4M9CA

Weei from acinetobacter baumannii aye
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
MTMIIGVYGASGFGKEVMPLVRQQFPTLSKEQFAFIDDGLSGTTLNGYPVLSYLDFISKPADHKAVTIAIANSVVREKLVSLLEKDGVQHLAVQSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVAHDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQGTPDKPLIIGKGAIVGMGAVVTKSVPAGVTVVGNPARILERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bacterial transferase hexapeptide (Three repeats) family pro
publication title Biochemical analysis and structure determination of bacterial acetyltransferases responsible for the biosynthesis of UDP-N,N'-diacetylbacillosamine.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 74
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF17836 PglD_N PglD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4m9cA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m9cA01
4HR7A 2I80A 2V0KA 3KWCA 3R1WA 5K2MA 4ISXA 4E1KA 2QK4A 3ORQA 4MYOA 3NZ2A 4R7PA 4HNUA 3U9SA 3Q2OA 4IWXA 4MZUA 1DV1A 4MA5A 3TQTA 5E3QA 5ADXV 3EEVA 3MQHA 4DCLA 2YZMA 3TDTA 2OEFA 2V59A 3FSCA 3SPTA 4AC3A 1SSQA 1OCXA 4C5AA 2I87A 4EA7A 1LXAA 2V58A 3OW5A 3D8VA 1PX2A 3WO1A 2IUAA 1EHIA 1QRMA 4FU0A 2V0HA 2RIJA 2WLEA 5ADXU 3R3IA 3C8VA 2VHEA 5DEPA 4J6EA 3TV0A 4M9UA 3T57A 3TIOA 3TWDA 1KK5A 3RFCA 3FOQA 4MV4A 3MJFA 1FXJA 3I12A 2W70A 3BG5A 5L6VA 4EG0A 2GPSA 4ME6A 2W6MA 1KJIA 1AUVA 1QRFA 1GSAA 4GGMX 1MRLA 2OI6A 4N6BA 3K5IA 5H80A 2QKXA 4MA0A 2AQ9A 3VPBA 4HNVA 3RV4A 5U2KA 3OTMA 3ST8A 3V4EA 1A9XA 2WLGA 2R7MA 3E5NA 3I3AA 3BSSA 2JF3A 1I7NA 1IOWA 5DMXA 2YS7A 1M6VA 2I8CA 3V4ZA 2VD4A 1B6RA 1CE8A 1UC8A 1KGTA 1KHRA 1KRRA 2QF7A 2ZDHA 3GUEA 4HURA 3VOTA 4HCQA 2NPOA 4KQLA 1T3DA 2V0LA 4M98A 5AFUV 1KGQA 1G97A 4MV8A 4EA9A 4N6AA 1V67A 4G87A 3VBIA 2W6ZA 1KK6A 2W6OA 3HBLA 4M28A 4MV1A 2GLTA 1KRVA 3R5DA 4AA7A 3VBKA 2GGQA 2V0JA 2R7LA 5D8DA 3FSXA 3BSYA 2W0WA 3VPDA 1JDBB 3VMMA 5AFUU 3WNZA 3R5CA 4E4TA 4MV3A 3FSBA 3K3PA 2DLNA 3VBNA 4EABA 4M9CA 2WLFA 3BSWA 1KJQA 1CS0A 1IOVA 2V5AA 3ETJA 3VNPA 3QFFA 3OUUA 3N8DA 1HM0A 4KNRA 4N69A 1KK4A 5JQWA 5E3PA 1KJJA 4AAWA 1YP4A 5F42A 3PMOA 3KWDA 1I7LA 2XATA 2Q4JA 3AW8A 2IC7A 3GVDA 4G3PA 4IHGA 3SE7A 1TDTA 2R7NA 3VBMA 4J09A 4KNXA 3VBLA 1ULZA 1C3OA 2R87A 3HB9A 3DK5A 4HZCA 3RUPA 3FTTA 3G8CA 3V4SA 5DG3A 2GPWA 2DZDA 3JZFA 3BRKX 2W71A 3OUZA 3WO0A 4EAAA 3K5HA 4R36A 3TISA 2PBZA 2I5KA 3D98A 4DIMA 5BPFA 4MV7A 1EYZA 1BXRA 2QIAA 3IXCA 4MAMA 2VPQA 2P2OA 2XD4A 4IZOA 3FWWA 2C00A 4M2BA 1MR9A 4E6TA 3IGJA 1SSMA 2R85A 2ICYA 3TK8A 3SRTA 1SSTA 5BPHA 3U9TA 1THJA 3BXYA 4M99A 4E79A 2R86A 3JQYA 3OUPA 4HNTA 2GGOA 4EGQA 1KEEA 3CJ8A 3R3RA 1S80A 3HSQA 3R5XA 4L1KA 2YS6A 1PK8A 4KPZA 2ZDGA 4DLKA 3BFPA 1GSOA 3Q1KA 4RZQA 3HJJA 3ECTA 2YRWA 3TW6A 2ZDQA 2R7KA 2JF2A 4EA8A 2OEGA 3MC4A 1DV2A 2IU9A 1T36A 3VPCA 2W6PA 1BNCA 4EQYA 1MR7A 2IU8A 3R5FA 3MQGA 2W6QA 3DJ4A 