3D4PA 4BDTA 4ENQA 5I4KA 1EGVB 1Y7LA 1A82A 2D2EA 2WWRA 3AF3A 3IBSA 3LC7O 3R41A 3G8CA 3GMDA 3R0ZA 4RDXA 5LOVF 4B3JA 3G2IA 2G28A 1T4CB 5LSAA 1Z12A 5H5JA 3EPRA 3I1YA 4CV1A 2AF4C 2N46A 1O5IA 1J2RA 3KV1A 5EZYF 5ARDA 4LXUA 2TMYA 2YC4C 2ZAGA 1SU7A 3GUCA 4OU5A 4V0SA 2B1IA 3LQ1A 3U7JA 1HZZC 1WETA 3D7MA 2C3YA 1JE0A 1TYCA 2BTQA 2AEJA 3FYDA 4ALIA 2QTFA 3A1FA 3VNPA 2AV6A 4MQ6A 1BCSA 1R0RE 2XCUA 1VGVA 4H3KB 4HZUB 2QE7A 4P6VF 4BGVA 3DLBA 3PWZA 3KOZA 2B4AA 1K8YB 2WUDA 3E5RA 1LPSA 2WF6A 1X1DA 1VKNA 1BWPA 2YRFA 2GBPA 2IXDA 1MG5A 2JLVA 4OQQA 1ZRSA 3ZI4A 3ER8A 1JXMA 2JIZA 3F5QA 3IEIA 3C7CB 1EUCB 3HY4A 4KR9A 3VI4B 2XE6A 2UKDA 4ZOLF 3BMOA 5BQOA 5F7OA 1OH6A 2BD0A 2CLCX 4MUYA 4B8ZA 4JEIA 4EG1A 1KH1A 1PDWA 3AR7A 3OE7A 1KRRA 3TSCA 3LX5A 5C31A 2Z6AA 1Y37A 3IAXA 1OXBB 3H1EA 2D1YA 4L8GA 5GMOA 5K4AA 8GPBA 1UJBA 1NX6A 3IP7A 1AS0A 4ECAA 5EFZA 4EGAA 1NVEA 1XRRA 1YDGA 3RS8A 2DB3A 3WBKA 1BH2A 2ZJ0A 4LHXA 4DEVA 2B36A 2WZDA 4H7PA 2OXIA 2Q4RA 1BVRA 3H7AA 5U4XA 1RQLA 3JVDA 4E2FA 3WGKA 2PBRA 2D1QA 2VDWA 1XCBA 3H97A 1HO3A 4V0KA 1NKSA 2IYZA 1YC2A 1F5NA 1S7GA 2J59A 2C5EA 4LZJA 4MUAA 5DEOA 4QGFA 4YEDA 3VMMA 4EYSA 3K4QA 3O8BA 1EG2A 1H4TA 4F7DA 5A3JA 1S3IA 2RGCA 5IANA 3DVAB 5KVCA 1V2GA 4TTVA 2JCBA 1VHJA 5FX2A 1AA6A 2ZWVA 5BR4A 3N53A 3HYLA 2Q07A 3B78A 2IITA 3JQQA 3V4FA 3ZDEA 5BXYA 1QG4A 2GKGA 3MPUA 1IBRA 2BZ0A 3R0XA 4OREX 4TLMB 3V4SA 3AVVA 4BJHB 1R18A 1JAHA 4RTJA 1E62A 1FF9A 3EXHC 1CDOA 4I1OA 2RHBA 3A70A 4JLDA 4DA8A 4YRSA 3RS4A 1CEYA 1XMJA 1K27A 4Y2QA 1IC6A 3SC6A 3I1IA 2Z1MA 3CGWA 3HA7A 1JDUA 2XMZA 4MUFA 5EIHA 4AZSA 3FPSA 5JARA 1QANA 2CF6A 4RHFA 1JG1A 1YZ3A 4BO5A 1L4MA 5EIWA 4EJ6A 2WW8A 4MTCA 1NGSA 1GZVA 1P0FA 4IICA 5G1NA 4BVFA 1KI2A 1CUUA 3DT6A 1RYFA 4ZYWA 3BIWA 9ABPA 4X0EA 2ANCA 4BAUA 3U4MA 3JQBA 4IHJB 1GZSA 1P0MA 2CLHB 4BC0A 1UEIA 3EVFA 2Q2WA 3I92A 3IAM6 4DSOA 4A5OA 3AYXB 2V3WA 3R6LA 1NBEA 4JL8A 3GJ3A 3O82A 1WZEA 2ORIA 1TZMA 1A88A 2QTAA 4P5DA 4YPFA 1PQYA 3TIOA 4OEHA 4EI2A 4ZJPA 4ND2A 4TLLB 4LWOA 1VGRA 2P75A 3LZ6A 2Q0HA 1T8TA 2Z56A 3N2ZB 4OXRA 4DUGD 4MJ7A 3GX1A 2OAP1 2XD9A 2O3UA 3A9UA 3HKDA 4EUHA 4E5VA 4CMIA 4KNYA 1KGSA 4QXPA 4X93A 5F73A 1L4NA 2D74A 3KO8A 4G1EB 4P3NA 2WJGA 3LVFO 1TYZA 3W90A 3VBIA 2WYIA 1DKMA 2QR3A 2I66A 4KPFC 3UF0A 3NJ4A 5FTJA 4TKLA 1A72A 2GZHA 1RRPA 4E94A 1P1CA 4BO4A 4YY3B 2OEPA 3CR3C 1EFTA 4JOQA 3ZLTA 2R44A 1XTVA 1DRJA 2FQQA 4QL3A 5KDDA 2GK3A 4ND1A 1ZHFA 3IEKA 