4M9CA

Weei from acinetobacter baumannii aye
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MTMIIGVYGASGFGKEVMPLVRQQFPTLSKEQFAFIDDGLSGTTLNGYPVLSYLDFISKPADHKAVTIAIANSVVREKLVSLLEKDGVQHLAVQSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVAHDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQGTPDKPLIIGKGAIVGMGAVVTKSVPAGVTVVGNPARILERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
molecule keywords Bacterial transferase hexapeptide (Three repeats) family pro
total genus 74
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m9cA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9cA01
2YS7A 3ST8A 4N6AA 1G95A 5AFUU 1KJIA 5F42A 3G8CA 1B6RA 4EGJA 3F1XA 2W0VA 2OI7A 4N27A 2WLEA 2I8CA 4EAAA 3I3XA 2YYAA 4EA8A 3GOSA 1I7LA 5BPHA 4R7PA 3TWDA 3T57A 2W71A 3TDTA 3K3PA 3EG4A 2YZNA 3ECTA 1EHIA 3VMMA 5D8DA 2PVPA 3BSYA 4M99A 2IC7A 3RV4A 3RV3A 5C1PA 5K2MA 4MV1A 4HR7A 4MA5A 4IZOA 3E5NA 4EABA 1XATA 4IWYA 4G87A 3ORRA 1I7NA 2J9GA 3R8YA 1GLVA 1FXJA 4DCLA 2QKXA 3VBJA 1G97A 2WLDA 3RFCA 2JF2A 2W0WA 4KQLA 1Z90A 1TDTA 4C5CA 2W6MA 3FSCA 1HV9A 2W6OA 2I80A 1AUVA 3EH0A 2R7LA 1KJ9A 3MJFA 1ULZA 4IHGA 1HM0A 3OW5A 3VPBA 4J18A 3VBKA 2YZGA 3JQYA 3R3IA 3MQHA 3BFPA 1UC8A 2P0AA 1SSQA 3ETJA 1J2ZA 4MFGA 1KRRA 2V0LA 1MR9A 1KHRA 3ETHA 1IOWA 2W6QA 4KNRA 1DV1A 3TIOA 3Q1KA 3CJ8A 1SSTA 3C8VA 4HUSA 5DG3A 2R7KA 4M2BA 4ZQIA 1UC9A 1PK8A 2R7NA 2R85A 4MYOA 2V0JA 3IGJA 4ME6A 4KPXA 4AA7A 2W6ZA 3MQGA 1KRVA 3OUUA 3K5IA 4IWXA 3N8DA 1KJ8A 4KNXA 2IP4A 1QRMA 2OEGA 3BG5A 1GSAA 4E6TA 2IUAA 2VD4A 3VNPA 4EGGA 4EG0A 2DWCA 3SE7A 2ZDQA 1QRFA 1A9XA 2V59A 4E1KA 5C1OA 4EQYA 4HZDA 1MRLA 3OU9A 3WO1A 2JF3A 3GVDA 3NZ2A 3RUPA 2R86A 2QF7A 4K6RA 4AC3A 1GSOA 1XHDA 3R5AA 3SPTA 2W70A 4HNVA 3V4EA 3P1BA 2XD4A 2XATA 4N6BA 1BNCA 4KPZA 3BXYA 5JQWA 3PMOA 3OTMA 4MV9A 3R5CA 2V58A 2YS6A 3HBLA 3G8DA 1QRGA 3EEVA 4HZCA 3V4SA 3D98A 2CZGA 2V0HA 1YP2A 3FWWA 5L6VA 2QIAA 4M28A 3FOQA 3VPDA 1CS0A 2OI5A 4HURA 2R84A 4GGMX 2QK4A 1M6VA 4MA0A 3D8VA 2R7MA 3DK5A 3VBPA 3R0SA 3KWEA 3K5HA 3FSXA 2YW2A 1QRLA 4R36A 3TQTA 4G3QA 2VR1A 1GSHA 4HNUA 1EYZA 3TISA 4HNTA 1KGQA 1MR7A 4IHFA 4MV7A 5I47A 3VBMA 2DLNA 5E3PA 4M9CA 4RZQA 2W6PA 1THJA 4J6EA 4IHHA 1YP4A 3VA7A 4M9UA 3DHOA 2W6NA 3LP8A 2XCLA 1KK4A 4R37A 3R5BA 2Z04A 1C30A 2Q4JA 1T36A 3TW6A 4E79A 1PX2A 2C00A 4EGQA 2GGOA 5AFUV 3R1WA 3JZFA 4MV3A 3GUEA 3U9SA 3HO8A 2I5KA 3OTZA 3U9TA 3TV0A 3VBLA 3VBIA 4WD3A 3SRTA 3R3RA 1BXRA 2OEFA 1V67A 4EA7A 3FSBA 3R5HA 3ORQA 4AAWA 3BRKX 5H80A 3N6RA 2P2OA 4E6UA 5DEPA 2PN1A 2GPSA 2QIVX 5L6SA 3V4ZA 1QQ0A 3R2WA 3I12A 2PBZA 5E3RA 3HB9A 2IU8A 3WO0A 2FB9A 3AW8A 4E75A 1CE8A 4C5AA 3R23A 2WLGA 1OCXA 4G3SA 3BSSA 5DEMA 1VKZA 3AX6A 4FU0A 3OUPA 2AQ9A 2FKOA 1KK5A 4C5BA 3R5FA 3P47A 5ADXU 1DV2A 1JDBB 2V0IA 2TDTA 5E3QA 2GLTA 3VOTA 2ZDHA 3R5XA 2R87A 1KQAA 3KWDA 3BSWA 1QREA 1SSMA 4DIMA 4MV8A 1AUXA 4ISXA 4M2AA 2IU9A 2ICXA 1HM8A 4FCEA 1EZ1A 4DLKA 2VQDA 3HJJA 4MV4A 4MZUA 1C3OA 2RIJA 4MV6A 3Q2OA 2NPOA 1V3WA 2VHEA 3FSYA 2ICYA 1KEEA 1KK6A 3DJ4A 2GPWA 1E4EB 2WLFA 4L1KA 5ADXV 1LXAA 3IXCA 4E4TA 3Q1XA 4M98A 4MAMA 4J09A 1T3DA 3HSQA 1S80A 3FS8A 2YRXA 5DMXA 3KWCA 2VPQA 2WLCA 3QFFA 2YRWA 4QSHA 1B6SA 5U2KA 4EA9A 3JZIA 1IOVA 1KGTA 3LWBA 5BPFA 2DZDA 1YP3A 2ZDGA 1HM9A 2V5AA 3WNZA 2I87A 2V0KA 4N69A 3R5DA 2YZMA 2GGQA 3VBNA 3VPCA 1KRUA 3MC4A 1E4EA 3TK8A 3OUZA 1FWYA 4HCQA 2OI6A 1KJQA 3FTTA 4G3PA 1KJJA 4H7OA 3I3AA
chains in the Genus database with same CATH superfamily
4DB2A 1LZLA 1T4CB 2PFSA 3FCAA 3IPCA 4GGOA 1JALA 1N0HA 3H1PA 2RONA 3KOXA 4OQQA 3RFTA 1D2CA 2PGLA 2DR2A 1KPGA 4I5EA 1OBCA 3SQXA 2PX8A 4B3BA 4EBFA 4KVFA 4YH1A 5FTLA 5DSXA 2Z56A 4F38A 1CVIA 1CY6A 2WVJA 1N1DA 1ZVQA 1JMVA 3NTUA 1YCFA 2GYUA 3LW7A 1Q16A 4B6SA 4JSTA 1J25A 3HYNA 4BJHB 5A3VA 3KKNA 3NWPA 2DLCX 3C1TA 3IL2A 1A9TA 1G291 4DCNA 1P9LA 3O1IC 1RYEA 4WL0A 4AK9A 1OFIA 3EG4A 1EG2A 1MB3A 3AU8A 3RTAA 5BSGA 1P5FA 1G66A 1OT5A 1IE3A 1Y6JA 3THWA 3V8MA 1LC3A 1M6WA 1OXTA 1SG9A 1UBOS 3N2IA 5GV8A 1EUZA 3ECTA 1PEDA 3EZLA 5KHAA 2F4VB 1XJQA 2IQ5A 4MKGA 3UJNA 1BS2A 3JVIA 4MYSA 4DUPA 5BT8A 3V1TC 3IBSA 3SFTA 4Q1AA 4Y3UA 5DZSA 3W5IA 2Z8YM 5EP4A 4NK5A 3C6QA 3L43A 2VJMB 5SZHB 3IUPA 2F67A 3INNA 1NC1A 1E3WB 4KAJA 4P7GA 4IUYA 4ZVOA 3VNUA 4D3ZA 1BQ4A 5CHYA 1VFPA 1XP5A 2Y1EA 5CX1B 5TPZA 1LLFA 1O0BA 3F5SA 1KDTA 1JR4A 3PUYA 3OTOB 2ZS8A 4EABA 3AR4A 1KE1A 1TGYA 3QKSB 1G3UA 1F9EA 3CN7A 3R3XA 4EDHA 3F98A 3C4VA 4X1YA 1KZHA 2PKWA 1NFQA 2YOFA 3S2YA 2YRFA 1GLVA 2WB4A 5GVSA 4D81A 2LD4A 4IHJF 2QXTA 1RKXA 2VTBB 3ZVMA 3KUCA 5JY1A 4GLLA 1D09A 4RSRA 5IYZA 1QGDA 4IDPA 2WR8A 5GIOE 4EOGA 4NU0A 5K3SA 5KTOA 3B3FA 1U1GA 1D2EA 2W4MA 4LHZA 4JI4B 3AHHA 3EVEA 3OFND 4Z86A 1G6OA 3VH4A 4YV7A 2KMLA 2QR5A 4G1BA 2IS6A 3FCXA 5F2OA 1Z35A 2UZAA 2ODAA 4Y6QA 1M9NA 3CW2A 1QFJA 1YGYA 2ZAGA 1IBCA 1CRWG 1NQUA 1ZVMA 3C6YA 5KPDA 1F5SA 3WLTA 1GYQA 4DQUA 3ZLUA 4OXKA 1HYGA 1QV7A 4KE6A 5EHZA 2R7LA 3BJMA 3JQBC 1OYYA 3LUBA 3JWJA 4M0MA 1MVNA 4ZRDA 2QL5A 3ZCXA 1ZMXA 3IKTA 1Q0ZA 5FL7A 3CW9A 3EFHA 2OGUA 3DFKA 3QMPA 2WUGA 3MG9A 1TUIA 2FWMX 3OW5A 1L4FA 4P1ZA 2A0XA 3ICQB 2BKVA 2EG9A 3K09C 3ZLTA 1W2GA 1YQGA 2IZZA 1PNRA 