4N27A 2YRXA 2IP4A 2YZGA 3HO8A 1V3WA 3EH0A 2YYAA 1QREA 3LWBA 1VKZA 3LP8A 2W6NA 1J2ZA 2J9GA 4G3SA 3OTZA 4EGGA 2FB9A 3FS8A 4MFGA 1C30A 1YP3A 2TDTA 3OU9A 3R5BA 2QIVX 2VQDA 3R5AA 4HZDA 4HUSA 4IHHA 2ICXA 5C1PA 2WLDA 1E4EA 2Z04A 3P1BA 3ORRA 2PN1A 5DEMA 4MV9A 3G8DA 4QSHA 3EG4A 3R0SA 2WLCA 1HV9A 4IHFA 1KRUA 1E4EB 1YP2A 4R37A 4M2AA 3VA7A 4E6UA 1KJ8A 1XHDA 3F1XA 1KQAA 1QQ0A 2R84A 3P47A 2PVPA 1QRLA 4IWYA 4WD3A 4H7OA 5L6SA 3AX6A 1QRGA 4K6RA 3VBPA 5E3RA 3JZIA 4EGJA 1UC9A 1EZ1A 2OI5A 2P0AA 2XCLA 3Q1XA 1KJ9A 2YZNA 1Z90A 5C1OA 1HM9A 2W0VA 3I3XA 3KWEA 4G3QA 4E75A 2FKOA 2DWCA 1GSHA 4FCEA 3FSYA 3R5HA 1FWYA 1B6SA 2YW2A 2V0IA 3R2WA 2VR1A 1HM8A 4MV6A 2OI7A 4J18A 1AUXA 3N6RA 5I47A 3DHOA 1XATA 3VBJA 3ETHA 3RV3A 3R8YA 1G95A 2CZGA 3GOSA 3R23A 4ZQIA 4C5CA 4C5BA 4KPXA 1GLVA
chains in the Genus database with same CATH superfamily
2Q1TA 1ZN9A 4LJSA 4AO7A 1TZBA 4INOA 4P53A 2SCUA 3WGUA 4DBLE 3IT3A 2FSVC 3ENVA 1UP6A 1Z2CA 3K0AB 2C97A 2GARA 1DHRA 4ES6A 2W11A 5A0TA 1Q7BA 3GPCA 3WQQA 1JG1A 4IVNA 4RCVA 3FW1A 1J7KA 1W48A 3QK7A 4B33A 4Z8YA 5KYTA 3SC6A 1QAMA 3BJZA 4WT7A 1JR4A 2NT4A 2ZSEA 4CEIA 1SIBE 3H42B 3NIGB 2A5FA 4JBXA 2O2IA 5B1DA 1PZGA 5KSOA 1VBMA 5GIOE 1XZIA 5D00A 5EMHA 3TKYA 2ZI7A 5SY9A 2CF5A 1B15A 1SIWA 3P9QA 3RS7A 3KVVA 3IAAA 4YV2A 5AKEA 1JG3A 1EFHA 4OIMA 5ADXV 3I6ZA 4YP5A 3EZYA 4AICA 1TQ2A 4PLFA 3T5TA 1LK5A 4C7MA 3QXXA 5A0VA 3RASA 1D9ZA 2IXAA 4HGPA 4JROA 4G5XA 4JU8A 3KQTA 5DLPA 4N47A 2VHZA 2G09A 3F46A 2ZXEA 4KWCA 4M1SA 2ZJYA 1TMKA 4O4LA 1C8LA 1YS9A 1CQJA 2DR2A 1BHSA 5B5SA 4KDRA 2QAJA 5JS2A 4Q1FA 5C8YA 3RJTA 3OP1A 2J33A 2C2XA 3F8TA 4B85A 1OROA 4YAWA 3W9BA 4A8JA 5M29A 3AF5A 4DV1B 4L72A 4BN0A 5JCXA 1LD3A 1EHIA 4QO7A 3V48A 5AUNB 5JSFA 2Q0QA 4Q00A 3HB1A 3LBNA 4JZYA 3BWVA 2JW5A 3EGOA 4BRSA 4U7FA 2Q3LA 1N8TA 3FPSA 2P69A 5IAKA 5K20A 5AM0A 1MW8X 1O9HA 3CZQA 4BB9A 3HBNA 3R3IA 5JTUA 3FHTA 3FDZA 3A7EA 1YA6A 1RVDA 1W2GA 2Q21A 2ZBFA 1CCWA 2WV9A 4TTIA 1A04A 2RGUA 1TVEA 4M0CA 3NATA 4PZDA 4TLEA 3BZBA 3JYPA 1L6IA 1FBTA 1XTTA 4MGHA 4ZJPA 4AJ2A 1S9HA 1MNAA 1EJ2A 1VSQA 1DVRA 2H18A 3AR6A 4FYMA 4RLSA 3N9IA 4DB4A 2WWFA 1X7ZB 4CV3A 5KZMB 2WY2D 2HJGA 2VCEA 1GQ2A 2C5GA 2DBZA 2RB4A 1J70A 2AC2A 4MVJH 1F5SA 2HUNA 4AQYB 5HTKA 1K4KA 4KRGA 3L18A 1KE2A 3VR5D 1IXYA 4INZA 4KR3A 5JYBA 3OU6A 4C4ZA 1UR5A 1WXFA 1YAJA 3IMEA 4JMLA 3STVA 4HVCA 4MQ6A 2NUBA 5J23A 4JV5B 3UXMA 1EXMA 1IB0A 2OZEA 2X5KO 3H2HA 3FUTA 4N6BA 1GZVA 2KMLA 2QVXX 1YS4A 2FFRA 1KRHA 2EAUA 1HSOA 1VA5A 1JHXA 2B83A 1PNOA 4RHCA 3N5KA 4PLGA 1EVKA 1D6JA 3K9BA 3PKIA 4NONA 3OLCX 4TN5A 5E95A 4BO9A 4BBAA 4XM0A 4C7XA 1O96B 4RJLA 4TTAA 3ZYCA 2ZPAA 5FKJA 1GPWB 2BEVA 4QU5A 5F1YA 1WB6A 3A1UA 5FI5A 3RO7A 2AFIA 2FQXA 1JZQA 2IHZA 3O74A 4EEZA 4JBWA 3E5NA 1PLJA 3CW2A 5EJFA 5J5CA 3N87A 1RWXA 1E3MA 4BNFA 4D8TA 3V8MA 2FMXA 1KJYA 1WCXA 2X0RA 1GT6A 3GELA 4FIDA 4DCVA 3B9RA 3V1MA 2H1OA 4YJFA 1WLSA 1M34B 