3O2SB 2O0MA 2ES4A 4N0QA 4Y2SA 3WMEA 3DTVB 3Q6NA 4FYXA 1DG1G 1AXEA 3B3GA 4BZWA 3FHCB 4M7RA 2DAPA 4QBIA 4U00A 1ZUD1 5I9TA 1UKZA 3UK0A 5I48A 4JT2A 5D5HA 4FHCA 5LU9A 3Q7EA 1CX9B 1LI4A 3H75A 3ZHUA 2GLUA 3D0OA 3SGLA 4ZOEA 1R0CA 4QJBA 1L5LA 4M0LA 3FNEA 1O5TA 1KWKA 1O96A 2Z5VA 4PZZA 3P1JA 1U63A 4MYSA 2ZRGA 1H0KA 2WSYB 2I2CA 3C3WA 4ZVSA 1YE3A 3DOUA 3QQ5A 5DPMA 1Q7BA 1R4MB 3CH4B 3DQPA 3L2OB 1BDIA 4UVHA 2F4VB 4C2TA 2Q5HA 1DL5A 4IIVA 1O3YA 4NV1A 1YMVA 1XRPA 1X1QA 1ZJ5A 3TDNA 4G37A 3D6JA 4YJHA 5DYGA 3DT9A 3QA3E 3UV3A 3ZDFA 5GTDA 1H9BA 3K2QA 5HS6A 4FEAA 5K1ZA 5CDUA 3R0QA 6REQA 5DTRA 2B78A 5HBRA 2XYVA 3FZYA 5IBCA 1VJCA 3EQ9A 4ZEWA 2X8BA 4IDFA 4RTSA 3FAKA 2C5SA 3DE4X 3I5UA 4M6WA 3DZGA 3ANXA 4CCYA 4QAJA 5FA6A 3ZZUA 3V8QA 1N77A 1L2TA 5CA0F 3FX2A 2C7PA 4JITA 5FNVB 5EIFA 4TUYB 2IHVA 2QTVA 1HE8B 3E3AA 2Q3MA 3DYVA 4EG6A 4PRKA 4FZ3A 5DE3A 4NOMA 3WDLA 4A15A 4JXZA 1VMDA 2YR0A 3HUFA 5FFNA 3VFDA 3FROA 1B8VA 1PBNA 3K4HA 2OE2A 2R6CA 5EMMA 3V6LA 4ALNA 4JJGA 2HT1A 2XKKA 4EATA 1Z4OA 1MTZA 5F3RA 1XROA 5IULC 3AJ8A 2P6NA 3FDJA 2W00A 4A8PA 4RAQA 2EJBA 1B41A 1VIVA 4JYPA 4M1MA 1RXUA 2X2PA 1C9MA 1SWVA 2RI6A 3E7FA 3K1ZA 2PBLA 4EECA 5L3VA 4QFDA 4ZYUA 1J9ZA 1VI5A 3RC7A 4EI7A 4Q1DA 4EBFA 3RVLA 4PR3A 1GYQA 3EUWA 4UD6A 3NIGB 5EJAA 1D8TA 1U02A 2WNHA 2Y77A 3LXMA 1KL7A 2OB2A 1KI3A 1X2EA 2PZLA 2YICA 3R3ZA 4Q21A 2N1BA 1G18A 4TMKA 3WGJA 3SVTA 3U0VA 2VF5X 1W52X 2D5IA 1ZC3A 4JH0A 1IG0A 4PYQA 1ZAYA 1C1XB 1EP2B 3EF3A 2O50A 3K9HA 1CUGA 2ZTSA 3GL9A 1TLLA 3AI2A 2AG0A 4AMBA 4O2BA 3KJEA 1ZJWA 2OBMA 1ZN2A 3BHIA 3G2JA 5CD1A 1RAGA 2VHXA 3K5PA 4B33A 1KYWA 4YX9A 2OAEA 1MBZA 3W06A 3QEMA 2X14A 4BNDB 2X7XA 2GD2A 1FTYA 3HHPA 3GI1A 3GHHA 3NRJA 3L0OA 1ECPA 2NTJA 2DECA 2PR2A 3KHUA 4GUAA 5ESWA 3TSOA 2JHPA 5EIXA 5BNIA 1YS2X 3PFCA 2GGSA 3CNNA 3UKDA 1WZNA 2FPPB 3I8OA 3BWEA 4AAYA 3K2IA 3NBQA 4ND4A 4WEOA 3UFXA 2LE0A 1JIXA 3UAXA 4N7JA 2WVJA 1QFZA 1TMGE 2D2FA 2K87A 3D5EA 2EL7A 3RDPA 1A8QA 3CUKA 3OE4A 2C31A 3SSOA 4O2AB 3RKSA 1D4FA 3UK2A 4E5PA 1Z8DA 2J5XA 3PFNA 3HNRA 4AI6A 2HMWA 3RS2A 2PX6A 3WMFA 3ZQ4A 2H9IA 3KLBA 1SC4A 3AF0A 3OICA 1TF2A 1ZXXA 1PWXA 1XZJA 2HMVA 3HBLA 3QUSA 4NAHA 3VOTA 4DT1B 4JEHA 3TW0A 4Q1BA 1M83A 2C2MA 2ZI9A 5CW1A 2VYVA 1GITA 2EIHA 2XMQA 2YFKA 3IPLA 2J1LA 4JS0A 2BJVA 1QVRA 3GNQA 2X3YA 3NRCA 4RHCA 3AEYA 1QORA 2TECE 3INTA 3JD2A 1MIHA 4KW7A 2JASA 1H2EA 4YP1A 1MOZA 3K09A 3O0DA 5DZSA 3D3KA 4OLBA 2VG8A 