1T4CA 5HJ7A 4QG7A 5FBKA 5AHXA 3G59A 7GPBA 2HTEA 3FDJA 4W5QA 4DA7A 2XX3A 1FLAA 3A4NA 4MS4B 1BCRB 3LDFA 4UEKA 2ZI7A 1BVHA 3AOGA 3ND9A 1L1RA 2IHTA 3PKIA 4I14A 2PNFA 5ECGC 4CG0A 3NX4A 3E0XA 3NHAA 2W93A 4ETWA 2D2IA 2QENA 4ZHQA 4PR3A 4LY3A 3KOWA 4M0UA 4C3ZA 1N2EA 4JLSA 4KNRA 2IYSA 1E9EA 3A4TA 4CT5A 1CB0A 2EATA 4PQYA 3SCZA 2WFLA 4KK3A 1N2GA 5GVRA 1ZWLA 2I4RA 3S0JA 3BRCA 1C8BA 4LW8A 1AY0A 3S40A 2ZIUB 1Z2OX 3TL2A 3ZV4A 1ZX1A 1K89A 1OWPA 1X7XB 1Z8HA 2NN3C 2O48X 2P75A 2VJQA 4QUEA 4RXMA 4YGXB 1KMIY 4ZQIA 1CZNA 5P8WA 3BOSA 3O6VA 1FF9A 1RP7A 2G28A 4L8FA 1ND5A 4Y1RA 4C04A 3UMVA 1WLYA 3OZIA 3HN2A 1B0ZA 1SXJB 3U2QA 1ORTA 2HQRA 4CKBB 3AR7A 2FSVA 1U0HC 5DP2A 5EP2A 1UXGA 4L4ZA 3V7FA 1S3GA 1IBLB 4RSGA 4U2EA 2ALJA 2QN8A 1XLTA 2P4UA 2W6ZA 3BS4A 4LK3A 4PF1A 4YS6A 4BNIA 4C6SA 4YV2A 3MWGA 3T34A 1LVGA 3R76A 1JAZA 3F74A 3GFSA 4MZXA 3RC2A 1ADGA 2SBTA 5DBHX 3LC1O 3N76A 2CXQA 2FZCA 2QQ5A 1BE1A 3LQYA 1KARA 1LBQA 1ISMA 1TIPA 1OZ0A 3GLKA 3PGVA 3QI2A 3I30X 1MX9A 2GPNA 1F5NA 2BJHA 3KQSA 1U80A 2JCGA 2GAOA 2ZJ6A 2W2OA 4HTAA 3LL4A 2XH8A 4EG0A 1MFPA 4O08A 3JQGA 3JQPA 1GFIA 2EKZA 1V1RB 3SXPA 4C76A 3GWZA 3AFGA 5EGSA 1JSCA 1P7YA 4GR5A 5JQGF 5F3RA 3P4YA 1T8TA 5ER6A 3BORA 1QRFA 3QEOA 2ISSD 2GD0A 1NU6A 2WAOA 3BWBA 1BVYF 4Q1CA 4LOJA 2FE1A 2JAUA 4AYTA 1R0LA 2OD2A 3ICOA 3ZLVA 5HILA 4N3NA 2H1OA 2YFHA 4G23A 1CT9A 2GEVA 1KI1A 1FS5A 3IQXA 3TTSA 1IN8A 3PXXA 4NZOA 1LV8A 2PZGA 1JEJA 3N75A 5T3YA 3I3OA 4MP6A 4WZZA 4M1QA 2G5CA 3KSRA 2IHYA 4FTWA 1NNSA 2WLSA 1ECCA 5D7BA 2EDCA 5LZ8A 2QF7A 5JAUA 2W00A 2IKSA 2UYQA 1PJ2A 4FD3A 2GM9A 3TM5A 2Z6AA 3HYRA 4ESEA 4XWYA 4RVUA 2Y66A 3CLUD 1JYEA 3KSMA 4GM4A 4PCAA 3CZMA 4L0CA 1G7RA 4FLFA 4MRVA 2VYVA 2ZJ5A 4NONA 2Q4EA 4N03A 4OHMA 2GX6A 1AGRA 5T4EA 3FOAA 5AVTA 1EEXB 4GLFA 1B1AA 4M1SA 5FFMA 4BNNA 4TVOA 3R3VA 1KI7A 4D79A 3A28A 1V8OA 1TK3A 3RBAA 2OHFA 3T1NA 5ES4B 1FVHA 2G6TA 5A7HA 3R09A 4YP1A 1PN3A 1RHJA 5AJZA 1HLPA 2ZE6A 3QBDA 2QN9A 3C8HA 3ZCQA 5E95A 1SURA 3X3HA 2P9JA 2LDXA 2FUCA 2A1TS 4FIDA 2VJBA 3OWOA 4I99A 1W0JD 3RR2A 4CMAA 4YR7A 2VHVA 4D3FA 4CF7A 3HJRA 1NBEA 2N75A 1DAMA 3AYXB 4B7XA 4CG2A 1WXFA 1XFAA 2QNRA 4G5GA 5TEWA 1Z2EA 4LYYA 3R9WA 3FOQA 1VPLA 2HAEA 3WVNA 4Z1MA 4KMRA 3GJ6A 3KAKA 4L51A 1BWQA 3DF7A 2HK8A 4GGMX 5F76A 4LF5B 4LZOA 1F4LA 4KXNA 3O9MA 2QP3A 1D2RA 4QVKA 3QKRA 1RS0A 3IAS1 5E6SB 4YRRA 2HK9A 4G1MB 4L3WA 1MPXA 1YS2X 3ZWOA 4FFVA 4F86A 2V7VA 3BK7A 4AZWA 1Y1QA 5IEJA 1IN1A 4HMOA 1A9QA 2XMCA 3NBQA 4WDQA 5FUYA 3WYCA 1PJAA 2HA2A 3IIJA 2I1LA 2RCYA 1BJRE 2IYRA 1FB5A 1AKVA 4HJXA 2XDQA 2GN0A 1QNLA 2BMEA 2N47A 2YIJA 3MJEA 1HG0A 1QJCA 3AM4A 2I7VA 4IGKA 2DFLA 2PX3A 4RTQA 1SA0A 4NWIA 3ROXA 4XJTA 3T3HA 1YJ8A 2RHWA 5LYJB 1S2OA 3JARA 3LT4A 5AVUA 4Q9JA 1JUDA 3LFUA 4JZKA 4HLUC 1CJKC 1RACA 2RDMA 1YS7A 4Q7JB 1OUMA 4YMWA 2UAGA 4DQ0A 4K40A 4XVRA 2XB8A 4GYJA 4BMCA 3DM9B 4Q1VA 5JNWA 5IASA 1THJA 4MHSA 3PRKE 3QX9A 2CXHA 5LPNA 4UMFA 2VP9A 3R6WA 2V03A 4RDIA 1WDLA 2HQBA 5DRTA 2ZYVX 1P5RA 1SHTX 1I0IA 3L82B 2IZOA 4DWWA 2O50A 3DR3A 1JSLA 4CLXA 1IBMB 3CONA 4HDNA 4DNQA 4M7WA 3NDRA 3T5CA 4PLHA 3LBHA 5NULA 1KYZA 1YK1A 4GGPA 3IC5A 3MWJA 4LGCA 2V4MA 5B1DA 5IC5A 1W35A 1ONSA 3R5BA 3AP3A 3W7BA 1I30A 5EUCA 1SUIA 5KO2A 3A0RB 2Y3IA 2GCOB 4ND1A 1G1MA 1AF7A 2B8JA 2ZSHA 2VUHB 4MUFA 4EKNB 4TV8B 4PIVA 4BLVA 4I36A 1NN1A 1VHTA 2XITA 3ED1A 3K5PA 3TEMA 1ZMTA 3W1WA 3KZ1E 4EUKA 1TC2A 5MFPA 1KOJA 2DC1A 1PWYE 2ZPUA 4ER3A 5DNAA 3DP9A 3LMKA 3KR2A 2ZJ1A 3R2JA 4Y2JA 2ZCJA 1JPUA 2AKYA 5F1OA 5KOYA 5F4ZA 3U9SA 4ZJZA 2EIXA 3OTZA 1NP3A 4XUCA 1QFSA 3JRWA 1R2QA 3WYFA 1ZI8A 4OGGA 1KC1A 1YOVA 2ZB3A 1JHRA 4N40A 4MR8B 1CDOA 5D5HA 3RABA 1BXRA 4YQFA 1XZPA 4IQ0A 1QPGA 4PLPA 3H9UA 3QF7A 5F51A 4P35A 5F12A 2ANCA 5JAMA 5JOQA 1RJ9B 2Y76A 3QLTA 2P6MA 4CMJA 5CVJA 2HH9A 4KR0A 1M1XB 4Z4HA 4N76A 1UP4A 4ZK2A 1NM5A 1CE8B 1FFAA 2QD3A 1LXCA 3PPVA 3F2IA 1LVHA 3UCEA 1HH4A 3A6ZA 5HOQA 5K6AA 2WJHA 2O2GA 2B6HA 1KK1A 4QDUA 2FN7A 2VHJA 1JWLA 3H7IA 3KTDA 2MSEB 3IH5A 4O2BA 5L4LA 4M9XA 1CB7A 3OT1B 4GOND 5EC8A 3WXMA 3EPJA 3KB1A 1NKTA 2R44A 1EFCA 1CE8A 4EW2A 4ZCMA 1DRKA 4LX8A 1TPYA 3ROGA 4B3RB 3AX6A 3I39X 2NUAB 4XUDA 5D5PA 1XHEA 4KNVA 2FDCA 3ZDDA 1OTYA 4W9NA 4NFYA 5DXJA 2A1TR 4G5XA 4CYMA 2AJBA 3E82A 4JJ6A 2JCVA 1NJGA 4DNPA 2YZ2A 3GMDA 4OFBA 4ZVQA 4MR8A 3DLPX 2F00A 1HA3A 3PQ8A 3ZH9B 2OCIA 3BM5A 1V9SA 4KC0A 3QW4B 4L76A 5EXDA 4LHVA 1G21E 4JZYA 3U3KA 4A8JC 3QEAZ 3DOEA 2TDTA 3V8BA 2XUZA 1GUYA 4KN6A 1WWKA 4EVQA 4B48A 1VGVA 4GQIA 3UGKA 4DEVA 3RF6A 4JT9A 3ED5A 4ZIRA 3EUWA 4RTKA 4RKEA 5TJHA 4LDJA 2PGXA 1CG6A 4HBGA 4RXUA 1KP3A 2WZQA 3EGOA 2SNIE 4KWIA 3HI4A 4P31A 5FHRA 1I9CA 3WQRA 3CYFA 3DNPA 1D6MA 2PHZA 3PLRA 3CKYA 1NJ8A 3LM8A 3ZKWA 4MZUA 1ETUA 3IAM1 3LRPA 3G9QA 1TFRA 4I6EA 5FLYA 3DOUA 5KC9A 5EXTA 3G7SA 2WIJA 3B8HA 4BQIA 3LF2A 4MR9B 1SBYA 2HQSA 4YRAA 5BW4A 3G5TA 4HAOA 5TLSA 1SKYE 3WJ1A 3ABRB 5LVAA 2Y6UA 3GIDA 3ETLA 3A9RA 2GKOA 3Q1XA 4PTZA 3G0IA 1C0IA 4HX2A 2ZIXB 2GBCA 4PZAA 10MHA 2KB0A 5HSGA 2FW9A 1VRWA 2VNIA 4R40A 1O94D 4B83A 1L3BA 2CEAA 3B1ZA 4GKJB 1Q57A 3EHDA 3O03A 2OK7A 2D4HA 1E61A 2P5UA 3H87A 2H65A 3K0HA 3N2GB 4KG7A 3AILA 3JQ7A 3WG9A 2BMAA 3RAJA 1KDYA 