4Q9HA 3KPVA 5FTWA 1ZGBA 2NPIA 5JZBA 2Y66A 3KB6A 3GLQA 4HUJA 2XCIA 4RQUA 4WVFA 5GOTA 3VZRA 3NU1A 1EFDN 4OREX 2JDIA 2PGIA 4F8JA 3I83A 3L8EA 3AB8A 2O1XA 4YQZA 4XEHA 4B6RA 1D1SA 1KYZA 4EFKA 1PTJC 1JVBA 1T4BA 1UBMS 3SKVA 3O5AA 1ONBA 4I3HA 5EIEA 4MP6A 5F4ZA 2QRKA 4A8TA 2AXEA 5A4DA 1YJQA 4QGHA 3Q2KA 2H6EA 5I8ZA 1JBKA 4KFRA 3UAVA 4M4SA 2TRSB 2DT5A 4MIEA 1FMTA 1TCUA 2APJA 2O2HA 4MI3A 2CGEA 4ZEOA 5IM5A 2ZREA 3T6KA 4BOYA 1ETUA 5BN4B 3EDOA 1NMEA 3V1NA 1QWSA 2QX8A 3W6NA 3ZY2A 3OOEA 5JMTA 3A1FA 5HKBA 3ZTYA 1KK6A 1DIHA 1P4JA 3BWEA 3DBRB 1YB7A 3LWDA 4PXYA 3KD2A 1GTVA 2ECKA 2Z2JA 4KXYA 3UK6A 1LJ8A 1TYDE 4X00A 3W8RA 4B3MB 4FI3F 3R5DA 3KZVA 2RHDA 2XEDA 4NJMA 2PPLA 3WLEA 3VBKA 1ZOLA 1RZVA 1YO6A 4MUGA 2H7XA 2XGOA 2CNBA 4EKNB 3T7IA 2FK7A 3D43A 1PQUA 4LY0A 3GGJA 4QTUB 1HDEA 1E58A 3LVQE 3VH3A 4TX1A 3E7XA 3AV3A 2AR7A 5K3OA 4UCWA 3KVYA 1L5MA 1HNWB 1E2BA 2QU7A 1P9RA 3KZ1E 4MW1A 3U49A 1PFVA 5A4MS 3ZVNA 3USZA 4FGLA 3WSWA 1NZFA 1SUFA 2GBCA 1G41A 1ZUWA 2HV8A 2FMFA 3IT2A 3NX4A 3R20A 3RRXA 5L3QA 4U9HS 5AXAA 1A95A 2AF4C 3HLKA 3RC8A 4HEHA 1TVMA 1U7OA 2FR8C 2FDRA 2H1IA 3MTQA 1SHLA 1Z6YA 4NBNA 1GCGA 5EYPA 3D4BA 3V2HA 1P7ZA 3N8DA 2WJPA 4GRAA 4Y1FA 4EGCB 1ZQ9A 3KWFA 2PH3A 4Z0NA 2ADOA 4DEVA 4D4IA 4KVGA 4E5SA 4N69A 1HC7A 5H9VA 1D5CA 1XTVA 4H3HB 3C8MA 1ZU5A 1MU0A 1H9AA 2RBGA 1MMFB 3CFYA 2Z8ZA 3QEOA 4MPJA 3GRUA 5JDIA 1XP8A 3PTAA 1KJJA 3JQ7A 5LXTA 4CIVA 1MAHA 1W4CA 1N6OA 1T2NA 3CJQA 3L49A 3VO1A 3TGLA 6REQB 1D6SA 1UP4A 1L5YA 3LA6A 3TLMA 5JHHB 3OE5A 4EW3A 2B0CA 3GN1A 4IOKA 4TWIA 4B4DA 2OXRA 2AMLA 1LBEA 1AUOA 5HOEA 2I3ZA 2BYTA 2D2IA 1K4MA 1B00A 4Q3EA 3B85A 5DW3A 3FVWA 3DV9A 3E5HA 4HP8A 3ZXUB 1O4WA 1T2CA 1E0DA 2FRVA 1I4OA 2WJWA 2CDBA 1E6CA 1SUSA 3ND8A 4PAQA 4N41A 4LSMA 3DE1X 3UVEA 2H2IA 2GM4A 5HCUA 1A72A 2E82A 2A2ZA 4CLOB 1TA9A 3O8NA 4O1HA 3BK7A 4WACA 3NUQA 1NP3A 5FBKA 4J09A 2G63A 3ANNA 2C4HA 5BSHA 4NNPA 4EP1A 5L6LB 3OCJA 2Z8YM 3TEMA 3AFHA 2RH8A 3T3EA 3ZHBA 3DVQX 4Z1MD 2G1JA 2RKOA 3UMBA 3ZK7A 1OREA 4HPWA 4RSMA 4YP0A 2QGFA 1Q7TA 2AI2A 2EWWA 1R0KA 4NZZA 1T4CB 1YI8A 1W6RA 3F5FA 5DZSA 5DG3A 2O1SA 3EPPA 1SVOA 3OICA 4RLHA 3S8MA 2X2PA 1GILA 4IYJA 3KLNA 4MVJG 1BMQA 2CWDA 3L5KA 4DA4A 1V1RA 1RI2A 2JGAA 4JLSA 2V6BA 4X20A 4DV0B 2PBZA 2IU6A 2W2KB 1AKWA 1B8OA 4GYWA 4NSNA 4NU5A 4OJYA 1NJ1A 1PO7A 2AE2A 4J4BA 4HVLA 1P2BA 4NPHA 6Q21A 4ZAWA 4B2YA 4MWBA 3RVJA 2DQSA 4CM4B 1A69A 2X19A 1ECBA 3ND6A 3IOYA 1ISGA 2CLKB 2W42A 3PGJA 1ISPA 3INNA 4XJXA 3SD7A 4OATA 4DYVA 2WWYA 1E1YA 1Y1RA 1Q0UA 2IS2A 5DTRA 2C5HA 2HSWA 4LZJA 3BORA 1U8XX 2Z2KA 3NYWA 4HAVA 3PC6A 4NH0A 4WPGA 5KAPA 3PR3A 4ZAZA 3V7FA 4C4YA 4CWAA 3HN6A 3JZMA 3EDYA 4RKYA 4Y9RA 1JSRA 3KUDA 4KV9A 2P78A 1JLMA 4LJ4A 1BFKA 5GWXA 3KSAC 2JKYA 2ANBA 2P9GA 2B21A 3NPMA 3WQHA 4TKZA 1VTKA 3VNQA 1QQ6A 1GZUA 4UM9B 3L07A 5F5LA 1EWKA 4YRFA 1JDPA 1G17A 2NZYA 1HUQA 3S2UA 4R3UC 2XRMA 1NTRA 2F59A 4E30A 