4Z4GA 5HFAA 4U7TB 6Q21A 2C0PA 5A1TA 1UP4A 3EPHA 3W2FA 2F8TA 5F7JA 3JQEA 3QE2A 4Q4LA 3M33A 5IDQA 4FP9A 4IJUA 1NZJA 4D25A 4RKRA 4FYIA 4H1VA 3AMVA 1ZCFA 4KRGA 3EAQA 1IZZA 1WNTA 2V7QD 1UDRA 2HK9A 5A5FA 3MM4A 4RTRA 1G7SA 2R48A 2YW2A 1W0JD 3V00A 1VYHA 1HYQA 2VHVA 5DX1A 1P61B 1ZM7A 2Y1OA 2RJ3A 3IUJA 3UVEA 3ZUGA 4M89A 4NG5A 1Z62A 1GILA 2EKQA 3WLLA 5JMWA 3BULA 4ID3A 1TJ4A 1YZHA 4LPSA 5DSTA 2GRUA 4PRZA 1CQJB 1RI4A 5COAA 4BMXA 3UAGA 2P2SA 1LZLA 3QG1A 1I2DA 4DAEA 1YA6A 2YFHA 2AMLA 2ZULA 4RYDA 3RQSA 4BXOA 3EGWA 1RAEA 1K5DA 4LQDA 1WM1A 5KS2A 4HYEA 4C30A 4IQ8A 3ETEA 2X77A 3C7DB 3AVTA 3W4JA 3OA0A 5ALUA 3T61A 3K1AB 1BMDA 1LPAB 1HL7A 4F56A 3QXXA 2BM0A 1F0PA 2XDQB 4EJSA 2IXAA 2H5IA 5DRYA 3PP8A 5ERGB 4QLBA 1CVIA 1E92A 3MS2A 4FX2A 3RFXA 3ZZTA 3FVWA 4KQCA 1VG0B 3FCYA 3T3MB 1VOTA 2H4FA 4ENPA 3MT9A 4OQPA 2XA1A 3SZOA 1M1XB 3N86A 1N3BA 4ZPXA 3IMEA 3STXA 3WQQA 2GD6A 4DR3B 3CWZA 1LCIA 1VKHA 2GUGA 2J3QA 1ZJJA 2C92A 4JI8B 1GKUB 4U7FA 2C4KA 1AMUA 1U0NA 1BE6A 3IEXA 4P32A 1XA4A 3NNDA 2WWYA 2DPMA 3BG5A 3CVJA 5BPHA 3IUEA 2WHYA 5M34A 3N8KA 5CM2Z 3SYLA 3C8HA 1EJ2A 2HFKA 3TBKA 3T7AA 3QPBA 1T9BA 5DCUA 3QEBZ 1TCUA 3RS9A 4J2TA 5C2JB 3FYUC 3RS5A 4OMCA 3W8DA 1WJGA 3EGDB 4KV9A 5ABPA 1D8AA 1Q14A 4HMPA 2WRZA 4YJGA 4BNXA 3VBLA 1KTVA 2V7PA 4GX2A 4MK4A 3MZ0A 4RHTA 2H51A 1E0DA 1ECJA 4MI3A 3H5OA 3GPDG 1GZHB 5DNWA 3KQPA 1Q7TA 3GVCA 3BTOA 3BIXA 2OFXA 2BEUB 3DL2A 2I33A 1RJWA 1GG2A 1O7JA 5HK8A 1ADCA 3F90A 4JDUA 4OGWA 4H0NA 4KQIA 2VNHA 3AV0B 3O4IA 2QXTA 4YCMA 3IUNA 1SWWA 4JQCA 2FEKA 1KMQA 1US8B 2VK4A 2Z1DA 1EZ4A 2P77A 2ZUBA 2PUEA 3ENKA 3EGIA 1KZ1A 2OXFA 2CL6X 5JSKA 4M28A 221PA 1SUSA 4QYTA 5FOVA 3QWAA 1T2NA 2G6TA 3WYNA 4M9XA 3FS8A 4OM7A 4NSNA 3GMSA 4HD8A 3ZHXA 2AWNA 1GPMA 1BVYF 2Q9AA 1T3HA 4KIFA 1GZ3A 1U8CB 4XEUA 5F1OA 1A2QA 2E4WA 2HIHA 4UBJA 5JXJA 4N01A 4ZYVA 1ISFA 2NIPA 3EEOA 3WMXA 3OMXA 5TF4A 1YZTA 2MCFA 4TKVA 2KMLA 1XN4A 3AEKA 4ITVA 4MQFA 2RH8A 4D0GA 5JVDA 5LL6P 1Q1QA 1TM5E 3A37A 3MGKA 5EQDA 4KLNA 4KGXA 2H4YA 1DINA 4H4EA 3IP9A 1I7DA 1Y9DA 1C41A 3Q2IA 2OCBA 4ARSA 3ZZ1A 5IM5A 1Z2AA 3D4NA 4A6DA 1WBBA 2WJAA 1GFZA 2QGZA 2QPAA 2DT5A 3R23A 1U0BB 1Z7GA 4DXDA 3T3HA 1BRTA 3GNLA 3RWBA 4BNHA 3P5SA 3RADC 3JZDA 2Y66A 4KSCA 3VZDA 2OHXA 5IT4A 3PHGA 5FV7A 2PZKA 3PR2B 4P82A 1OR8A 3AL2A 4PBTA 3ZGNA 1LY1A 3GY0A 4Q47A 4ZRDA 1XPOA 2FKOA 1RXEA 5FR2A 2QV7A 2WYHA 4YJFA 5HJ7A 1UBOS 1VP3A 1XWIA 3OZCA 3I30X 3WLTA 