1L7MA 1P17A 2QAGC 1ZXLA 2ZYUX 5DGCA 3HXMA 1ONNA 5U2KA 1AM4D 1G8HA 3RAPR 4CEHB 3M4JA 3KQMA 3NJRA 3SC2B 4JLOA 2GXUA 1NW6A 1H5QA 2V74B 5H16A 1KS2A 2O59A 1KF0A 1TK9A 3FPFA 2J4DA 4C6TB 3WIBA 1VBFA 3BCHA 5G0TA 2PXHA 1NJFA 1BDBA 4IIYA 1P4SA 1FYXA 1IH8A 3QWAA 5E4YA 4AUMA 3EDRA 3SHOA 3E2IA 2VYND 1TMKA 2F9MA 2OAEA 2YIDA 3O94A 3SIWA 1U65A 5EAIA 2CV1A 2P11A 4DSOA 2GUWA 4D43A 1X1CA 5GGYA 5JYDA 3R3UA 3EVTA 3ZE6A 2HR1A 5DXFA 3QNMA 4OU4A 2YZMA 1W5SA 3T9AA 1I14A 3L8GA 4ROTA 3BTSA 4ZHQF 3OFJA 4J0QA 4H4DA 3SF0A 1GG2A 3W2FA 1WPQA 8LDHA 2SKDA 1I0ZA 5BORA 3GQVA 4V1CB 4KFTA 3IXLA 3WGNA 3UJ6A 4DCMA 2I1QA 3DTVA 2EFYA 2GD2A 2R79A 3EGVA 4GPZA 2GWHA 1NM5C 1SPBS 1WW3A 2C3OA 2Z95A 4U9IS 1AA6A 4QAJA 2AX4A 2Z9DA 4G4JA 1L5GB 3VJMA 4XWWA 2HBYA 1QZTA 3WYEA 5AFUU 2FMIA 1RABA 5F42A 1X2EA 2C1XA 1T1SA 4EGJA 1PR1A 2OORC 1CUSA 1BS9A 3Q8WA 1E3QA 1A96A 4JJEA 2OC9A 3GLGB 4KREA 4MI6A 2QLNA 3R0ZA 3OZTA 3TE7A 1RMTA 1C8VB 1V3VA 1D2MA 3L4SO 2ZTUA 4H4CA 5AM0A 1I2ZA 4Y2SA 5DHAA 4ZARA 1E5QA 1RZVA 1IHXA 1NYQA 1QAOA 3EWAA 3NFYA 1ODSA 3ZIAA 1MXFA 4II3A 2OV8A 1R8QA 2ZYTX 3O8OB 3IXMA 3IHLA 3C4QA 1N5OX 3BMXA 4MWCA 1QBKC 3BRQA 1B3RA 1ZKMA 5JVDB 4BDSA 1GPKA 2Z98A 4EHHA 3DAGA 2YQ4A 1EZ4A 3MJRA 3HWWA 4G0XA 4H0NA 4HO1X 2XMRA 4BPRA 3RVQA 1CEXA 1FJXA 1P7VA 2VSNA 2Z8YA 2QYSA 2GVDC 2LKDA 1K7CA 2OD7A 3B48A 2H2AA 2OHXA 3HADA 4JXJA 3EZ2A 4QAQA 4DQVA 1B0UA 5CLIA 2NSDA 4XYBA 1LB1B 4LVUA 5JYCA 4KV9A 4DZZA 3TSZA 1FFHA 5LLDA 3PJRA 3S8MA 2RC6A 3O84A 2W58A 2NU7B 3L1IA 3QXXA 3SDSA 3T9EA 4CDRA 2QE6A 4KN9S 3ZBTA 1US8A 5F1PA 4WN9A 3ZIDA 4B6QA 3WLJA 3N8IA 1VE5A 1Y3DE 3TQHA 4LDNA 1SBQA 1TLFA 1X7YA 2OXRA 3OEHA 3DMRA 3QVOA 4C30A 5KJCA 4I2VA 1BA3A 3RVJA 4OA5A 3ZZUA 2IGBA 4ND7A 4K3UA 2VPZA 1ACMA 5JS8A 3IEMA 2IH5A 4DV2B 2FN4A 4IQ4A 2CJXA 4EFDA 2XA2A 3G2KA 1XLWA 3IPXA 1NA5A 2G6BA 3I9V1 4UTZA 4X1KA 2ZPAA 4FUTA 5TY0A 4I1OA 1V3UA 3GUZA 1UIRA 4MVYA 4YC7A 2W2XA 3EAQA 3ZBQA 1AB6A 2AN1A 1Y33E 4MUKA 3WAGA 1YFLA 2HFJA 1GQQA 4NFLA 3ADPA 4PYQA 4RL6A 1FU8A 1ADYA 1ISSA 3SBOA 4AU1A 4OBWA 1FSGA 1IHUA 4REOA 1DWQA 2G4LA 3K0FB 3BD7A 1PWHA 5JZMA 1N7GA 5HKKA 1J33A 2FOXA 4JVOA 3IKVA 3W5VA 2BEUA 1CNEA 4YXFA 1FP1D 2AQIA 1TDTA 1I9GA 3O73A 3DL4A 4HSEA 4ZYTA 1LH0A 4CIWA 2AW5A 3PKJA 2Y0CA 2C5AA 4PANA 4BX8A 5HIAA 1Q6YA 1ODKA 2ILTA 3BAFA 5HZGA 3QBJA 4D42A 3BQ9A 5IF9A 3CZAA 3K8YA 1M0TA 2JFNA 4RF3A 2WIAA 3RTDA 1MDFA 2IT1A 4JBNA 4XOUA 1S9HA 4Y6OA 2BI4A 2ZT7A 3BX1A 3PUZA 4NYJR 5D01A 4M6WA 2X8JB 4JEHA 1ABEA 3A3YA 2O06A 5E9JA 2LXNA 4CNBA 5IT4A 4PE5B 3QPVA 4EHNA 2BPOA 4US1R 3ROEA 5KWIA 4BBPA 5FOQA 1YZKA 4PHCA 3SIPA 3MUNA 4Z3DA 2HT1A 3L7IA 4UQPA 3HB0A 3G5UA 1GTVA 4V1CI 4HWGA 4MUXA 1WUKS 3TM4A 1PKEA 2JI6A 2WUWE 2WV7A 3PHBE 4R2MA 4CFYA 2P3OA 2RH8A 4KQ9A 2VT6A 5GWXA 4FGKA 1G6HA 3VR3D 1CUJA 2G9ZA 2H57A 1OH7A 4UM9B 5HDBB 3AEKA 3PFIA 1U0NA 3Q1KA 3D59A 4WV3A 1OH6A 3C3AA 3BZUA 1TU3A 2D2VA 2DX7A 4X9XA 3RT9A 4AW9A 3AR3A 4FYMA 1V4NA 4FHDA 3VZCA 5K8LA 4P2BA 1JYFA 3IDZA 3AVYA 1W4RA 4LI3X 4BQPA 3JVDA 5FT9A 3PIRA 4M53A 3DZKA 1WB9A 1P4GA 3DNMA 1CQJA 3H5VA 1EBBA 3VAAA 4I4LA 3KBBA 1XF1A 2ZSEA 2R7NA 5JZ9A 4ZOEA 4ZCQA 1XMOB 5DTMA 5BYJA 3RSQA 2PPVA 1QAQA 5BSUA 4W7SA 4UBJA 2ZE8A 4DV5B 3MELA 5EJ2A 2FNAA 4TKVB 4UM7A 2P9ZA 1AGYA 3P2MA 1WEKA 4ZD6A 1NWCA 3MQFA 2QM0A 5DWVA 3P4XA 1USIA 1WCIA 4ZN6A 3G9XA 2D1FA 1ZJWA 2GEKA 4H7PA 4QLOA 5F2NA 3KYDB 4M1KA 1ZZGA 5DI3B 1QRMA 1AKRA 1UWCA 2CXXA 3ANTA 3G5LA 4GAEA 4XARA 4CMCA 1JU3A 2CF6A 2Q9UA 3NM4A 5IYZB 2IE8A 1N6PA 3ZZMA 2PL3A 2VDOB 3Q3HA 1H0HA 2OBLA 5CYGA 3BH0A 1H85A 4JLUA 3BHJA 5IMBA 3ZWQA 2B1JA 4B3JA 2ZIZA 3AC0A 1Q77A 3UAGA 4RTMA 1E6EA 1LI7A 2P1DA 3NETA 1ZBDA 1ZGAA 1J6UA 2AI1A 5LA6F 4OHZA 5CM8B 2C29D 5JMWA 5HBGA 2DR0A 3CLRC 4DWOA 1P5HA 3MTEA 3PPIA 2V6GA 1SVMA 4GUAA 3RU2A 3GCWA 1QGZA 1XDDA 4RSMA 4LNUB 1NJ6A 1QQTA 3E7WA 4ZDJA 1WJGA 5LMCA 3NZ2A 3E3OA 3OPNA 2IP1A 3QHPA 1NW8A 2W90A 4J9UE 8AT1A 1BMFA 4L5CA 2WKQA 2Z09A 3L7KA 1WZIA 4NHOA 4H60A 4RACA 1TVMA 4KXUA 4ZP1A 2CVPA 4CKEA 4JUFA 2W98A 4U2DA 4HZUA 1MPTA 4P3YA 1BRTA 1L4HA 5JNLA 3THWB 1NQWA 1RWOA 3OC0A 3VYVA 3E0QA 2C9DA 2XATA 2QVCA 1FMJA 4PVCA 3NKLA 3B85A 1GTZA 2AOUA 3ZU3A 2JAQA 5LDGA 4QHSA 4P7KA 3QITA 1NBMA 2C95A 1BE8A 3ZNOA 1XAJA 1A98A 4OPMA 3U60B 1EFDN 4QFMA 1A04A 1JS1X 3R5CA 1K92A 2QDKA 2UVPB 2XSZD 1NU8A 2QSJA 3I2JA 3NTOA 4IIVA 4R1UA 5DTIA 5E9WA 4MGEA 2C7VA 4AMGA 1TMOA 5KWEA 1BXZA 1OBHA 4M3NA 4NE9A 4RNCA 2ORYA 2XI4A 1P77A 1Q3TA 1C50A 2EV9A 2CZGA 4LGMA 4R01A 4BUJA 5C7IO 1PVVA 1QF7A 1RXUA 1TJNA 2PUFA 4QWWA 1LLUA 2FWAA 3L5OA 4ZWNA 2X1VA 3TRDA 3TTWA 4NICA 4MJXA 3D54D 1NNLA 4ZAFA 1T8PA 5CX4A 5H3CA 1S8AA 5KVSA 1RC8A 3R44A 4HPXB 1KBZA 5LMZA 4IDFA 2XWPA 4OHXA 3CPEA 4XQ9A 1OLOA 2I4OA 4JBYA 1PG0A 2YR0A 2OBMA 3L2OB 3DLTA 3ROQA 3W90A 3ZWXA 4UTPA 5A5EA 2CY0A 4DM7A 5IDQA 5J4HA 4I19A 5LFAA 4FKBA 3FLMA 3L8FA 2BGKA 2XLCA 1RJ9A 2IX9A 1SHJA 3LC7O 3ORSA 3PFKA 3WLHA 2MYUA 3B12A 5FWNA 4WLEA 3A1SA 5J23A 1EX9A 3OSUA 3LIIA 3TLKA 3D5QA 5EZ6B 3R7DA 1R4MB 3LX5A 1LF0A 1NF2A 1GPAA 2JFVA 3MMZA 3M5WA 1ZY2A 3T9FA 4QU9A 1LBHA 4B4DA 3TG2A 1F0YA 5JECA 2M6KA 4OP1A 3OY2A 3PB3A 3T7RA 4ZI2A 4LE1A 1DAPA 3STTA 3A3PA 1P33A 1RWXA 4X1IA 