4C4PA 3CCBA 4Q6WA 1R12A 2ZRPA 2RFLA 3OT5A 4OPMA 3FDFA 1V5FA 5FEMA 1CZKA 1PK8A 1YKGA 2K7ZA 3HDYA 1QIGA 3IVAA 4N7BA 4QXAA 5D85A 5E2BA 4A8PA 2X3FA 4UZFA 5JEDA 1GNRA 1CRQA 4QNRA 4F2PA 4ZCSA 1B76A 3E9YA 1Z6AA 1GL9B 4RKEA 1PD0A 5AMXA 1S9DA 4ZO6A 2HMYB 4KUGA 4I55A 1S2GA 2PX3A 1W9HA 4IHJB 4K5QA 4BV2A 3H2JA 1Z2OX 3NB0A 4KCGA 4NCAA 2R7KA 5T8KC 3IFSA 4ZO9A 1PQPA 1KYWA 5JZ9A 3I32A 2GPJA 5DMHA 2OQVA 3OD1A 1GRQA 4C2BA 5BN1A 3TZEA 3DZJA 1L8AA 3DMNA 1MDFA 2I55A 2VUIB 4FD3A 4D44A 4Y7DA 1YUBA 3J7AC 1G3RA 1ZGHA 2QUIA 1Q95A 4N6OA 4FK8A 1DAFA 1RMQA 1NRJB 4HNSA 4O29A 4KOEC 2GZSA 2CL6X 2JIZD 3NT2A 1SOVA 2E87A 1O94D 1NN0A 2HUPA 3MXTA 4ZT3A 3QBVA 4TKUA 2WFZA 4KXFB 5ITSA 5JZVA 2HA7A 2D1SA 3UW3A 2QT1A 3FCXA 3QVLA 1QIFA 5K3FA 10MHA 5KU1A 1T36B 1Z4IA 2YRXA 2NUAA 3G89A 3NR2A 4BDTA 4ZJYA 5A5VA 5F51A 3ZBUA 4HRAA 5B3KA 1QGAA 2DFDA 3N2GA 2YYAA 3D6TB 3B5EA 3CLHA 2CMFA 2KI5A 3F49S 3F90A 3DLAA 4QNMA 5CGZA 3SHVA 3KQVA 1IQUA 3WDLA 1MOPA 3WOHA 1CNMA 5A7FA 4TXMA 3PHBE 5AVJA 1RHRA 5ARCA 3FCOA 4R01A 4REQA 3LLUA 2AW3A 4C1NA 3JD2A 4Z4QA 4XRGA 1GZ3A 2B1GA 2WWGA 5DLYA 3CNHA 1ZKMA 2QTZA 2R00C 4DLWA 1THMA 2ANCA 1UWCA 3DDNA 4Q05A 1AB5A 1JEAA 4JQYA 4D6XA 4TKLA 2BL4A 3C6XA 2KSQA 3L1KA 2N47A 2E4YA 2ZYUX 4GL4A 5LA6A 5C8YF 4X94A 2WHYA 3M3DA 1JA0A 1TW2A 3K96A 4MB0A 1AN9A 2AOVA 3O8OB 3DQPA 4I1SA 4WFQA 2PWPA 4DWWA 3KALA 3VH4A 1SZPA 1VKOA 2JAHA 2WTEA 2WA2A 2VQSA 4RTNA 1NBMD 3UW1A 2WIJA 2ZS9A 4IG4A 3EGDB 4OHZA 4ARBA 4CCYA 4EB6B 1KQFA 2G7MC 2PXHA 3FB4A 3HVHA 3M89A 5D84A 2B2XA 2ZIWB 1EXNA 3PRYA 1D0VA 4MHSA 4BP1A 1J0DA 1V3TA 4RH3A 3PFKA 3UK7A 1J0BA 4D8WA 4P84A 2ZSFA 3ZW8A 2NZWA 2WWHA 3H1BA 4X24A 1CDEA 3VA7A 1MO5A 4TMZA 2JFFA 2XQJA 1J20A 4BJ5A 3B6MA 3OEYA 1TLFA 2BW0A 3DTVA 2OQ2A 2A9VA 3L0ZA 1ORDA 4QBKA 4S1OA 4ID3A 2FWAA 1KK0A 5DWQA 3ENNA 3T54A 4BAUA 1SUCA 1TA4A 3IMCA 1K6MA 1QRLA 1NAIA 2VAVA 3QMVA 4WKNA 4U6SA 5G1OA 4AXBA 3HY3A 4JFAA 2L2QA 4DSTA 2WHEA 4RA6A 3HQ4O 3UJAA 3BRCA 3E7DA 3QF4B 3H3JA 3S0JA 4C7BA 1K0FA 2NQTA 4NAHA 4QKQA 2AZTA 1T9DA 4EJ6A 3B7GA 3L0YA 3LWZA 3PGXA 4RPGA 2CLHB 1GGJA 1RKBA 2GRJA 3PVCA 3ZIAD 3JASA 1GA1A 1OXXK 1U7TA 1UK8A 2DUJA 2H57A 1OVMA 4GEGA 4L74A 1E2HA 1KS9A 2QW1A 4FOOA 1G42A 4HB4A 1EK0A 2O0MA 2Q8QA 4NEHB 4HTAA 5CYPA 4HXEB 4ZYXA 1Q16A 3E4CA 1A77A 1SXPA 1NZDA 1T5OA 1PG0A 3RU3A 2XT0A 1HXHA 3L0OA 3WMRA 4R5HA 5F78A 1KAHA 1UM9B 2OC4A 4Z1OA 3NAZA 3PXBA 4YAKA 1GPNA 1TKBA 5KOYA 1GCOA 2QAGA 3L8FA 2PH1A 3B6JA 3DSRA 4YRRA 4X97A 4LCBA 1KERA 2Y9MB 2XUAA 3OZVA 5AI8A 2XWSA 3O0DA 1QRTA 1E8NA 2A92A 4D9GA 4RTLA 2FX5A 4HUQB 3FXAA 1ARZA 1QHXA 3SEZA 3QQ5A 2HQSA 4N6GA 2F6RA 5B37A 3K4QA 1IHOA 4MAAA 1DADA 4LDQA 1AMUA 4PLTA 3K0AA 4LXXA 1WD5A 2IDZA 1F8UA 3GDOA 1G95A 3HDGA 2BBWA 1XJQA 4EX7A 3UH0A 3GXOA 4C5BA 1SBHA 3WWCA 2EKZA 2ZB8A 3C1UA 4EI9A 4O6VA 4KLAA 2BISA 4ZRMA 4NMWA 1SD5A 1SOMA 1G8AA 5M04A 5HFJA 4HYYA 3SR3A 3FIJA 3SE0A 2ZU6A 2HIAA 