3Q0IA 4EQ6A 1W19A 5C32A 4E4TA 3FTDA 1IXZA 1UFOA 2BFMA 4HJXA 3VR5A 5K5EA 2HXGA 3V33A 2E5FA 2Y76A 3LBFA 2W2OA 1KGDA 4BQPA 2NZJA 4FUTA 1XHDA 2VRNA 4HN9A 1OZHA 5ES4B 1C3EA 1J5PA 4ENTA 4Z8XA 4DC1A 4R1NA 2PSFA 4LJ9A 3L40A 4Y6SA 2O8EA 1JAYA 1FTNA 1QHHA 4RFLA 3FSJX 5EPOA 3SQLA 3OQNA 4GZLA 2GAFA 2DRIA 2NUAA 3IODA 5DM2A 5LQJA 2A5JA 4MMXB 3ZJVA 3B38A 1RR6A 2AJCA 2M6KA 421PA 1L3IA 1H3FA 2G08A 3GT7A 4RU1A 4NE9A 1NXTA 1PD1A 5ESRA 3R74A 3SK0A 3TQIA 3MWGA 3D6NB 1VB5A 1HYHA 4JR2A 3OFJA 3SE0A 5TIIA 3NAGA 4PPFA 1V4VA 2QNBA 3NHRA 1KOGA 3BGWA 5KX5A 1H6AA 2H4WA 1L3BA 3KKMA 1H2ZA 4IMPA 5LMZA 3ETJA 4OB7A 5ALSA 3DOIA 1RADA 3CUYA 5MGBA 1K8QA 2DEUA 1W5BA 5BYJA 5J2TB 4QPPA 1K1EA 3L0IB 2FUG1 4HN2A 1XMIA 2VF8A 1HLDA 4YT4A 5KJCA 1BJRE 1PFQA 3RFVA 5HCIA 3K9FC 1W85B 1Z39A 3SMQA 1OI2A 1K89A 1C0PA 1G60A 2UUOA 2XNJA 1KJJA 1LK5A 1SBTA 2HDOA 2C98A 3K16A 2YCBA 3MMZA 3NGXA 3DFKA 2E5LB 3R7WB 4BN5A 4E6PA 1G4HA 4BNMA 3M9WA 4U9IS 3CFYA 2FK7A 1J0AA 2FWNA 1U7TA 1Z35A 3SJ7A 3UWDA 2WINI 2ZR0A 1XZLA 3OT1A 4I5IA 3JWEA 4RQTA 3HLTA 5JWRA 3RREA 2ZBQA 4FR5A 5HIIA 1R6TA 2NMVA 4B84A 2ZE6A 3P0FA 3GRUA 2B4KA 4L07A 4C4SA 3IO3A 3K8YA 1PS8A 2AOUA 3OH1A 1D4AA 2PWZA 2H3HA 5DOZA 3V8BA 4FDLA 3ZY3A 4EHJA 4ZV9A 4KPUA 4YH1A 2DBVO 2WKSA 3DVSX 4A0FA 1DV2A 3LT5A 4C0KA 3CURA 1ZMTA 4ROTA 1BD3A 4M9QA 2CDRA 4LC1A 1JH8A 4WNYA 1MAUA 2FPGA 1YVRA 1M1ZA 3CN7A 4YQYA 4KV7A 4Y67A 3LUCA 3S6JA 2YBEA 1G5PA 1KFCB 4HNQA 4OFXA 2AEFA 2AJ8A 1CUAA 1QAMA 3ZDXB 3ZQ6A 3A3PA 1YQWA 3EGVA 2BGUA 4YTEA 1F14A 1WUIS 1IQRA 3SYNA 3WR5A 1SH7A 1FTWA 5DJ5A 4EY8A 5CFLA 4D3ZA 1JKFA 1UDAA 1N36B 1E1KA 4TWRA 2HF7A 3GEBA 4GBED 3C8MA 2O57A 1C3OB 1E3WB 2RGEA 3LVRE 5IFLA 1ETHA 1Q5PA 3RG2A 2LVBA 3E3MA 3KFLA 1CZOA 1Y3IA 3LIIA 4FNOA 3FXAA 1EK0A 2HLPA 1KI8A 5CLLA 4K05A 4EHHA 1VSUA 3ZEIA 1PR4A 1DUSA 1ZOLA 2BM1A 2DZDA 3AUTA 3DTVD 3LO5A 4I66A 3P52A 4IXTA 3WQSB 1H1LB 1CJUC 1L1QA 3EFHA 1X14A 3CNEA 4KN9S 4QBTA 4GMFA 5M29A 5K9ZA 3NHKA 1KHHA 1XZPA 3WADA 5DYIA 1OGYA 3TLCA 2O8CB 3TB6A 1UH5A 1RI3A 1VG9B 5K6AC 5F3WB 4O4IF 1D2AA 1VIMA 5CFOA 1FDIA 1XU9A 2VP6A 1PK7A 2ZJ4A 2IV3A 1L9XA 1NULA 3AB3A 4YB8A 4C5CA 1QRRA 3M6WA 3CRNA 5AIBA 5AUNB 3FOZA 3UCFA 1I0LA 2P65A 1LDNA 2PH3A 4NYIQ 4UDYX 4X1YA 3R5DA 4V0RA 4J4BA 4JFRA 2JF3A 4RZIA 4C22A 5AW4A 1DKNA 1FSPA 5HZMA 1A04A 1O6GA 4A0GA 2H6EA 4R51A 4KQFA 1I4OA 2WTNA 5JS8A 3WLJA 5FOQA 5KTKA 3GF4A 5FTMA 1Z6ZA 2A67A 1DAMA 4BNJA 