1LSSA 4KR9A 3TISA 5AVSA 3CB2A 3KZCA 1MQSA 4TYPA 3GLIB 3VR5H 1I3LA 2EGUA 4NZPA 4FR0A 3WV5A 3AESA 1K7SN 3WGJA 2SHKA 1EX1A 1QCYA 4K7JA 3CX6A 1KDOA 1DQSA 4MLZA 3EX7C 3RFVA 2F9FA 2Z2KA 3HTXA 4Y9SA 3T41A 4G0MA 1IJKA 3QG1A 4PZPA 1YF3A 3WK9A 2WF7A 4Y2HA 4BNVA 3RS9A 1HDCA 3A4IA 5EJAA 5KDOA 4S24A 4R2XA 3STHA 2BN4A 3N86A 3ZNPA 5KDLA 3DKVA 5EJFA 5BSKA 2FPGA 2ZXFA 4MK4A 3TOVA 2GCPA 2XCLA 3CN9A 5TJ9A 3L4BA 4KPEC 2PFGA 3BFKA 1MH1A 3ZGLA 4GXRA 4EB6B 4KDRA 2Q4JA 3V4VB 4B2LA 3HZHA 4KYUA 1WPRA 4QQFA 3QXGA 1LX6A 2WRZA 4GVXA 3THOA 1QE5A 1SZCA 1U3DA 2JIZD 4FFBA 5EXXA 1MF7A 3K0AB 4EEZA 2C00A 4HQRA 2CE7A 4HRXA 1V2HE 4LDZA 2QMEA 4A1FA 1OLSB 3EXEA 2JKVA 1T6XA 4MS1A 1K3FA 2C58A 2TMYA 3LO5A 1TADA 4B2IA 2WF5A 4UC0A 1KAQA 1OLUB 2J67A 2N0SA 2GUGA 4O2AF 1YCGA 4FHGA 4Z8XA 1AUPA 4IH1A 2AUNA 3AHJA 4HNAA 1Z26A 3SSOA 3T4UA 2IBMA 2P8SA 4XIGS 1URPA 3KJQA 4UM8B 1CP3A 2FTKE 2I67A 1OY1A 4NNOA 3TZKA 4D9KA 4ZZ1A 5KTKA 3E7XA 1Q7GA 2QQGA 4AY5A 4C4TA 4WX2B 3SG0A 2XTJA 3R3YA 3UWOA 5B3KA 2P2OA 1IQUA 1Y80A 2FA9A 3D81A 4UOZA 4WDRA 1P6XA 1QIDA 4BVHA 2F55A 5WRFA 1BTOA 1ZK0A 3OPQA 1YDMA 3P9IA 1MENA 1XT6A 4MVWA 4BNYA 1ILEA 3D1LA 1RTTA 3KJFA 4TZ6A 3BJZA 1KAHA 1ZMOA 3C14C 1XZMA 5I9TA 5IUJC 4XWOA 1EA7A 2R4UA 2PRJA 1J24A 3JSXA 4PYRA 4Y9RA 1SAYA 2E4XA 2CLLB 4BAGA 2O8BA 3M83A 3NP9A 3AWIA 4IO1A 2VPTA 1A5BB 4PGGA 4CM7A 2ZUTA 3TZ6A 3FCYA 4YJGA 4M9SA 2XXAA 2P9YA 2Y67A 5GONF 4E75A 4ZCLA 3C3MA 5TS3A 1SHUX 2QL7A 4BNMA 1KIMA 4C5AA 4DADA 5A1TA 3UAWA 3A6PC 1N6KA 4G3SA 2R8BA 4Z4QA 4YAUA 1Z0SA 1XCGB 2PUEA 4OF4A 4PG4A 3VR5A 1WPXA 2OV3A 3AJ9A 2WIBA 3AXSA 1P80A 1VE7A 3GVXA 4L8VA 3EZYA 4O4JA 4DIDA 4OXRA 1M6EX 4FR2A 1FU7A 3EMKA 5EOVA 3ST7A 3B6EA 2F1HA 3SX0A 4EJSA 1CUBA 3PX2A 4BB6A 2IBSA 3PNYA 2A5DA 2ZCUA 1OFVA 1OU4A 4K6MA 4OI2A 2RHRA 1WF6A 4LIPD 4OMDA 4E22A 1WX1A 1EVKA 4Z9YA 1KU6A 2M9MA 3AKCA 5JQGA 1V3TA 2ZDHA 5TT1A 1A7AA 1EBFA 2VK2A 5DHQA 3W05A 1KY3A 5CG2A 1GU7A 2FEXA 5IAOA 1QIJA 4A2PA 5B6PA 1M8NA 3IBYA 5FLXA 3MUOA 1E89A 4I46A 4L0QA 1VG8A 4LMPA 4BGDA 3AFOA 3I09A 1T2CA 5CFMA 3NTVA 1RJEA 4MI3A 5COAA 1BH2A 2NZVG 4LZAA 5LUBA 1Q17A 4IDOA 3IILA 4DHEA 5BT9A 2G1AA 2ZETA 3FOWA 1TW3A 1Z4KA 3INTA 1L4KA 1DIOB 2H2DA 3B51X 4LYHA 1SXPA 2EQBA 4O4HF 5BMVB 3W5DA 2ICYA 4OY3A 3V4OA 2VBCA 1GFWA 1UPBA 1IIRA 1L3CA 1UXOA 3EH2A 3W3AA 1D2HA 5KWVA 3OZGA 5DT2A 4R8SA 3OP1A 5K3FB 4Q1EA 1DMSA 1M2GA 2CHVA 2WJWA 3JQGB 2WVGA 3RYHB 5K03A 3TMKA 2C42A 2HHLA 5CVTA 5EZYA 4QOIA 3VNQA 1Z28A 3URKA 3VAYA 3A6GA 3BIWA 3EGWA 5DMXA 1MOQA 3FPBA 3IUNA 3TDKA 5I9LA 1MU0A 1OFTA 3ZCUA 3F9RA 1KMHA 3NVMB 4BECA 3LG2A 4LWOA 3HDYA 1AXGA 2QVXX 4BFSA 5LYJF 2IYAA 3L1JA 1R00A 3P26A 2HLNA 1JNYA 1U2GC 3H97A 1K8ZB 3HU2A 4BFVA 2J0UB 2OZEA 1LJLA 2R48A 1UWKA 2NSHA 3DFMA 1BKYA 4IGIA 1L5VA 5CB4B 5KTRA 1QZZA 3W2IA 4JVLA 3A1TA 1XZCA 2WB2A 5A0FA 4LZZA 4R41A 4XFJA 3RAGA 3WLLA 4J8PA 1GT6A 3UW1A 3SYTA 4BIMA 3M5DA 4I5GA 3HHPA 2ZU0C 2NVOA 4URHA 2CMKA 4WINA 2WIFA 4M4SA 2DHRA 3AF4A 3EIUA 3MINA 3L7CA 3QJGA 4PLFA 3WBBA 3NVKI 3DLIA 3MLEA 1Q83A 3EF1A 2Y71A 4OHVA 4QFCA 3IMKA 2BKXA 5C53B 4DIKA 2XTNA 1CJBA 3O4FA 4RVHA 2D1TA 3KCNA 4RNDB 3L04A 5BSHA 4X7PA 4OB7A 1BN6A 2I6UA 3KD3A 1G4HA 1TIBA 3Q5DA 4HEHA 3PHHA 4Q66C 4QECA 1COWA 3ROPA 4DL9A 1KETA 1Y7LA 2RG1A 1FYFA 4Q03A 4EI7A 2GM4A 3MWYW 3LLMA 5KSWB 5IVHA 1MW9X 1XRNA 4ZQGA 3ST8A 3IJPA 2AQHA 3M3HA 5KKCA 2ZRBA 3Q15C 4PZCA 4QTZA 3QUTA 2H29A 2R96A 2B99A 2PRKA 2R47A 3EZNA 3FGZA 3D31A 1OA1A 4DLYA 1RU3A 5B7PA 5E38A 4C4ZA 3R6LA 5JZOA 3QXSA 4JWTA 4BLQA 1X1RA 3A4MA 3IQGX 3BICA 4S1NA 3UYKA 3GVCA 2QPLA 3VC2A 5K6AC 1HG1A 5BPHA 2ZWIA 4X41A 4CL8A 4UU1A 2JIZA 5JQGB 1NGSA 4B8WA 1KEKA 1BVRA 2DH6A 1TDJA 2J9FB 2NUPB 3QLEA 4MARA 3ILXA 4IINA 4QRIA 2W71A 3TZQA 5ITVA 2QW0X 5JCOA 2GYYA 1KDRA 3ONNA 4PBSA 1YQWA 2P77A 4JK3A 4Q02A 1E5VA 4F2DA 4JVNA 3I5XA 2FG7C 3SZOA 3UUGA 3NTLA 1ODTC 3EW9A 2IIVA 3BHIA 4I8XA 4LOKA 5DK6A 5JEDA 2GASA 1Z5WA 3KQKA 1Z7WA 3B3AA 3RW9A 3A37A 1VHJA 5IAJA 1UIMA 2OM6A 4AF7A 1RYDA 2VTBA 3EQZA 2X0RA 3U4QA 4B43A 4GZ3A 3JQAA 3H86A 4C20A 2VAPA 1KYTA 1AHIA 1QE0A 3MWLA 3DF9A 3DMYA 3HCWA 4KGVA 4AG6A 1Y6GA 1AKEA 2IHZA 2QVLA 2XGGA 3P0EA 2FLWA 2H1HA 4BO5A 5A5FA 1HMYA 3FWNA 3L1KA 1SWWA 4IZOA 1EWTA 2R1ZA 3LCVB 1QG6A 4XVHA 4EFKA 1WXQA 4K9KA 2UU9B 4BLUA 4JB0A 4IWYA 4CR8A 5BXQC 2R4TA 4ITRC 5ICSA 2V1XA 3TSAA 1H93A 1PJ8A 1XCMA 2HHAA 1TXGA 2W6JD 1QTNA 3ZWWA 5CFNA 2YTZA 3HM9A 5JWOA 1V3QE 2X15A 1C8LA 4HNRA 3IEVA 5ADHA 2BFFB 3MIIA 4LYEA 1YS1X 1MAHA 3VISA 2FSIA 5DOVA 1K5DA 1I6WA 1L6IA 1NG9A 2Q50A 3L0OA 5JD3A 1GGEA 3QFTA 2E0IA 3O4GA 4GOLD 3KTOA 1V9CA 3I8OA 4GKVA 5AUOB 2QMUA 3KEOA 3QUQA 4XSVA 1LRKA 2C4MA 1ZC3A 3CNEA 3GG9A 3DMTC 2CDNA 1HUQA 1Z62A 2ZYGA 1GZHB 3T5TA 3Q6MA 1MRSA 1N0VC 2VEDA 5EGNA 3USES 2CV2A 4DCPA 2AG8A 3C8ZA 1MUUA 3N8KA 4PCUA 4MVJP 4LFCB 2ORED 3A9UA 1V1MB 1ZH0A 1XRJA 4TKUB 4ZOLB 2AFHA 1LPOA 2J4FA 3AIIA 2EIHA 4IIBA 4EI9A 4EMBA 2ZVQX 1NUUA 2X1MA 3IBTA 3PHJA 3R5TA 1T0JB 2P91A 3EPRA 3O8QB 1U2EA 2I6XA 2Y9MB 3EF0A 2QYHA 2UZ0A 4F6RB 3CF0A 5JADA 1YR8A 3I5MA 3KV3O 4XAQA 1P7CA 4J75A 4DMFA 3R5KA 1E79D 1KPIA 2HI0A 1E7QA 3NLLA 3E8MA 5AO9A 2KI5A 2ZIXA 4LQLA 4RPGA 5JNVA 2G7MC 