5KOIA 5KNBD 4BY9E 1NBHA 2D2EA 2EQAA 3SZGA 2P8JA 4RABA 4JYZA 5TQ0A 4ATNA 3EQ9A 2Z0MA 3QM1A 4FWTA 1FFXB 2E5FA 4TLBA 2I6SA 3R5JA 1U7ZA 1J0CA 4DM3A 2UVDA 1C4XA 4DKJA 2GWRA 4RUKA 3R44A 2WF8A 2O4UX 3IAXA 3KYDB 4RY0A 5K0LA 4CR6A 3SHQA 1YR9A 2GAIA 2XITA 3H6KA 1FYFA 3JD3A 3TQQA 3ORQA 1LF0A 3OZ7A 5GADl 3G1WA 4M9SA 5I48A 1OC4A 4KMMA 4J94A 3ZEIA 2H17A 1E2FA 3OKCA 1DV1A 5FUBA 3OZTA 5BWCA 4D3YA 5E3QA 1XDUA 2ZT6A 2CFOA 1S3GA 2WW8A 2VTDA 1JLHA 4V0RA 3LKBA 5F5XA 1WMFA 1KR2A 3ESAA 1E4VA 4PCAA 1YI0A 3BX1A 2FZLA 5DLDA 3WTBA 5C32A 5MGBA 1E9VA 1W73A 2NV2B 1P2GA 2OLKA 1F7VA 3H3FA 1D4OA 1XNGA 4AIIA 2WKSA 1BE0A 4EG6A 2V58A 2ZP1A 2UYGA 5D3KA 3R6DA 1G1AA 4G5RA 1DUIA 3M6MD 4MVJI 4Y2RA 4BQQA 4RL6A 3PEVA 1QRRA 3AERB 4ER7A 4TRJA 1WIWA 5AHXA 4FLMA 1ZISA 1YDEA 2AJTA 3B3JA 3A6DA 3KEOA 4LE2A 1X8LA 3OQJA 5ADXU 4MP3A 1HQYE 2JFVA 4EARA 1F51E 2WPNA 5JCOC 2X8JB 3MGKA 3AM1A 1AV7A 2GRAA 2PVCA 4MWEA 4C0QC 1ICIA 1NQ5A 2HXGA 1ATIA 3T57A 3NAQA 1BZYA 2JCVA 4FONA 4J75A 4DBVO 4NESA 5CBKA 4V1CB 5MDHA 3L05A 4KQEA 3NBAA 3CBGA 5FA8A 5IBPA 1T43A 3PP8A 2OP0A 4CL3A 5JBQA 4KQ6A 4G5OA 4MV0A 1L4HA 3A6GA 4ISBA 4RK5A 4CKWB 4FXPA 3OM1A 1KH2A 2NU6B 1Q1QA 2N42A 3OSUA 2GPSA 3Q15C 4MVJM 4RPHA 3L1HA 3TNYA 2BMWA 1IG0A 3IKJA 2JLRA 4Q3DA 4XVUA 2UV8A 2QP3A 1U8YA 2CB0A 4C7KA 1O96A 1MRLA 2OI6A 2W00A 421PA 2XQKA 5JWRA 4C01A 4NE2A 2GO1A 3C1OA 1DQPA 4Q7MB 1OTXA 5KQRA 3KYJB 2WHPB 3D3WB 5CDSA 2ILVA 1SOUA 4Y1GA 1GCUA 1Z74A 3RW9A 3R5TA 4JR2A 1P6XA 1X1DA 1T6ZA 1WXGA 2IGBA 3AYZB 3CGWA 2DR0A 5U2KA 1KVQA 1NF9A 2FGKA 2Q62A 4G2NA 3LFHA 4JJZA 5EJ9A 2HMWA 3Q8KA 3CKKA 1OV6A 5JFOA 2UZAA 1KYQA 1G21E 3JQ9C 2J87A 2IPLA 4CM1A 4P7BA 3GHHA 1N2JA 1NONA 3LW7A 3RIHA 3E48A 3TR6A 4YNBA 3G9XA 3OHPA 4OY3A 5GVRA 1D2HA 1IOWA 3O21A 1O5OA 3AHEA 3RFVA 1RTKA 3Q8XB 3K2IA 1ZMBA 1GL7A 3M6AA 4D9KA 4JVNA 3AILA 2ZWMA 2GBLC 3C5VA 3FPFA 4NABA 2OPHA 4EJ2A 1BE1A 1WSBA 4P81A 1NXSA 3QG1A 1XZKA 2AN3A 1DWQA 1IVYA 1LBQA 3L1IA 1LI4A 1PCXA 3EFEA 3QPCA 4IDCA 2YJ3A 4KLRA 4TTSA 2H8KA 2FPSA 2I9KA 1HE4A 1MPTA 3C6BA 4G84A 4JXJA 4WE3A 3FZNA 4EPWA 4I9NA 2DB3A 2V6FA 2CLFB 3ZCPA 1TU3A 3KL4A 1JTFA 1A5SB 4B73A 2J3DA 3GBVA 2IYTA 2HF8A 5JU6A 1RYDA 4G4SO 1L0BA 4FX5A 1O95D 2IF2A 4IDFA 3VPXA 4B17A 2O07A 5LZ8A 1RBZA 3FJYA 5JMPA 1TKCA 4G9GA 5B3JC 1BMTA 4IMRA 4J0GA 4JVMA 4DCSA 4YT4A 4IAOA 1CC1S 5BQPA 5ICGA 4Z9FA 2FKNA 1DG3A 1WWKA 3NOOA 1PZXA 5IJ0B 3W4IA 2F43A 3I01A 2CLIB 5AFSA 2AFHB 3G2JA 4QGGA 3VYTB 5K0ZA 1L7QA 3LPDA 4Z0PA 5ECGC 4MYDA 3RUIA 2G9VA 2JH8A 5TLSA 1SB8A 1U63A 2V7VA 1DBRA 3I05A 4ENPA 2NO6A 1PYGA 3TUIC 1CLUA 1JS1X 1QG2A 1KQNA 3ROXA 3R5CA 3FHLA 1JG6A 1R5OA 1P39A 3WVNA 1IEVA 4N7RA 1WXDA 1QP8A 3IOCA 1C50A 4IH1A 1X42A 4PTZA 4TOIA 4PSCA 5EHIA 4HDRB 1OD6A 3T7TA 1OOEA 3VHLB 1KIAA 3MOSA 1MBZA 1DRUA 4K81B 4RIFA 1AKRA 5DHTA 3ZNQA 4EIWA 2XZLA 5DGHA 4CM6A 3IQGX 3VOBA 5EY5B 4DIEA 4Z7OB 1FS6A 4LX8A 2Q5EA 4N39A 