4F4CA 2X6RA 3G0OA 4OQXA 4Z1OA 3G7UA 3BL5A 4MEAA 3MPOA 4OPMA 4CEIA 1KVSA 3CO0S 1E3SA 2HREA 3JQFC 4EFNA 3OBBA 3IXCA 1UBEA 3HFRA 3RYHA 4ZODA 1BTOA 2PX0A 3I09A 5TQ2B 1EFAA 4QRDA 5KMGB 2R751 5JR3A 2GHIA 3R5CA 1EAYA 2FSVC 3ASZA 1R0XA 1SUDA 3COSA 3Q7SA 2WKQA 1G21A 2AC2A 2NU9B 3D7SA 1G8FA 1XTBA 2AZDA 2OKGA 3B13B 1N1DA 1SOAA 1N78A 4RY9A 2I7CA 4WERA 1YDHA 1IBKB 4PCLA 3TZCA 4IH1A 4KVZA 5FPPA 3TQSA 2I80A 5THKA 2C95A 4NMHA 4PG4A 4N1AA 2BGTA 4KFTA 4YASA 5TJ9A 4OATA 1XMSA 1P31A 2X4DA 3IQEA 3WK7A 5A7FA 5FI5A 2DTDA 2IOFA 1OXXK 1P1RA 2QQGA 1QDLB 2I99A 4M0KA 4PO8A 5CCDA 5KHLB 2Z5FA 4ZK6A 2WPDD 5AK0A 4MB0A 5HM8A 2P2ZA 2EOAA 3NHWA 2OM2A 7GPBA 1KNXA 1VLZA 1XVUA 4V1CA 2XJ9A 1HNZB 2HPVA 5ED0A 2C7VA 1S01A 1OYWA 1C30B 2HTEA 2OXCA 5ISMA 4IHHA 5IXJA 1WPQA 3TRJA 5CX1B 1H0RA 3IQHX 4RCVA 4N18A 4WINA 3ROGA 4PN7A 5IU6A 3DULA 3OU2A 2JDID 1OU4A 4RK6A 2JFHA 4RGYA 2G04A 3A4TA 4GMHA 5DU2A 4JC4A 2YV2A 3T3GA 1U80A 3LT0A 3UMSA 2FUNB 3ZK8A 2BEKA 4DBLE 3MAAC 1EVIA 2I71A 1QG6A 3IAS6 3CPEA 4S2UA 1KKLA 3TNFA 4YMGA 2AOXA 3KS9A 2R1TA 1EG7A 2XMGA 4I6GA 1J8FA 1V41E 5ALVA 3GLQA 2V7QA 1TZ2A 4IYRA 5D00A 1WXWA 3QBEA 5T6BA 5LP6A 4OK3A 1W0JA 5J1SB 3NJ8A 5EVJA 3U49A 3PHBE 1M2VA 1Q57A 3X1JA 1K6EA 2NTVA 4I46A 3RS0A 4A73A 2YMPA 3IYLW 2ZWPA 4HEJA 1KH2A 5DLEA 2HMSA 3OCWA 1NIPA 4IKOA 3S7TA 2DKOA 5B5SA 4XR4A 3OEED 2M2IA 1D4OA 4MQEB 1OIXA 2JBHA 3PXUA 2A35A 2VZ9A 4WDQA 4C0BA 2HMYB 2Q2VA 2OPHA 2HW8A 3KJIA 1HLFA 4K87A 5AVQA 5BN4A 4ZJZA 4A0RA 1YBMA 1RWVA 5BXQC 3TLGA 1APBA 3VR5H 3WV4A 5C4IA 4O3FA 1MEOA 3IMGA 2Z2XA 5ILOA 1ADFA 4PPNA 4E5NA 2C2HA 1RZVA 2I6GA 1KSFX 2EG9A 2VAWA 4HNAA 4L8VA 4R1MA 3FYUB 4ONEA 2AFHB 2EX4A 4GLBA 4I50B 4G1VA 3O0TA 1JJBA 5I9NA 1QIEA 4Q9HA 2YFQA 4DAOA 4Q37A 3V4EA 1E89A 1PWEA 2GYYA 2PNFA 3ZX5A 2Z95A 3HDQA 2DETA 4GGOA 3TTSA 3FHJA 2VWHA 3L6BA 1U11A 3KHSA 1CZKA 3NV9A 4KI0A 3VKUA 5TARA 3TZKA 1SQGA 3H1AA 4W1SA 1I8TA 3EXIB 5LQMA 2HIMA 2ZRQA 1MAAA 1YRYE 1V71A 2R47A 3JQCA 3OZFA 1EEHA 4P36A 5HIJA 4AWXA 4YRIA 3O4VA 2BAGA 3L6UA 3IDFA 3EQ2A 3ADOA 3T5CA 1P81A 2XCQA 2Z04A 3P94A 5LZ7A 2RHCA 4CUJA 3D9QX 5KNDA 2AX4A 3UUWA 3EASA 4HDKA 4MRPA 2PVPA 1D0VA 4W9RA 5J5AA 4YMHA 5A62A 2IXGA 5CK5A 3ZKAA 1TU3A 4GOJA 4Z3OA 2A0UA 3LP6A 2H0QA 2GVDC 1P0CA 1R9MA 2WSBA 4H35A 4IJQA 1I1NA 3TD9A 1W36D 4O4HA 1YR3A 1WDWB 5DYNA 1QNFA 4F0JA 3IX7A 1R3UA 2QUIA 4IFIA 4I3HA 1PUXA 4U2KA 1NW7A 3KEFA 3C8UA 4DIKA 2MYNA 1N57A 2H2HA 