3SX4A 3C3CA 1HDRA 4IS2A 3IEUA 3C5WP 5DHFA 3LY7A 4HQNA 3VC3A 3DHYA 4ES6A 5FNVF 2AYZA 1ZIXA 4KXLA 4RD0A 3TB6A 3N2EA 4IDGA 5CH8A 3LBAA 4UTRA 3QWHA 3BIFA 1GG9A 1E8NA 1XTRA 4D9IA 1SUWA 1X9GA 1XGKA 1ZIOA 1J09A 4KZPA 1P9OA 5U4XA 3VJRA 3AH8A 1FY2A 4FFMA 4IXWA 4OHBA 4BQNA 2QLLA 4WGGA 1IEVA 4AB1A 2IXTA 3GUVA 4KRGA 3RRNA 8ABPA 4BKPA 3QU4A 2HJ9A 3KAJA 2OSVA 5C34B 5BNFA 4D9MA 5IJ9B 4YY3B 1MEJA 5A04A 3T3NA 3A04A 2WUFA 1GV0A 2DAPA 3OKFA 3ZGXA 5IS2A 3CH4B 2DQKA 2COEA 4CMHA 1FP2A 4M2BA 3A1WA 3D64A 3FXAA 2HPHA 2ZB4A 5E1OA 3UHAA 1MHPA 3H2BA 3K1ZA 5EMJA 3WYNA 4X20B 2VOJA 4RABA 4C03A 4P4SB 4Z7JA 4G3XA 1BCSA 1NXVA 3GBPA 3UT6A 3GZNB 4WXEA 5AW4A 1M72A 1ZONA 1SK9A 3E9QA 1LTQA 1FNSA 1QC5B 2QL6A 4RH1A 5CCEA 3PG5A 1Z6YA 4P4UA 4IFIA 5IAAA 2B8TA 1N2JA 3LX8A 4MCJA 5E1MA 3NRCA 3HB5X 1TECE 2GHIA 1H0SA 1OA0A 2JI4A 2XWJI 4LXUA 1LSOA 2VP4A 3OCYA 4RVSA 5EINA 5CDFA 1KJ8A 4XD2A 2O8FB 3MJSA 3DULA 4NG4A 2OENG 3ORHA 1V7QA 5F33A 4NOLA 3V8EA 4ON9A 1KDPA 3VKWA 4YLEA 4AI6A 4EYOA 5FEUA 5KNCA 4MDFA 4EGGA 4DCVA 2EX0A 3HG7A 5ICMA 2IY9A 3OPYB 4O4LA 3SXUB 1GN8A 2CXUA 4X00A 3ZVLA 4PS1A 1U3TA 3CS3A 1GL7A 2YJTD 3FYCA 5F1KA 3PV0A 4ZVRA 1OU0A 4C7VA 1DHRA 5E9QA 2IWRA 3LT2A 4ENQA 3DEFA 3O21A 1RBQA 3TSOA 4EQYA 5BQXA 5AK5A 1J5EB 2AKEA 4BEVA 2VBGA 3HJCA 4Z1OA 1C81A 4ZU3A 1NYLA 5CMLA 3VOSA 1S8FA 5FULA 2PZ8A 3I6QA 4QM6A 2QD1A 4PLTA 1W88B 3FY4A 1N1GA 1Y9JA 1WP9A 3ROFA 4EFMA 5JVDF 3AUSA 4F1JA 1E69A 5KZMB 3FKSA 3GIWA 3O95A 4RK4A 4P83A 5G02A 3TNYA 3WMEA 1BEUB 2PA3A 1UQUA 4W4TA 1NT4A 5L3QA 3GF4A 1AMOA 4HB3A 4INPA 1S1MA 2XZOA 1KR2A 4TT3D 1MVLA 2O8BB 3I05A 2Z1MA 2AMLA 1GNPA 2NXNA 3FPEA 5JR3A 2RBGA 1UZUA 1R0RE 4HZIA 3VV3A 4AMBA 4P5DA 2IYOA 3R8FA 1XIVA 1KFEB 4IMJB 4PZ0A 1PT8A 4NZZA 3GBSA 1MJNA 3KCQA 4ASUA 2GCIA 3C1UA 3ZDFA 3SGLA 4YJ2A 2BGMA 3JR3A 5IKXA 5AI4A 1FDWA 1CF4A 5ESWA 1QV6A 1V4BA 2BTQA 3VR2D 3JSAA 1GL6A 4DABA 3E9NA 3X1KA 3TIVA 4WBNB 2CYBA 4QICA 2FW7A 2K7ZA 3MQ2A 4H1HA 1XMPA 2EP7A 2UYYA 3BMCB 4FUQA 1PYDA 1RBZA 4MQUA 5AHKA 2OPHA 5LQAA 2D5IA 2R0QC 3MRSA 4NZNA 4LRUA 1Q95A 4Y2XA 1DRUA 2PMWB 1JPJA 1Q0QA 2WDZA 3ZG6A 7REQB 1ESZA 1YASA 3GNSA 2BEJA 1VJ1A 3OOSA 5AJHA 5J5AA 1RLOA 1POWA 3QU9A 5FD8A 4ZTBA 1SD1A 3D02A 4R1LA 3TTUA 4L6IA 2QMQA 5IDXA 2GCEA 4ZU6X 3DK5A 1ZC4A 2RGXA 3BH6A 1SVOA 4NAUA 1F3LA 2RAPA 3L6OO 4D45A 4QBTA 1JP7A 3C5HA 4BNDA 2A5JA 1RM0A 2QRMA 3ADOA 5A62A 1I7DA 1SA0B 3V4LA 5TMBA 4PZ9A 2PYIA 3TQTA 5HXAA 3I52A 3KVNA 2PYZA 1Z7BA 1H9AA 2YIVX 1NYTA 3A1DA 2BF4A 2E7ZA 4NCHA 3U4GA 5JD6A 3IQDB 5JAZA 2CNNA 2JAHA 5C18A 2XE8A 3M3PA 2D0IA 5AVVA 3M34A 4IHFA 1H6BA 4EFLA 1ECJA 2NOAA 3IUMA 3HKCB 4IMPA 1N57A 1WVMA 2RK6A 4MV7A 3CR8A 1P1BA 3MWEB 1XA0A 2NU9A 4IJKA 1E5TA 4MB6A 3BJIC 2GTPA 2ZJ3A 3HC7A 1UK9A 3II6X 5E3PA 1C30B 3GV0A 3GMIA 4MPRA 5B6IA 2JIBA 4URWR 5PNTA 3U37A 4XM0A 4BFCA 2G76A 3VHLB 1LBEA 4A23A 1PVOA 2OXTA 3P9ZA 1CR4A 4KXQA 4H3KB 1A7JA 2DWQA 4G0ZA 4WECA 3T4EA 2DF8A 5DN6A 3CIFA 3K0SA 1FNNA 2ECPA 1L5MA 1L8XA 1NUQA 4B71A 4KX3A 2LDBA 1WV1A 4YK7A 1DIHA 1ONPA 1YZTA 2RGAA 4Q3LA 3SQLA 4KFUA 2J31A 3MF4A 1X1TA 4UD2A 2V7GA 2ZUDA 5FTWA 4D9NA 3RJMA 4ZJUA 4KLAA 1H6CA 3TR0A 4D8YA 1UC4B 4IEEA 1Y5RA 3FB1A 1RYZA 4MGZR 5KSPA 2XCSB 3GUHA 3MXOA 3IOCA 1JQEA 1MDBA 2IOFA 3MT8A 1PHPA 3B70A 1M2EA 4MMYB 3W4KA 1EX7A 5JTUA 3RPEA 2OO3A 3N0TA 1RRGA 2I3DA 5EI5A 4PFQA 3V97A 3M6FA 3ME5A 4PYNA 4W6QA 4X1OA 5DGTA 3P94A 1SC6A 3O3CA 3GEGA 4JIMA 3SICE 3MW8A 3BXXA 2QMZA 3H9EO 3QE3A 3SNKA 4UASA 2DKOA 4FGLA 4PG8A 1F6WA 3FFBA 4BWFB 4LDPA 4AY6A 5L3VA 1V95A 5BQOA 3DL0A 4KO8A 4C08A 1GPDG 3QJ5A 2FFAA 2HA3A 2Z3VA 3GOHA 3NBYC 4MUAA 3G6KA 4QE3A 2EEPA 1USVA 4BQEA 4QSMA 4NULA 2I62A 1YC5A 1AO0A 3ZWYA 5IKPA 4ZTUB 3WTCA 1E6MA 4LHWA 4MUBA 2FK7A 1EUDA 1PJTA 2QA5A 3RVPA 3ZD8A 4L9RA 2E4UA 4ARZB 1T34A 4DTIA 1RWVA 1TVEA 2HK7A 5LOVA 1ZM2A 5AK6A 1F2TA 1OHHA 2AYXA 1H3NA 2GVZC 1I4OA 1NXPA 3DWGA 3I53A 3JYPA 4MPTA 4RVOA 3TMAA 3KSAC 3BCSA 3H8WA 4EQZA 1T8UA 4WLVA 2YJGA 1H2ZA 2JJQA 2QIVX 3BL5A 3FA2A 4LZJA 1P1FA 4RIIA 1U7WA 1NE7A 5DK4A 3RS0A 1OTHA 3K7EA 4FYHA 2KWIA 4B3TB 1SC1A 1WUTA 3VTFA 1B8NA 5C1IA 3FZNA 3H4TA 4QPZA 3VZRA 2B9VA 1Q0RA 1KY5A 3BWXA 4DDKA 4MRSA 3SNHA 3UMMA 1SXJC 2CVOA 1SBTA 2X40A 5CGZA 3ZY5A 3UJ8A 3SF8B 1H5UA 1RHQA 3WGTA 3D6HA 3ZV6A 2RGUA 2P68A 3WLAA 1JFRA 3IDSA 3DZIA 2YHAA 3N7AA 3R23A 4W1RA 4V0QA 1AS2A 2OC4A 2Y9PB 3GGOA 4V0LA 4YREA 1AKUA 1RLTA 4G4SO 1U5BB 1DO8A 3H8SA 4H0FA 1MR3F 1RBYA 4MRAA 1TO6A 5GTDA 1G8AA 5I01A 3A1EA 1CWUA 3EZ6A 1HFJA 3F4KA 3L0IB 4YRTA 5FPPA 5T5QA 3TVTA 3V1MA 4LOHA 1KI3A 1R4ZA 2Y1OA 4F4JA 5BN5A 9ABPA 2CMDA 2ZIVB 1SXQA 2CLOB 1U1IA 2A8YA 2WSIA 1NURA 3R5FA 4FN5A 3CISA 1L5HA 5ADXU 1PR0A 1WW2A 2PZEA 3GPBA 4HGPA 1MC8A 2L69A 4OBBA 1RR6A 3UOAB 4ZZIA 5HK9A 2GLTA 2JI8A 3BD8A 3JVEA 1YA6A 2ABWA 1CIPA 3X1MA 1LK0A 4J4HA 3URMA 5CXUA 2FWJA 2W48A 3BWCA 3QMMA 4PXAA 1EGVB 1L4UA 3TQRA 3BREA 4TMWA 3LBYA 4Y6RA 5LCXA 3ADBA 3B7WA 2YUTA 1HM8A 3AHGA 1VB5A 3LOQA 1HY3A 1O54A 3CB4A 3RWBA 2IBTA 5JUWA 2ZBVA 3ASUA 1J2UA 3KJGA 2B0CA 4CODB 4DMKA 4MV6A 4XD7D 4QYSA 2ZRGA 3MHTA 3QG5A 1RPNA 2HRQA 3HXLA 4EG4A 5B1HA 4V0NA 3S68A 2BUAA 1JXOA 2WF8A 4A7PA 4XFDA 1DKNA 3S29A 3W4IA 4J09A 