4D9HA 6REQA 3DF9A 3CZ4A 1C8KA 2X1HA 1EAYA 1R0ZA 5DLEA 4E13A 1V37A 5JI2E 2RONA 4IQ8A 4DTCA 3UMCA 1GFIA 3QY0A 1XQ6A 3SJZA 3H4MA 4HFMA 3AOEA 3DZFA 4AS1A 1NP6A 2BMJA 4PGGA 4EY7A 2G08A 4AAWA 2H4XA 2JH3A 4RF4A 2WPDA 3KAPA 3PUZA 4QGFA 5LJLA 4E5NA 1YZ3A 3GAZA 4CLOA 4DPMA 3BE5A 2ZANA 5FWXA 3C6QA 2ERXA 4KVFA 3CEJA 3IYLW 4LXHA 4DA8A 2OZVA 2XNCA 3T3IA 4IKOA 3ZHUA 2F48A 2CLCX 2GCPA 2E6UX 3TNDA 3OPYB 4KSCA 4CMCA 1JVNA 2QM7A 2RI0A 2DQYA 2YVKA 2VHJA 3A7DA 1RM0A 3GW8A 4HCJA 1Q0HA 3DE7X 3P9PA 5KTMA 4IIJB 4B7AA 4CG3A 4IKPA 5CTAA 1U0HC 2IPNA 3BAFA 3UV6A 1D1QA 1Z5PA 4IIUA 4PHFA 2H08A 2W2KA 2NAFA 3E9EA 4G8CA 4V0MA 5EQFA 2WE8A 3W04A 1QPGA 1JU3A 3GEMA 4F3TA 4RORA 2ONKA 2V4ZA 4KYVA 4PQFA 5AHWA 2XXJA 5F1PA 5CAEA 1LI7A 1Q1BA 3C8ZA 3IQWA 4CMHA 3BRKX 4CM4A 2H2HA 4IMIB 4BGIA 3PG5A 1A3CA 3DAOA 4N3AA 4B8YA 4ZVPA 5CFQA 4XYGA 3TISA 5TGZA 3GP5A 2GM3A 3BCUA 1H23A 3BIWA 4TUYF 2ASEA 4RTKA 1SKMA 1DEOA 3ANMA 4HDSA 2NNWB 1RRMA 1REQB 1LW7A 1PL7A 2Z4TA 3CQ9A 2RK3A 4DWJA 5I7HA 4G5YA 1N5JA 3F97A 4HS4A 3K1YA 3OQ1A 2VRBA 1W0JA 4WZ6A 2OEPA 5BSWA 4TTPA 3GUUA 4HBGA 2XA9A 3EDCA 3TCXB 5J4KA 2P2OA 4YYEA 1F2VA 4HAOA 3GGPA 4RTRA 2CHEA 1DQNA 1ZBQA 3H5IA 3GPBA 3QMPA 4IXWA 4D9NA 1H6CA 4TN1A 1PNRA 3OIWA 4HAIA 3UHFA 2PKQO 5KWIA 5KWSA 3JQAD 3D6VA 4G1FA 4ID9A 1J97A 4EI7A 4MVJD 3K0HA 3T94A 4LCEA 1OLSB 3I1IA 5C1BA 2CZQA 1LDBA 1CUZA 3BSFA 1VMDA 3QZUA 5GP1A 1ZI8A 4OHFA 3ZGNA 2PLFA 3GJXC 2IBTA 1FLAA 4IBOA 3RAEC 2VPTA 5CT9A 1R74A 1W6UA 2BTOA 4CLDA 4MK4A 3WQBA 2CFSA 1Z4OA 3VQTA 2WIKA 4MYSA 1OGYA 3HP7A 1DI0A 2GGOA 3AJAA 4WTOA 4F1WA 1IFXA 2P9BA 4CG1A 1KEWA 2MSKA 4KW7A 4Z2AA 2VF8A 3X1MA 1OGIA 4IHJA 2IW1A 4WFKA 3K70D 2YWRA 4ZQGA 2NX2A 1H2FA 3IPCA 1ZJ5A 1V0JA 4H6WA 4LC0A 2VP2A 3WHIA 1OGJA 3U4DA 3WYFA 3PC3A 4HN9A 3RSZA 2OFWA 4QQFA 1QHGA 5BO5A 3HXQA 5BSFA 1H6BA 3DPIA 2J0SA 3GJ4A 3I9OA 3UAOA 2BELA 2QTLA 3ODGA 5CDFE 2F3PA 4MS3B 4K9OA 4K86A 5E2AA 2ODQA 4TWAA 2C2MA 2GD6A 4M83A 1Y98A 4TYQA 1X87A 1NPDA 3S99A 4UVDA 3HJGA 4DJ5X 2FW0A 3IE0A 1SEVA 4C9BA 4EPYA 4JLOA 4H7PA 4JI4B 1WBBA 3BD8A 3P9YA 4JR1A 3V8NA 3F7OA 3ITDA 4DIBA 1T36A 3CTMA 1QZXA 3DC2A 2PFSA 2LUOA 4RKFA 3DZ8A 1ADBA 1S02A 1GQOA 2W6PA 1VOTA 2YV1A 4KQGA 1HORA 4Q3CA 4HWTA 4Z2YA 1UFKA 1R0LA 1R8SA 3IEPA 3L46A 4N3BA 4UNIA 4XQCA 2BTEA 3EUWA 5DEOA 3VPGA 2EW8A 1DEXA 4YAIA 2ZYHA 1UKAA 2PWZA 4FMDB 1B74A 2W6QA 1IHYA 3E3AA 1Y34E 4XDGA 1KQGA 3T9AA 2AWOA 5KINB 3GYBA 1RRPA 2BKAA 4OGGA 2OD2A 2XY4A 1E2IA 1KZ7B 1II8B 4NNJA 4Q9IA 4XUEA 4W5HA 3JXEA 4RIHA 5EZSA 3TE7A 1KOFA 1YDWA 3LP8A 3OJFA 3UPDA 4DJFC 1G2OA 2F3SA 2VWGA 4PR3A 2OCXA 3R3HA 2ZAGA 3TLYA 4XDYA 2XKKA 3ROTA 1JR2A 2QEQA 4ABTA 2FB9A 3O8OA 3O1JC 5CCXA 3AP2A 3QLVA 1RWWA 4ZQBA 3V4VB 4DABA 4D80A 2J7KA 3ISJA 4GX0A 1JHOA 4XDHA 4Y6QA 3WB9A 3BXEA 4BMXA 4HT3B 3PNYA 2Z57A 4J3FA 4RPJA 5CPFA 4CKBA 1X8JA 3EGDA 4EB6A 4HZDA 4HUSA 4QFMA 1RYNA 2ONCA 2DT8A 2QOEA 3EPKA 5C1IA 