2ZKIA 3DZDA 2V3CC 1NQWA 3HN6A 2VNJA 4RVUA 1ZFNA 4FFMA 4GBJA 2YXPX 4Q0MA 4NU0A 4WA7A 4CKBB 4E6UA 3FN4A 3OQOA 4M1YA 5TPWB 3MTJA 4ENVA 4C7OA 3LWDA 4HDSB 5EJ2A 4MVJM 3RE1A 3P4XA 5T64A 3S8MA 3GFBA 1V8OA 2X5KO 3ED5A 1N5RA 2HK8A 4GPD1 4YMWA 5EXSA 3TMAA 1KMHA 2WJ6A 1T2VA 1OWOA 3CNHA 5JNTA 1FWYA 2P5YA 2W6ZA 2YNMA 1YAHA 1NASA 1JIJA 2KJQA 1QKIA 3LHDA 4U0JA 5EE3A 3UH1A 4AZTA 4DM4A 2NO9A 4HT3B 1SBQA 1V1RA 2WSLA 2DFKB 1ULUA 3D8TA 3EIFA 3NHPA 1IY0A 2OGTA 4JP2A 5AJHA 1FTGA 4TMFA 3WGNA 2K6GA 2XUIA 2H4JA 1U3GA 1RWKA 3PTLA 4OQYA 3T0FA 4R2WA 4HH1A 2DSNA 4JVLA 5AFUV 3OF2A 1PNOA 4P7FA 2GI4A 4JBXA 3ZJUA 3AQ4A 3GLHA 1WA5A 1U6JA 2NU7A 1H22A 4MW9A 4P84A 4Q1AA 1JIUA 2P6MA 2OCIA 4PWYA 5ADWA 1UFQA 5LYJB 1U7DA 3NB0A 2ZJOA 4OB8A 2VTDA 3GLRA 4IZHA 3IB3A 5BN5B 1T4GA 5JEDA 2YJ4A 3RSHA 5KTYA 1NN3A 4BBJA 3EE6A 2WU8A 3RC8A 1B23P 2R87A 4UEQA 4LXIA 2J8ZA 4E7OA 4YA6A 4O4LA 3HVRA 1FW8A 1Q21A 4ZQGA 5BN3B 3IGJA 5J2UF 4OA5A 4TQAA 1EUCA 3TWOA 3FOBA 3EVZA 3R1IA 1DKLA 3H17A 2H5JA 3FWYA 4EH1A 3VO2A 3ROXA 5IDWA 1A96A 1FK8A 5D87A 4HNVA 5M04A 4WN9A 4BTEA 1HYBA 2JANA 4EPWA 1GPWB 5HIKA 4US2R 1DKRA 5DXAA 1Q3HA 1SXHA 1M72A 1P29A 5FBLB 4EUFA 3I04M 3ISTA 4EVQA 2AXNA 5BP7A 3BH0A 3FDXA 3K20A 4K81B 5LYYA 4B83A 1A9TA 4C08A 4L9RA 4QX6A 2N42A 4ZTUB 3FLAA 4OJNA 2WKRA 3L06A 3T1NA 4JT8A 1QZTA 3PPVA 3A2LA 2YHSA 4GU5A 3ZH2A 1NRWA 2CJFA 2XZTA 3X1XA 1PNRA 1Z4NA 2FF5A 3FHTA 3KJFA 1PNTA 1IPEA 4NIMA 4UHKA 1CIVA 3GUUA 4DJFC 4KPEC 1ZVVA 5EHQA 1XUOA 4L1KA 4LYJA 5EUCA 5DM0A 4GI2A 1PSDA 2GB4A 1CE8B 1GGVA 3RM3A 5TMDA 4D56A 4AIRA 1ZN9A 1M8PA 1OYYA 1EWQA 2AS0A 1VCOA 3OOSA 4FJ1A 3RANA 4PC6A 3W9YA 5CT8A 2Z3WA 3K32A 5ETJA 5JU6A 1H4QA 5H68A 1ZGCA 1OXMA 3THYA 2BF7A 2FRDC 2O2GA 5JCJD 1HBJA 1P5ZB 4US1R 3F7OA 1BDHA 1FNMA 1T0IA 1EIWA 3DMTC 5KNCH 4CDRA 3K53A 2Q7DA 4KIJA 1XOIA 4X61A 1JFVA 2HRRA 3LCMA 1TCAA 1SC3A 2CVHA 2A9VA 3FPGA 3ONNA 4RLHA 1HE5A 3MELA 3S3TA 3S5UA 3IUSA 1ULHA 1Y82A 1YTLA 1FE8A 5IHPA 3THWA 4N6BA 1Z0KA 2XXAB 2OBLA 2SKCA 4KN5A 5D1HA 5E3PA 1EVEA 1UT6A 2C3UA 3QKUA 1WXDA 1WXXA 2Q3DA 4J0GA 1P72A 1D1SA 1ZLYA 2JFNA 3OU7A 2E55A 4C76A 2QLTA 1TD9A 2PA0A 4BV3A 2E1RA 2BPOA 1K7XB 2CK3A 2R4QA 2RBEA 3FPBA 2QTHA 4XB2A 2HADA 2AW3A 3KYBA 4KO8A 3RBAA 2REBA 3ZU4A 5JSQA 3FKJA 1NF9A 1SCUA 1H5UA 1T8PA 3AUFA 5D84A 4GYWA 4KNRA 2ZI6A 2MYTA 3Q40A 3B48A 4MZDA 1ZR2A 3SAJA 4BRWA 4C6SA 3DKVA 3L05A 3VH1A 3AR6A 1PGJA 3FPAA 4R9SA 5G41A 4BRUA 