2VVTA 2P4QA 5I4KA 1E6KA 1IVNA 2AC7A 2QR3A 1M74A 2YOGA 2ON6A 3OJOA 4N5DA 4QFDA 1TQ8A 4DT1A 1T5OA 1OWNA 4EEXA 4OIMA 1AV6A 13PKA 4QXOA 5I51A 2PYDA 1FIUA 2BV3A 4DAOA 1S2LA 4ZYYA 2EFDB 3CKMA 2LGJA 2YRXA 3KWCA 1M1YA 3CPHA 1ST3A 3F4LA 3O0TA 5JXWA 2ID8A 1GPUA 2VP2A 5LM3A 3IT1A 4IQ8A 1HEUA 1FLNA 4A5OA 3ANMA 4ZOAA 4EMTA 2FUG6 4K05A 3A1UA 5ARCA 5AVQA 3KP1A 1KK2A 4DR2B 1N9ZA 1NDQA 1RP1A 3G68A 3RFUA 2ZBGA 4RIFA 2VRWA 2IJGX 2F62A 1JHVA 3FZYA 4FNAA 4N7MA 4MVJE 4BZQA 4OMUA 4PAWA 1ZU5A 3HKDA 5LBUA 2DZDA 4GVPA 4E94A 5KHLB 4A2CA 4QJ5A 4WQMA 3AF2A 3HCRA 4JITA 2VA9A 2D1QA 2BFFA 2GN1A 4BP1A 1TJ5A 3LW8A 5IXSA 3FMOB 5C31A 2JRCA 3I45A 3LZCA 5CCBA 1QFYA 3QYAA 5J2UB 2WHQA 3HSSA 1ODIA 3BPSA 3ZY6A 4FFPA 3EGCA 5GZ6A 4PNPA 5JI3E 1JTEA 2VHCA 3PCXA 1PTJA 2BFCB 3PKZA 2GZAA 1FWYA 2A7QA 3OUZA 1KJQA 2AJ8A 5CX1A 4GZMA 5DF1A 3I0MA 1I6MA 4ZCPA 3T7JA 4BFXA 5I47A 1W8DA 1N2ZA 3FPAA 4R3NA 2G06A 1MGOA 1QR6A 2R6JA 2ZRDA 4IDDA 3PDIB 3WDLA 4I0WB 3WL7A 4M54A 1UMDB 3QH4A 5C51B 4X3CA 2IELA 2ECKA 4DE5A 2P6PA 2TECE 3PEFA 1U7UA 1DL5A 2I2CA 3MMPA 3S2ZA 4JR0A 3L8YA 1DC5A 3NDPA 4TXNA 4D92A 1NQVA 5JU6A 3FRJA 2HU7A 3H3XA 1FXWF 4Y18A 1L5KA 4XEHA 3DO6A 1ABBA 1OAKA 2BKUA 4F06A 3TOCA 3DZDA 4CEIB 4CQLA 1EGHA 2BBWA 3F6CA 4YVFA 2ZROA 2H5EA 2ARKA 3GAMA 5E9AA 1E2HA 3ULKA 4OM8A 4TMKA 3KKQA 2BM9A 2J5XA 4N5IX 1XEXB 4ILEA 2XCOA 4IVNA 1Y7HA 4DMCA 3UATA 1ORDA 1TYZA 4PINA 5K0NA 4BATA 1DO0A 3OPVA 2ZVDA 1VQ1A 3T06B 1JZQA 4JJ8A 2ZR7A 4G0WA 3M2TA 1HO3A 4ZI7A 1O7JA 2PEZA 1GADO 1NVVR 4ZOBA 3K9GA 9ATCA 5LQRA 1FX1A 3RV4A 3QI7A 3VU0A 4BHTA 1N2SA 2XXBA 4KOAA 5H59A 4MI9A 3ZGNA 5B4UA 3EQ6A 2I6SA 3JQFC 3G89A 2B1GA 1JKFA 4M22A 1IWOA 3ENNA 3MJ4A 5K2MA 3K35A 3R77A 3LFHA 1U11A 3RO7A 1U0FA 3UWMA 1Z2CA 3ZCRA 5HZKA 1XU7A 3ZBPA 5DX8A 3V33A 2HADA 1O0CA 3ZQ6A 2DR3A 5L4NA 4EHAA 4UNRA 4UU0A 2FF7A 1OAAA 4RF2A 4RPIA 4AN1A 2CNBA 4E2YA 3TNFA 2J9GA 5HS4A 4AKSA 1HZZC 1V5IA 4ADSG 3OIDA 3VBJA 4RM3A 4CI9A 1T2NA 4RD1A 3KQLA 2NT4A 4GPTA 3MINB 2RHBA 3DKKA 4L7VA 5TARA 4EHLA 3LDAA 4D9BA 4ZCRA 1L7VC 2JBAA 4E3ZA 4WOPA 4X61A 4P84A 2D62A 1LDNA 2EERA 4HHEA 4MRPA 3HWX1 5LBIA 2JBHA 3ONDA 3SYKA 1KFJB 1YOVB 2ODEA 4QEZA 3I0NA 3Q3EA 1I5RA 1SXHA 1NXQA 2R1UA 5CUQA 3X2FA 1Y42X 3CEJA 3NHPA 4ETMA 3AVPA 4I8IA 2CFCA 3OZBA 4LJ4A 5FBLB 4EPVA 4ZHSA 4Z2AA 4Z3OA 3K05A 4KBFA 4L5AA 4TTSA 4U5XA 5DHUA 4F72A 1T5DX 5H1YA 4B5LA 5A2GA 3UPUA 1YMQA 4Z1MD 1UKYA 4XYGA 3SZMA 8ADHA 1XXHA 1Y3BE 2CHEA 2P6OA 3OE5A 4MPDA 1AD2A 2DPHA 2Y93A 1N7JA 3DFZA 1H05A 3THXB 2HIAA 3MMXA 3Q11A 1ATZA 1VYTA 2FGJA 2OFOA 1F06A 1PS9A 1TM2A 3DHNA 4L27A 1SC4A 3I58A 5FI3A 3TH5A 4AY2A 1BJKA 2GWRA 4BFUA 2RB5A 4HDSA 5FNVB 3MQHA 2QRKA 1PT6A 4M7RA 4AS1A 3HNRA 5TF0A 1MABA 5T8KA 5JDCA 1RWMA 5JZBA 1J2ZA 3OWXA 4MFGA 4FDVA 4JUDX 1MD9A 4IUBS 1Z5PA 4I9GA 2PBFA 4IYJA 5CFZA 2OZLB 5AFSA 4AQ7A 4Q93A 2BH9A 1ZIYA 2WHEA 2XHEA 3DSRA 5J2UF 2G67A 5IC4A 1LY1A 3IPYA 4HQFA 5ITSA 4HPWA 1A5ZA 4YEDA 4M49A 5C3MA 4CNQA 2XKJE 1X3SA 3O7WA 1RM5A 4TUYB 4GI1A 2NMVA 1U4NA 1TT5B 4E4YA 2I4LA 3WB9A 2C59A 3RU3A 4BO8A 3RIMA 4EUSA 3D7MA 2JHFA 1YVPA 3N7UA 4JXXA 3OURA 4YASA 2P3QA 4XCXA 3TQQA 5AD1A 4BC0A 2FW1A 2HMYB 3ESCA 1K98A 1E99A 1TYBE 1FE8A 4LBZA 3W34A 4K87A 2WEKA 1H2EA 1D6NA 2O2JA 3OFVA 3ICCA 3UJDA 5TQ0A 4IH9A 1O95C 5SYAA 4IHQA 4BNDB 4EJSB 2I0FA 3ENWA 4EI8A 1BMTA 2VN8A 3T38A 1XN4A 1WXIA 4P34A 3E9MA 1WU8A 3LT1A 4PO1A 2DUWA 1Y5MA 1OSNA 2X8BA 1YI0A 3ADKA 3DE5X 1OIVA 4HX9A 2CHFA 4PX9A 1GTG1 4UUOA 2O1SA 1EQAA 3HUTA 1RBMA 3HXOA 3HVJA 4AP6A 1XLUA 1ESMA 3OSZA 4Q4AA 5EN4A 2QBYB 4RGVA 2ROQA 1JFVA 4OAQA 1IQPA 1BAPA 1GG8A 5F4BA 1Y9DA 2BHNA 3ZNNA 4ZJYA 1WU7A 4HCJA 4CT0A 2VWPA 5LMNB 5AQEA 2ZIEA 3CZQA 1TCCA 1G19A 3FD8A 4KQKA 3SOPA 1CYEA 1SELA 2ENWA 1EFPA 1GQRA 1JLRA 1QYRA 4JP5A 4WVFA 5EMMA 2WD8A 2JEOA 2VRCA 1IB0A 2XBUA 1U6JA 3OM9A 4G84A 5HCNA 3GQAA 2RHHA 2XF2A 4JCOA 4RIEA 4URXR 1RWNA 2IXEA 1OX4B 2XMZA 4NJEB 4YJ2B 4HQOA 1VL6A 1SIWA 1S4QA 3F3KA 3ZH2A 5JG7A 2REQB 3DBLB 4D4KA 1HE1C 3QYPA 4PQRA 1D2NA 4X71A 1O0SA 4HNVA 3HZZA 1C2YA 5DDIP 2Q46A 4CF5A 2J3MA 2OORA 1TZJA 2IZ7A 1U2GA 2CHQA 4YCBA 1JWAB 3B2QA 3ESBA 4GUDA 3BVPA 5K8IA 1T13A 1JHXA 3F7TA 2R1VA 4TTAA 1IM5A 4O0LA 5EWLA 1LPMA 1QH9A 4MV9A 1GJRA 2NSLA 2EG5A 4QGFA 4XGNA 5G0SA 4DRXB 3ZDAA 4FHCA 1JA1A 4QO7A 4G0QA 3EG5A 1G20B 1JJIA 2ZSBA 4LE0A 2BEVA 4GWLA 3D7SA 3G8DA 2VNHA 4JJ4A 4Z5XA 1X1SA 3MOIA 4ARCA 4AICA 1U99A 2PPLA 3KM0A 1HYHA 4OFWA 3P2KA 1BW9B 3S2EA 3WQQA 4QNRA 2QZ9A 3KWMA 2FEWB 3OO1A 3IOYA 2PSFA 4OIFA 3A9WA 5DISB 3C48A 2YKGA 3RSGA 4XYMA 5CLQA 3IRVA 4B3DA 1VBMA 2UYHA 1UBTS 3GUYA 2A9JA 1KGDA 4TQ9A 3UA4A 3PQ2A 2BBSA 5CA1A 2Q7XA 1FTWA 4IRXA 3T15A 2MT9A 1ZW6A 2ZB2A 3PCRB 1NWHA 2NWQA 4XPIA 2H9IA 2QLBA 2V9PA 3IEPA 5FTJA 5T4BA 1VOTA 3OPYA 2QOEA 2F8LA 4YGYA 3UY4A 2QK4A 3TKAA 4XRGA 3GT0A 2BMDA 1Z7GA 3L0DA 4LC0A 4MA0A 3TGPA 1S2NA 1KZ9A 5KSZA 1ESDA 4B6GA 1T1GA 3W2EA 1R0XA 3ZU6A 1DG9A 3M1LA 2Z1DA 4CQMB 3AVUA 5G0VA 1Q0PA 1NVDA 2Y1LA 5SZKB 3TDMA 1N5LA 5DCWA 2ZBRA 1AQ6A 2VNKA 5HJEA 1ZAKA 4AUEA 5AVWA 2OOKA 3ORFA 3PIIA 4DUGD 2PS3A 1NV8A 3K30A 3I28A 2BMJA 3DWFA 5CT8A 3CVXA 3MQ4A 1DAHA 3PHCA 1Q19A 1FTGA 4CLRB 4ZI7F 1IQ0A 1EWKA 2XV1A 