4A8JC 1VB3A 2WAYA 4NFYA 3TRDA 4AG6A 4ZIRB 2IYQA 1GFWA 2YW9A 1J06A 1QLHA 2A0XA 1IY9A 3PGKA 3C5HA 4CQNA 3GGGA 4CG0A 3DVSX 1W581 3Q11A 5GGYA 5TC4A 2WLCA 2B98A 3C6KA 3HYTA 4IHFA 3MAAC 4HH1A 4L4UA 5JSKA 4B09A 1G98A 1P7CA 1EAMA 3C3WA 5A0FA 3R6GA 4JBNA 1SKBA 4FPXA 5IMSA 1KTIA 1RRCA 1A9SA 5BQFA 2FQWA 3HZRA 3TW8B 5IXJA 1IPFA 2D59A 3STHA 3T1QA 4EO4A 1QGOA 4AY2A 4PZCA 5IFLA 1THGA 1YOVB 2OQIA 4PIVA 1USWA 4DDVA 4AG3A 3R8XA 3P47A 1JE1A 3PB3A 3LKZA 2GLXA 3KVNA 4WD3A 5IN4A 2J3QA 3DMHA 1L7AA 3FFWA 3I1FA 3MXOA 1ML3A 4LHYA 4M8NE 4PZEA 1HM5A 4U7GA 3SOPA 3IHTA 4PQEA 1CTQA 4DDHA 3PE6A 1P74A 4QD3A 3K0KA 2R1TB 4XOUA 4ZFNA 1RWVA 3W3AA 5HHTA 4GAEA 1PTKA 1WZIA 4R16A 3MGGA 3U7JA 3LHFA 2N9UA 4G36A 4DHWA 4LSWA 2B1JA 1JYFA 3H18A 4Q39A 3I2KA 2PYZA 3ROFA 4ZOQI 1UM9A 4QTYA 1EZ1A 1LNZA 1BKYA 2EGUA 5G1PA 3VAZA 3WX0A 3L8YA 5F7ZA 3A6HA 2I76A 1E6KA 1J1ZA 2Q9BA 1ZAKA 2ZROA 2PT6A 1XR3A 2GZRA 5IT9A 3HP4A 5IC5A 3G9ZA 3V4PB 5B55A 3OU7A 2I66A 5EVCA 1F20A 2YMLA 3AV0B 4IGFA 4OU5A 2XUZA 4ER5A 3HCFA 5I01A 4UULA 4HUQA 2EG5A 5KVCA 5ABPA 4FKMA 1JSLA 1OC2A 3GRFA 3U37A 1DWUA 4BZWA 1PN3A 2VZ9A 1OT5A 1C14A 3DTTA 2WKPA 2Q49A 1JIQA 1SU7A 3PD7A 4R1TA 2JB9A 2POCA 3LUFA 5T3UA 4AQDA 1TU0A 2I4NA 2UXBB 2GK4A 1ZH8A 4B7XA 4BMYA 3ETGA 3LQYA 2DPLA 2HCJB 3Q41A 2B82A 1EWQA 4S1WA 4RHXA 2DYKA 4BBZA 3UYLA 3GG2A 3UOWA 2HIHA 1YGYA 3RV3A 3ND5A 4KE6A 3BJMA 3MWJA 3OTWA 5I9TA 1FFXA 3FHJA 1CJMA 4MGIR 1YULA 3CMMA 1SA0B 1RHMA 1EZZA 1U3UA 1XLVA 3NHBA 3NM5A 3OT1B 2GD0A 4GECA 5C4GB 3SR4A 3ZE8A 5CFNA 4HR7A 3KYDA 1QE3A 3TRIA 1NYTA 5C8DA 1Y8AA 3FKJA 3CE6A 3R40A 3V8PA 1XF9A 1IE3A 3OTHA 1GGVA 2PSHA 4D79A 2CUNA 3BL8A 3A10A 3EQ8A 1M6HA 1FTNA 1P6UA 1JDBC 1TKAA 2WIBA 3IP5A 4JC4A 4OXKA 5CVVA 3T9BA 3GFOA 1MFZA 3W4KA 3T41A 2RGRA 2AR0A 4R54A 3LY5A 3BF7A 4HGOA 4ISXA 3N3AC 1RVV1 4I4TB 2L19A 4JLDA 1JWAB 4KYUA 2NOAA 5LQNA 1J2RA 3KCQA 3M33A 1QU2A 5H3LA 1Q0ZA 3TMAA 1YFLA 1CEEA 4DDTA 1N6IA 1K6IA 4R7PA 3HVKA 4AJHA 3U44B 2ZBEA 3CLRD 3QBTA 4M9QA 1V47A 4AJEA 2PT7A 2XUOA 1YHNA 2P9JA 2VUSA 3IOBA 4KX3A 3G68A 4MA5A 5CT8A 5IHXA 3GLGE 3EEVA 3V8VA 3BWMA 5EXXA 1O03A 1LC0A 2BDUA 3FSCA 1DJLA 5K4HA 5KSZA 3W5UA 3H2GA 4WSOA 1UQRA 4MTLA 1DC8A 1R88A 5H3CA 4BIIA 3FTNA 4QUEA 8OHMA 4YRMA 4UQLA 3T5GA 5BP7A 2RDMA 1OCXA 3AERA 2RAUA 3CH7A 2R47A 4EA7A 1ML4A 4O4IB 5E1MA 2M1XA 4YS6A 5EUCA 4YRZA 1VJDA 2VTBB 2IBMA 3WLLA 3B9QA 4NLLA 3T7DA 2X8JA 3CZPA 4DQVA 5FPSA 1Q83A 2NXNA 3ON5A 1L4MA 4YDRA 3WIOA 1WULS 4V1CA 3GNQA 3FA2A 3H5LA 1QJCA 2YN0A 2QYTA 3L0DA 4J2OA 4UTXA 1XZAA 4ZO4A 1MXHA 5JDIC 3HCNA 1IMJA 1KPIA 1VCIA 2AN4A 3TR5A 3ZVRA 3QIVA 3Q0EA 4L9SA 3F0TA 2NU6A 1FSZA 4AKIA 2JIRA 3LUAA 2X6TA 3LQ1A 4TTQA 5HKKA 1PT7A 1D1TA 3GJYA 1UMDB 1SVKA 5DBGA 1W30A 5SZHB 4JLAA 3N59A 2WYWA 1V25A 4MS4B 5AW5A 2IYUA 4TXNA 1KEZA 3G7SA 1H85A 3D8UA 2VN8A 2Q3DA 1MIHA 3II6X 4NZ9A 2HL6A 2OY0A 3BFJA 3O2SB 2G5PA 4MQEB 5I7AA 5IHPA 5BWBA 