2PFSA 1CDEA 1O97C 2HMAA 3HA3A 3AGPA 1V7ZA 4ZQEA 4Z3KA 3X3HA 5JNSA 3KCQA 3LGSA 3BYZA 2B25A 3VSBA 5AK4A 2HPHA 4ZOBA 5TJHA 4ZO6A 2E6KA 5HW0A 1ZSVA 3G1UA 5C3UA 3I3SR 1DWUA 2W2TA 3AM3A 4R40A 4DL9A 2FQ1A 1RRMA 5LOVA 3VUEA 1JXOA 1JR3D 1ZD5A 2C9OA 2GEBA 2HJ9A 2YUIA 1EP1B 1VPEA 1PDOA 2AL7A 2WLTA 3LHFA 3UWPA 1ZR4A 4LJSA 1XV5A 1JHXA 3P5BA 4JLUA 5EZYA 1RJ9B 3DE3X 1SC9A 3FVRA 4GMXA 4RHYA 4UMFA 4WXPA 4BP1A 2E37A 4Q3DA 2HHJA 1W5TA 1XEWY 5H59A 1Y4SA 5KYUB 2WTMA 4WLEA 2K7FA 2NADA 4E13A 4EMSA 4BASA 1YE5A 3T41A 3HWSA 2IYLD 2WM3A 5JH7F 4MHTA 1KZ7B 1SZJG 1NI3A 3HLKA 3E5NA 4OD0A 4QG7A 3T3DA 4EHLA 5KTOA 2OHJA 3L49A 1GFWA 5AFSA 5JZBA 1D0SA 1QCCA 2QMZA 3KB6A 4QOJA 3WKBA 5BWOA 2F1OA 1I7QB 1R4MA 4JL5A 5D6NA 3EOAI 4O5AA 4YACA 4ARIA 1E2GA 3KJNA 4XAQA 1VFNA 3M4JA 3P2KA 9GPBA 1J1IA 2DXIA 4KL8S 5KVAA 4RH1A 1AQLA 4ZOLA 1W0KD 2OENG 2ZI3A 3UM9A 3HWWA 4ZOCA 2EGUA 1O57A 4MGZR 2OXEA 4AJ9A 3RVMA 7ABPA 2F4NA 3W34A 1X8LA 1Y48E 1E2PA 1GPAA 3FNRA 2NACA 4IHQA 1M74A 3L7JA 4MVJH 4RVFA 5K4GA 2Q8NA 4DADA 3WB2A 1JVBA 1C4OA 3QV1A 4DEXA 3FTPA 5G0SA 4EBBA 1WSWA 1YVPA 5LQSA 2OHIA 3TWDA 1NXVA 1GL7A 2GD0A 4P5EA 4Y0NA 1Y9EA 4G4SP 5ALYA 4QXQA 4DM3A 3EH0A 1WRBA 4OKSA 2Y0BA 3IEMA 3KUKA 2PUHA 1E2KA 2ZYGA 2PVSA 2BMEA 5FQNA 3O73A 1JHMA 4BUCA 1QHFA 5TQJA 3WIDA 1NBAA 4AD8A 1NQVA 1ZM2A 3D7KA 4M53A 1A9YA 4E03A 1X9HA 4NWIA 4URHA 1B6RA 4RA9B 3BJRA 5CYOA 3FTFA 1OILA 1YOVB 3O7MA 3NAMA 3EGCA 5TEVA 3NIDB 4K2HA 1KERA 2XB4A 3E8SA 5TEWA 3TI9A 5KWJA 1P7ZA 1L7EA 3C7TA 4OVKA 3ET4A 3VBJA 2EWVA 3KXPA 1RM5A 5ALNA 4Q3CA 1RT9A 1S7CA 2C3OA 3OJLA 4DLZA 1SKMA 4LGVA 4OHZA 2BFOA 3L07A 1AHHA 2PKQP 1OU0A 2JH3A 5HFJA 3EF0A 2ODWA 1JG3A 2RB4A 4QBGB 2RIRA 3GN2A 1AZSC 4MJ3A 1ORWA 2I4LA 3DGEC 3M1LA 4G84A 2JDIA 5DTJA 3I1JA 1OWNA 3CTPA 3QLTA 3V7NA 4JL6A 2IWRA 3JZFA 4ICIA 4NECA 4DLNA 4R05A 4Q9IA 4JJ6A 1V8BA 3UOGA 4R0VA 3F73A 4CM9D 3M1AA 1Z4KA 1PYDA 4GI5A 5DASA 1IXKA 3DNPA 3NFRA 3M34A 3TW6A 4V0LA 3GJYA 4CF7A 1GTSA 4N47A 3G79A 4E6TA 3EIHA 3KQTA 3LOQA 2FUEA 3PNKA 3C2QA 3LXXA 1MAHA 1M3SA 1O77A 2VCEA 1KGTA 3K2EA 3V9PA 4BLWA 4KUGA 4YQZA 3L0SA 3W3ZB 2GTHA 2F9MA 1ISMA 1MIOB 1TFRA 2FSIA 1A5TA 3LKVA 2JGJA 4H7DA 2YUTA 1Z4IA 3DO5A 1H2BA 1FDWA 2MSDB 2P6RA 4EK9A 1SA0A 1H2WA 5CIYA 3UC5A 3S28A 4TSKA 10MHA 4QXAA 3D8NA 1D2RA 4P2GA 4LPKA 3OLZA 3HLYA 3BN3A 3EUAA 4KVAA 4OXIA 2EBUA 4TTIA 1UBMS 3ZHSA 1BVUA 1U2PA 1ITZA 3DAHA 2W6ID 2XMRA 5GIOE 3JR3A 3QK7A 