3THYA 2WHPB 1E3JA 2AWOA 3P9XA 4DREA 2HQ1A 4FT4A 4FYIA 2VWHA 3FSEA 1O94A 4DLAA 1SRQA 2OP0A 4LJ7A 1DKPA 1KJYA 4TWBA 5CRIA 1UOQA 1C7FA 4XLZA 1E2DA 5IBCA 2AOXA 2XUHA 5HX7A 5IXYA 2OCGA 2YHIB 3AVOA 4PGHA 4RE5A 3U3RA 4U8GA 1DCKA 3COWA 2AIRA 2CCGA 4ZYLA 1BKSB 2I54A 4IDBA 1UXIA 1TF2A 1F14A 2VYFA 2NVUB 3VKFA 4DIOA 4U1RA 2P2CA 5A7FA 2JNWA 3AWDA 3TZEA 5IUKC 1UZMA 3GJYA 1DQYA 3WQBA 2BZGA 4QJBA 1YDFA 2I2AA 3S7TA 1CEEA 4EGQA 2YBDA 2R8RA 4ZRMA 1AGXA 2G0AA 2JGLA 5FA5A 1HL7A 4MV3A 3NNSA 1XCJA 2QAIA 3DE7X 2YWJA 1M8JA 1VPWA 1QVRA 2ZAIA 2DPLA 4CF6A 3NHRA 4CUKA 2YJNA 1M1NB 4IXNA 4IW3B 1MIOB 1XWWA 2NM0A 1WR8A 3S8EA 3JQEA 1R50A 3CF4A 5BWOA 1DELA 4QYIA 5HE8A 1NKVA 5JHGB 4IEIA 1RQGA 1LRLA 3CZ5A 4R4JA 2FJ0A 4QOFA 3LVBA 1PR9A 2FKNA 2PKQP 1K3UB 1XELA 3QKWA 5TPWA 3TCKA 5C5EA 1TKRA 4HDQB 2CMGA 4ZT5A 4P4LA 4G81A 2Z2IA 1NFRA 4KRXA 1W36B 1M34E 5F9FA 2QVBA 1TMYA 4BC1A 3FVQA 2Q5JA 3WIUA 1HNZB 1HSZA 1WS6A 1O9HA 3EBLA 3KFVA 3QPWA 4J3FA 4JA0A 4KSBA 3LWZA 3X1WA 2BD0A 3CUTA 2GJSA 4HDKB 4K46A 1V37A 2L0XA 3G88A 2Q0HA 2VHTA 1FFCA 4OGKA 2AVNA 3U4MA 1M2OB 4UAVA 1T91A 2R6CA 3K70C 2A6PA 3ASZA 3O2JA 3NDBB 3B1WA 4EL0A 5DEMA 3I83A 1ISIA 4PC1A 4G5FA 4LJ6A 2JLXA 2NO0A 4U8HA 4IYRA 4US0R 4KXWA 1YA8A 3HV2A 4IIDA 1SVIA 2E5WA 1NY5A 1ANKA 4UVEA 3TI7A 1OIXA 4WFQA 4OI4A 2XMQA 1V41E 2QYTA 1R9GA 5F64A 2JRLA 2XQFA 1ZUWA 4TKVA 5J1SB 3HEMA 1RMQA 3N3BC 2QNBA 4NDZA 1ISHA 3B9PA 4RE6A 3SI7A 3MYYA 1HQCA 2Q07A 2WTNA 1X7ZB 2ZP1A 1S3SA 5BWNA 1OTXA 4J6FA 1KQAA 1KO7A 1UBLS 1NW3A 2QS9A 3KWDA 3HVUA 2HZBA 3QENA 4G8CA 2NV2B 2QIOA 2WSMA 1SSMA 3ID6C 5EVCA 3UM9A 3WLIA 4DOMA 3LSTA 1UFOA 1KORA 2CNLA 3EIEA 3G02A 2PKCA 4OXQA 2G9VA 4IV8A 5EHGA 5CW2A 1SQSA 4DEXA 5KUTA 3HP7A 3PTZA 5DHPA 1XHFA 1NJ2A 3M5CA 3LNTA 5LMUB 1RM4A 2O8NA 4PZUA 1TK2A 4I4TF 2EKLA 3RKUA 1KEEA 4J4BA 1WDKA 1XTVA 2FP3A 2HXGA 2W7TA 3E5HA 2KJQA 4MITA 3O8DA 2XD9A 1ID8A 4UCWA 2X41A 3EARA 4ENUA 5JSYA 1U28C 2WAMA 4K9QA 3ZBUA 4DDMA 4XVCA 3OX4A 2CDRA 3LU1A 2JFYA 1SD5A 1HDXA 1A5TA 4LA4A 5AW1A 4JBIA 1FVFA 3SDBA 1Y8QB 3TLZA 1YQ9A 1A9OA 1SHZA 3FBWA 2QTWB 2NQ2C 3BKXA 4HTFA 1BFDA 1GUAA 1X3LA 1KY4A 3DC2A 1Q91A 2VPQA 2C9ZA 5TB5A 2VYVD 2WLCA 3UMRA 3RM3A 3FJYA 3VI3B 3QFFA 4Q15A 2F3TA 1M6HA 1P2DA 3L79A 1P2TA 4H77A 4A8JB 2QQ0A 4Y0AA 1FUUA 1DXOA 3JAWB 1QU3A 1NFFA 2C4KA 2F8SA 2J0UA 1DMRA 4V2UA 5DW0A 2PSHA 4BVAA 5BR4A 4AXBA 1D4ZA 3AT1A 1QX4A 5BPFA 1NLZA 1XZJA 1HT2E 2GA8A 4UUQA 2AXQA 5JW6A 3B3QA 3OF2A 5AWFC 4EYEA 2AF4C 3MWFA 4XYLA 4A15A 2WUVA 4NARA 2BW0A 3MGCA 4PX2A 1C4KA 2W2LA 3BFJA 2C54A 2AL7A 4D4LA 4KPUA 4O3FA 1NVMB 1YVRA 4B74A 1K9VF 4X7BA 4AAYA 5KB3A 2E5LB 4LZLA 1ENPA 1AVTA 3QFRA 1NAHA 2REBA 5AJUA 3ZN2A 3UK6A 2B7CA 1KQGA 1G0OA 4IHJA 2P2GA 3HA2A 4LJSA 3HL0A 2G1PA 2CFIA 5C80A 4D3DA 2ILVA 3GRAA 4KO3S 4LWPA 1XZQA 1JL3A 4XR4A 4XGIA 4EI2A 3LBIA 4YRKA 4ISBA 2XXJA 2ZTSA 5BN1A 2BP7B 1OREA 4TS9A 3VU8A 1GKLA 1YSCA 3QRWA 3D3WA 2VDUE 1K2WA 4FHZA 1TM3E 1M8PA 4PX5A 1NBME 3SP1A 3TFOA 5TE9A 2PX4A 4CQNA 1KJIA 3G8CA 4LCEA 4R9VA 3T1VA 4GX2A 4NENA 3GPIA 4MZDA 1DIRA 3GZTB 3REOA 3DKIA 3PR3A 2DU8A 2EKQA 4EG1A 4DZRA 2I8CA 3H5LA 4BMZA 4BYGA 1U5AA 1JDTA 3I3XA 2VBIA 2BLNA 1XCLA 3D0OA 4V3CA 4YV0A 4BAUA 3NHKA 1UBHS 5MN4A 4BWYA 5CK4A 3HJUA 2I4MA 4IDAA 4B73A 1L5SA 4V38A 3VR4D 3KFLA 2Q5OA 3NPAA 3BIJA 3GJ7A 4FVTA 2DWPA 3T57A 1R9MA 1W0KA 2QMOA 4Q9IA 4P08A 4AJKA 4HMPA 4RF4A 5C1BA 2NV6A 2VSOA 1RC1A 2RK4A 3INRA 3R4CA 1JAYA 4GW3A 4L74A 4TS4A 5CT6A 2V7TA 1I3MA 1X80B 2IF0A 2PMDA 4QTTB 2F43B 1I2MA 3X1JA 5ILOA 3KQVA 3E53A 4HB0A 1TTTA 1T3ZA 1FX0A 1VPDA 2ID9A 1KHTA 2BMFA 3GCDA 3ITNA 4AX8A 4B0PA 4R8RA 3I04A 4Y30A 3KKKA 1OX4A 3VVCA 2KQUA 5B4TA 1JDUA 4JYAB 1NVGA 1EB8A 2V98A 4HH3C 1O57A 3HN6A 4C7KA 2UZ1A 4BLSA 5IPFA 1EFPB 1RQNA 1NG1A 1P44A 2WA1A 2F3SA 2YJ6A 2XMPA 2M32A 3C8DA 4KE8A 3OLVA 4KAXA 4UVDA 1A9ZA 5AP9A 3SR3A 4B32A 2XVAA 4UULA 5IJAA 1GUFA 3ORRA 1SIUA 1G59A 3SEFA 2ZJ2A 3G2OA 5MDHA 1YRHA 1FFDA 1XHLA 2WKRA 3MWKA 5FO0A 1FXJA 4BRUA 5J4KA 4E3WA 2GBLA 3AJ8A 1G0NA 3DLCA 2GH1A 1I80A 3DV9A 2VZ8A 3WOVA 4QGGA 5IT5A 4CETA 1R3UA 1QZXA 2LZ0A 2G0TA 1RKVA 4XW2A 2HYDA 4BMNA 1X80A 4KUEA 1ZM7A 4ZEXA 1PQPA 1AHHA 1XA4A 2I6QA 2DBRA 3A06A 3ILVA 1BIFA 4BVKA 4Y2PA 1MO5A 5DTJA 1C7RA 3GJRA 1YK0A 3AI3A 5FPQA 1CY8A 2I80A 4FMPA 4QRHA 2Y27A 3R9XA 1HOXA 4QA9A 5EZQA 3UW3A 2JEZA 2FMUA 2XUOA 4KO4S 3EZXA 3F1LA 4KGZA 4UHKA 2H1SA 3ZLJA 3AF3A 3OEYA 1JLLA 2XNJA 3DV0B 4FKMA 3P71T 4OQNA 4YNBA 2FMHA 3MCUA 3K0KA 4MYHA 3SY8A 3TXXA 1T24A 4IHGA 1FFXA 4HX5A 2Q45A 3F6RA 4Y6GB 5HIIA 2EF1A 1SU8A 1CETA 1P7ZA 2R8PA 5EIEA 4E2WA 4MI1A 2E85A 5H68A 3U13A 5GY7A 1NRWA 2OFPA 2V1UA 4QDKA 2QTRA 4PGAA 3EEIA 2HV9A 5JAHA 1NQXA 2WWIA 3L4BC 3HU5A 2QAGB 1U9ZA 1A7KA 1DS6A 4TPKA 3WIVA 1RM3A 5DYIA 4AP5A 2X9NA 3GEIA 1X15A 5EL0A 5IABA 1TQ4A 2B8NA 4PO9A 1YIDA 3N39C 4QGBA 3VR1A 5EUBA 1H8HA 3ACDA 1LDGA 3VNSA 4UBOA 4BO7A 1YJBA 3AF5A 3Q3IA 2P2LA 4MR9A 5KYUB 4NPAA 3OA0A 3LRTA 4XPZA 1QBGA 2GJ8A 3SSAA 1QK3A 1VL1A 3SHQA 2E6UX 1IY0A 4FYXA 2HJGA 1SSTA 1KI6B 4ZVPA 1OAOA 2QGNA 4DR6B 2C9MA 2XQIA 4PAMA 4AURA 4EJMA 4UM9D 1YB7A 1IAVA 1NVKA 4AKTA 1JIUA 1VDMA 3D6AA 3LA6A 1G5QA 4P58A 4X1IB 2ENUA 5LKAA 2R2AA 3Q7PA 5JWRA 2ADMA 4MEBA 1CFZA 3CEPB 3IVRA 4AZSA 2D74A 3A3OA 4B79A 1FVXA 2NNWB 3D7KA 3UGQA 4A4DA 3JAWA 1EFAA 1TZMA 3FR7A 3AXTA 1EKXA 2QPAA 4OHPA 3P32A 1LEHA 2VH5R 4U9UA 3HDVA 1WMDA 4MQ6A 5L8VA 3E84A 4CR7A 4HVLA 2R8XA 5A02A 4PPFA 1VMDA 3A4LA 2JI7A 3OQBA 3OLXA 4KTTE 1LFAA 4CLEA 2FFJA 2X0EA 4MVJM 1J8QA 3WRVA 4ZKDA 4CM9D 3GJ8A 3WBKA 3PVCA 5KTMA 2HDHA 2K87A 4U02A 3VNPA 5ALIA 4ENTA 3LCUA 2CC2A 3SC3A 1DQZA 1U2SA 1YULA 1JG7A 4YI5A 3TZHA 4BKUA 2JLQA 2DWCA 2AS0A 4IUCS 4PLYA 4U6QA 4A2QA 4CKCB 1WBBA 4BZZA 5THQA 3RYIB 1R15A 1PZEA 4JKIA 5HA5A 5LXTA 4X66B 4A6XA 1GPH1 1KAEA 4O2BB 2LR0A 2VDVE 3A9VA 4ZJPA 4Z7NB 1WOYA 4RCYA 1LD3A 4FZJA 1IVYA 4EG5A 1T4MA 2WWWA 1OI7A 3F7NA 3OMLA 2O6HA 3RT7A 2Z3WA 5BMOA 2Y0DA 3KJHA 3ER8A 4D0SA 2B30A 3KXIA 4GI5A 3UCFA 2Q27A 3GRPA 1X14A 1E60A 1PGOA 1PNQA 3ZHUA 5JNSA 1YQTA 3TL3A 2WJPA 3C8UA 2FWIA 2ORVA 2X5NA 3WA7A 3FWYA 2IOFK 2PWBA 3VYUB 2X77A 3BB1A 3P45A 4X20A 5IEBA 2DCUA 3NGMA 1T9DA 5L7WA 1Q74A 2PJDA 2Y99A 3KE8A 3MYRA 4UDYX 4TTVA 5IJWA 3CVJA 2XCRB 2PLFA 5DNWA 1PL0A 3FTCA 1R6XA 1YKFA 2VPYA 1S8NA 4G0PA 2NPIA 1G7SA 3KYBA 4JD5A 3M9XA 2HZ7A 3TINA 3EVNA 2HEGA 2XVZA 5AVXA 3VYWA 1C7QA 2DBQA 1A76A 4K88A 2G4CA 5ESRA 2BCJQ 1P4RA 3ESZA 3FNIA 2PKRA 4LISA 1TC1A 2X2OA 5DX0A 5F7ZA 1OYVA 3IT3A 5BSWA 3MNFA 3TUIC 1ILWA 2WG2A 3CZ9A 2VC2B 3HKBA 1C9DB 1ZUHA 3EIOA 4FGJA 4HFMA 2J59A 4PHFA 1OGYA 4LYAA 1K5PA 2O2HA 4XKJA 1RQ2A 4AN0A 4DV3B 3PEYA 1P3Y1 3TGWA 4HQ6A 2HWWA 5FNZA 3HLYA 1ZGJA 4WIAA 5BQFA 3HA5A 2BJWA 2PBRA 2FW8A 4XIYA 5FFFA 4D8UA 1NMSA 3D3NA 4E46A 3PSHA 3BGWA 1JR3D 3MGGA 3WL3A 3AM1A 4QPDA 2FDXA 5A9SA 3S2UA 2CDAA 5IHXA 2BFCA 3KQPA 2WHYA 5GOTA 2GK3A 3RIHA 2GXSA 2WTXA 3GPDG 3RQIA 5K6RA 1CS0A 2UZ4A 5HOEA 4D2IA 2BAGA 4BTLA 2BFNA 4N9WA 3NALA 2PKXA 2R6HA 2WICA 4DG9A 4M76B 5TIIA 3GQ9A 3MTQA 3QV2A 1GO2A 4ZQHA 1ISGA 2PRYA 3ZTTA 4D6XA 1BOFA 3AFMA 3B1VA 2NQ8A 4EG3A 1F0NA 3HGTA 3KHTA 1UQRA 4PIPA 4RLFA 4F45A 1YI8A 4Y6SA 1UJ4A 2X76A 1AKMA 3ECSA 3IAFA 4JUCA 3LUJA 1R10A 2J3JA 2V3WA 4G5RA 2FUG1 3T4XA 4L8WB 1Q0TA 2O8EA 4B3IA 1ZESA 5AXCA 3IBCA 3EG9B 5TT0A 3PGKA 4GZ6A 3MAGA 3CLSD 3WTBA 1AQJA 4G3QA 1EAYA 4H4EA 3S1LA 4IKOA 1B8VA 2DFVA 3RC7A 2OWEA 2O8CA 4ER5A 4GSYA 1GSHA 1YBHA 4KHPB 4JYBA 4N4AA 1P81A 2O1XA 4ZA2A 4PLVA 3P1JA 4LVNA 2FP4A 4EHBA 1CY1A 1DTEA 1PTJC 3QVVA 5EWJA 2B61A 3COPA 4YRJA 4CV0A 2AOWA 4PRKA 4JV5B 4XFKA 1F51E 1G38A 4IZ6A 5THKA 3OMWA 3WYAA 1BWSA 3HR7A 3H7AA 5K09A 4KITB 4IG4A 4LCBA 4N0QA 2NU8A 1U8TA 2DP4E 2W6PA 1EFKA 5KJ1A 2CN1A 2Q1WA 3FYSA 3CQ9A 1N2XA 1SEPA 3E23A 4GXQA 2PWZA 4NABA 5DP1A 5HF9A 4Q3EA 3I04M 4GT1A 2BHRA 2C7GA 2YHIA 4BX3A 3QW2A 3RNLA 2IC5A 5KMGB 3R4VA 4ANFA 1OXVA 2WQZA 2HXYA 3FAZA 5AJVB 3A6HA 4LNAA 4NEGA 2H07A 5TPZD 3ZJTA 1MO6A 4J7CA 1NNUA 3R0VA 4YB8A 2W6NA 4JI8B 4NBRA 3AVTA 1UZLA 2Q3JA 4YQZA 1YS9A 1XQ6A 1H8HD 3QVUA 4MR7B 5FPYA 1U0GA 4IAOA 2VK8A 1MG5A 4DLBA 5M5BA 2RGRA 2IZ5A 1N25A 4JB8A 3OQ6A 4M55A 1DVRA 2CNWD 3FUUA 2QRLA 4AX4A 2DY1A 1Y1SA 3E3LA 3VNBA 2I34A 2ZW9A 1H0RA 1UKCA 2INGX 2XB4A 4JJKA 2X2PA 4IIEA 1AURA 4NCBA 2OK8A 2ZQ5A 3WGZA 3CCCA 1E18A 2O2IA 1IG3A 3OZ7A 3H1TA 3RYTC 2IHNA 2PMBA 3MUEA 4BP3A 2WMYA 4W9RA 4KQGA 1P61B 2HX1A 4EVRA 2FX2A 5E6UA 3QWBA 4JC4A 4FW9A 1G5FA 4HV4A 2KLBA 1U7TA 2VG8A 4GR4A 4B4WA 3T1YB 1VXRA 2Y8EA 5C5DA 5LZ4A 3V9AA 3VYTB 3H19A 3NYQA 5HCUA 3BRKX 3QFSA 4E09A 1AS0A 3JY6A 5E2AA 2ZJ7A 2BDTA 1GTJ1 5SV2A 3AR6A 2OHOA 3DE6X 4H7DA 2ZPTX 3I23A 4BNHA 1VP3A 3D8TA 1L4YA 1NJ1A 2BGNA 3GI1A 4ZCIA 1EWVA 2P9TA 3K5WA 3PD7A 5K3DA 3BE8A 1BO6A 4TYYA 3QPDA 2HPZA 1IDOA 2GGSA 3BXEA 3CR7A 3R2WA 2ATCA 1HDGO 1VMIA 1X7YB 1O87A 3GGGA 4ZO8A 5CLJA 3NAMA 4F3KA 4XIJA 4D4GA 5DB4A 2IRWA 3MILA 3EFBA 5BXYA 2XRZA 3G0GA 4TWRA 1O4WA 1YL6A 2OBNA 1C29B 4G86A 2O7SA 3IHTA 1YQDA 2QLFA 3WSVA 4YJHA 1CQIB 1G21B 4G0NA 4L5JA 5JJBA 3I92A 3EVFA 1U0OC 2H18A 2FK8A 5F35A 3V3KA 3CVOA 2I3ZA 3LA8A 3R40A 3MJHA 5FOUA 2KYRA 2XZLA 1I4TD 1EJ2A 3DB2A 5CEFA 1U0TA 5SICE 2X0JA 3HJFA 4P93A 4H17A 2Q2NA 2MYNA 16PKA 1BFKA 2Q3LA 5ALHA 5ALRA 3WMGA 1JQDA 4AMZA 4C5BA 1Z6AA 1F17A 3LNCA 4JXKA 3FDIA 2ZS7A 2RJ3A 1FMTA 2DHQA 4RMIA 4W7HA 5CT9A 5DBEX 5CDUA 1E2JA 3GFGA 1Y7IA 4LOAA 3VOTA 4DDUA 3C98A 3A58B 3O1HB 1QQ6A 3DMDA 3ZVRA 1QHSA 1ZNZA 2FN9A 5AHRA 5DNCA 3U3DA 2W37A 1Y5NA 3UAZA 4BKRA 5EJEA 1Q7BA 3FUXA 3PEVA 1Q44A 3IAUA 1NQOA 2ZJ8A 2HIHA 1PV1A 4TQGA 5AKXA 4BMSA 1Y7PA 2NACA 2ZI3A 2W6JA 3IODA 3O2QB 4HN9A 4O02B 3GLUA 4QUHA 3T3GA 4D8TA 5GJWC 5CD9A 5I7HA 2ZSKA 4GDMA 2FJPA 2VJCA 4A3SA 4LOLA 2OAQ1 2QRPA 4F96A 4HVCA 1E9VA 1D04A 1ZGHA 5ELMA 1FQJA 4B35A 3MBKA 1XX6A 1EGQA 2AGVA 2XA9A 5I7EA 2AE2A 3FF1A 4HK4A 4FB5A 2LCFA 4YI3A 3K96A 1Q50A 4GQBA 3OE1A 1C5KA 1QANA 2P9QA 3QVGA 1YZVA 2C07A 4WY2A 4Z0TA 3E5RA 4AY4A 4BO4A 4ZQBA 3CCBA 3EMVA 5KYXB 4P22A 4E4TA 1IULA 3NH6A 2QTVA 1E6UA 3LXUX 3W79A 2ZIWB 3DL7A 3QFCA 4LKRA 1X39A 4V03A 3WGGA 1JT2A 4RM2A 3UJPA 1S80A 1R8YA 3L7NA 1XC7A 2HL6A 4OGLA 2J6CA 1U7XA 4OSEA 1VZ2A 1G5RA 3MWEA 3LECA 4XLLA 2EJUA 2H11A 4Z4CA 2BYTA 2IIPA 1D1TA 4G5HA 2PS0A 5DW3A 1ACLA 5FAXA 5I9BA 5JLJA 2ZYSA 1SOWA 1B6SA 4B09A 5JMTA 2IEYA 3FTFA 3WJAA 2FR8C 4ID9A 3I2IA 3K1JA 4JDUA 4D0GA 1GR1A 2FWNA 2PUTA