3RSOA 3K6SB 2XYPA 2IS4A 1J9GA 2GEUA 3DEYX 3DDCA 4CGZA 1F12A 3HDHA 1RE0A 3PC8C 1INLA 4NG4A 4OHXA 3F5SA 4DR1B 4CU5A 2Y92A 1WZ2A 1R8SA 3GJ4A 5JQGB 1XHEA 5I7VA 1S6YA 5F77A 4W63A 2OZKA 2OPBA 1QHSA 1A7AA 1WR8A 2WFLB 5T41A 3R9KA 2BKAA 3GVHA 3B60A 2HU7A 4E1AA 2FKAA 4IDDA 4TQGA 4Y7DA 1BKYA 4KKXB 5GJWC 5C5IA 4MDEA 3CG0A 2C07A 3DLPX 2MYUA 4B5KA 2HN9A 2D5BA 4XUDA 5FI3A 5C9ZA 3UJNA 4PBSA 1PGPA 2EFJA 4PNHA 5I45A 2GQ0A 4GI3A 2RE8A 3MUFA 4GLFA 4HBGA 2XYHA 3KPWA 5EKUA 2REQB 3ZVNA 3U60B 2IP1A 4JHLA 4D8XA 4JD5A 4JYAB 1YNSA 1OFHA 1S9HA 2CNOA 3IBCA 3OIYA 2BRUA 1FP4B 4WCDA 3I23A 1VJ0A 3ONVA 4QYWA 3A9WA 1OROA 4UHJA 3OKPA 2SCUA 3NWPA 5DN6A 4GDFA 4JOSA 3EEIA 1O6ZA 3T4XA 1KPIA 4EJMA 4LHWA 4B87A 4OX9Y 4BLUA 4HH4A 3FOAA 4PVCA 4XD7D 1I2ZA 4FFDA 1T8YA 1XJQA 3TW4A 2OBBA 3RARA 4PC7A 4LYFA 4P9NA 4HJRA 1G5IA 5EYPA 5CA0A 1EEXB 3GVDA 2XGSA 2HY7A 2CV0A 3ZGOA 3DXXA 1UP7A 1USKA 3GJ0A 1R15A 4H7HA 4KVGA 4TN1A 1TVKB 4XASA 3T94A 5EJ4A 2A9KA 5FDFA 1V16A 4JFAA 1UR5A 1P1KA 1SUCA 3EB9A 1JECA 3DC7A 3G85A 3VPXA 3RV3A 1Z4JA 4MW2A 2WG2A 4E5YA 2C7QA 1NN5A 3JATA 1NBMA 1KDPA 2EGHA 3WGTA 2BLLA 4D8VA 2FDRA 1PJTA 1F7VA 3THXB 1YGYA 1EDBA 2O1SA 4IIYA 3WLEA 4KREA 2AUTA 1CY6A 5JV5A 1GKLA 1FU4A 3WP0A 2WTUA 5LA6B 1NQAO 2O59A 5M7EA 2W2LD 1ZGZA 2R8PA 2WVHA 3PA8A 4BCDA 4KR0A 3DHWC 1O0BA 1ORVA 1CUJA 1V1JA 2I8AA 2WAXA 4BNUA 2QUKA 3LUHA 4XE5A 1XD2B 3QKIA 4MKRA 4DVJA 1LRLA 5LQKA 3J81k 1G19A 1IZYA 1RPJA 5CFNA 1WCYA 2A5YB 2PTGA 3P0RA 4EGCB 2QIPA 2FWJA 2JD2A 3G9UA 3M6VA 4F11A 2H7CA 1S0UA 2AXEA 1L7XA 3A32A 1Y7PA 3HCRA 3QFHA 4OQEA 5EFOA 1V45E 4IHKA 5IJ9A 1QTQA 2V0HA 1NSYA 2C5GA 3NTXA 4G97A 5ADUS 2EP5A 1CRZA 2XKAA 3V2IA 1XSEA 1AD2A 1M0EA 1RI2A 1T5LA 2QD2A 4PX3A 4R5MA 3T9FA 5D01A 4HLUC 1X7XB 4A10A 3ADBA 1NDQA 1E9AA 2EJCA 3EN0A 5AJVB 3MB5A 2W9XA 1OV4A 1Z90A 1N5JA 1NDUA 1JQAA 2A1TR 2BN4A 2G5TA 1J0EA 3KPJA 5G53C 4EGJA 1NSFA 3C3BA 2O3QA 4RA6B 1TEVA 3GT3A 1ZEMA 3F4BA 3BPSA 2Q62A 3E2MA 2QX9A 5BQPA 5CXUA 1L5ZA 1QZZA 1AGPA 1ZGJA 2DH5A 2ODNA 3RRZA 4ED9A 1AU9A 1P4JA 3CVOA 4HRAA 1Z6AA 3WKAA 2G82A 2QDXA 3EXHA 3FZQA 4FR0A 4PAQA 4UM7A 1KI1A 3RYTC 4ESVA 3V8EA 5FLEX 5AW6A 1CJSA 3A4MA 2UUBB 3HZRA 4GFDA 3LX6A 1P4RA 1RIIA 2V9ZA 2PZFA 3FPKA 4FJ2A 1V9CA 3WLIA 1EVJA 3FTQA 2M98A 2FW8A 3GIDA 4KPGA 5AD1A 4MGKR 1A5AB 4A8HA 3OUUA 2GJKA 1MABB 2IOFK 1G7RA 2IZ0A 3WA6A 4RDCA 4DV4B 2Y0PA 3M2PA 1Z8NA 2BJHA 5LUBA 1SQSA 1LXAA 2VUSA 4PSAA 5E3JA