4ZARA 1E77A 4WFJA 5EMJA 3CW8X 2HXSA 4EG0A 5JNLA 1FP1D 3IJRA 1KJIA 2ZSKA 1E7YA 1SCNE 2R5FA 2YL2A 3OIGA 3ZBTA 5LLSA 4EJMA 2CNLA 5L3VA 2DJ5A 1X7HA 2QLLA 3H2IA 2WTAA 5FPYA 4CTKA 2IA5A 1ADGA 4EYKA 5FOQA 1YJBA 4HMQA 1UT5A 1GTRA 3L84A 3VU9A 2IZZA 4QDZA 4E03A 4UXIA 2C7QA 1UKCA 5E3IA 4YWJA 2ZBPA 1QRSA 1A96A 2QTFA 1AVTA 4HGRA 5TPZD 2F1IA 2WLGA 2OK8A 4W9MC 3GGSA 2AJDA 3CRMA 4KHZA 3JV7A 2ZYTX 2G04A 4TWBA 4GVLA 1YS2X 5KC8A 2ATVA 1ODIA 3MRSA 2JF3A 4FJ2A 2VAPA 5HJ7A 5LL6P 1D2CA 2BKEA 3FWYA 2ZR8A 1P72A 4XM1A 5JISA 3MA0A 2IIQA 1LDGA 1UZLA 2QM3A 1CLEA 2QLBA 2XTJA 2ZR9A 3LOUA 2J46A 3Q7SA 5ED0A 5KJ1A 1C3XA 1J8DA 3B6ZA 1KRRA 2HCFA 2QF7A 3KKZA 3KLMX 4HZGA 3SHOA 3UOGA 4EI8A 1JDTA 3D6AA 1PGPA 5IH3A 3C24A 3OMLA 4EG4A 5TEVA 4XARA 2GYWA 3VR6A 4F4JA 2B0JA 1R4AA 5K8TA 1AS3A 4X85A 3LFTA 3JQQA 3GT0A 1K8XB 1NUPA 3Q3EA 2WR8A 4KRXA 4KQLA 5FUXA 4ZDWA 2YNMA 3DPSA 4MPRA 1YZQA 3ZY6A 2Q5JA 4L0QA 2I6UA 5KNCH 3DVRX 4N6AA 2N1MA 2GAFA 3AOGA 5J4LA 4G87A 1JXOA 4BUJA 4DNQA 1P60A 2AFHA 1XHFA 1V8PA 1EA7A 5EE9A 1N8SA 2UXCB 1IWBB 4HX5A 4L7QA 3W7VA 4IHJF 2O1EA 1CY2A 1KSGA 3BA1A 4ARZB 3QYFA 3GQ8A 4KN6A 4MGKR 3IT0A 2ZUEA 1SBQA 1L5SA 4G0ZA 3C3EA 5EUMA 4C29A 4EELA 1KRVA 2LE0A 2ZUBA 3AZQA 1I3OA 1TAQA 3A1NA 3JW8A 4AA7A 4B3SB 1FUYB 2H51A 5DNVA 4HDRA 1TAGA 3GLRA 3TLJA 1LLQA 2VS1A 4IIDA 3RWBA 1OAOA 3FN4A 3BSYA 3BF8A 4NMHA 2W0WA 4NHOA 4BC1A 1UL1X 1LGYA 5DSTA 4BLQA 4DLRA 2I7DA 3IILA 4QGSA 3DBVO 4R8RA 5DPMA 5EXEA 5IUKC 4J0FA 4MP8A 1Y7PA 5GOZA 2I8LA 4UMDA 3SM9A 1TO1E 3D3NA 1O87A 1XJ0A 2WT9A 3P0RA 4KQIA 2DLNA 5HDQA 3HRKA 4R9RA 5LOVB 3LKVA 4PGMA 3VHRA 4FHGA 1VCMA 1Z2NX 3BJEA 1NHGA 2K87A 1L3BA 4GOOD 2F1HA 3C3KA 2RARA 4LJLA 4X62B 4DIFA 1OW3B 4Z99A 3OLZA 2FNAA 2AD5A 1P5HA 5CGQB 2MWMA 1LX7A 2XTMA 3CNOA 3AM5A 4PZLA 2JIMA 4O2AF 3OOWA 1ABEA 4WOPA 3S1SA 3HA7A 4J0CA 1LXCA 1X1BA 1DBIA 3MVEA 2VAMA 5J2TA 3ZI0A 1EVZA 4BNGA 4J03A 3LPLA 1PFQA 2CB9A 2G4VA 5F35A 3VGJA 3OPYA 5AXBA 3VV3A 2ZM6B 4DANA 4UHJA 3WL5A 2LKCA 3F1LA 1EE9A 5AKHA 5KB3A 5AKGA 4O5OA 1N2CE 3PICA 3L1VA 4U39A 5IP5A 2QRMA 1XLWA 4DSOA 3H9BA 3EIFA 4RY8A 3I1YA 4IIJA 4WA8A 3SR0A 1I9CA 2C9DA 4AYXA 4V0LA 4D5EA 1GN8A 1C9NA 3QFSA 1G20E 1K8ZB 3IDAA 1MAAA 3G5TA 2QJRA 4G0XA 4ZT6A 3K70C 1R0YA 3PFHA 1CJTC 1HYEA 2XX3A 3D6NB 3LL7A 4OI2A 4TT3D 4Q1CA 1S2OA 4ZAVA 1AM4D 1N0IA 4DS3A 4EPTA 3GFTA 1VRVA 1GG8A 3A3OA 3I42A 1F0PA 3HUFA 1T1SA 1U2GA 4DCGA 2DY0A 3QVKA 4LRUA 2BEUB 1U7DA 3K8QA 4FEGA 4HB0A 2HGSA 1REQA 1NXXA 1GG5A 3N0WA 5DVZA 4JOSA 1E63A 2JD2A 4K7JA 4DPLA 5HUQA 2HA3A 3KU4A 3JZFA 3M9XA 3P8ZA 3IQEA 2IXTA 4M7WA 5ITWA 4CKXA 2FP3A 1R4NB 2J8ZA 1V45E 5EPOA 1Z8DA 4YWHA 4BP9A 5GY7A 2A0KA 1N0HA 1J25A 1XV5A 3H97A 1I2DA 3WFZA 1W36D 1Z4MA 4BNIA 4HN4B 5A04A 1H9BA 1SU6A 3LGSA 1TTPB 1H69A 2P6UA 2KWIA 2XMZA 5JJBA 3IT1A 3CZRA 2C78A 3FKSA 4RGVA 2ZSUA 1OLSA 4JJ4A 4L3WA 4R69A 4R98A 2VPQA 4G0NA 4QYIB 4IDOA 4R7ZA 1KZ1A 1BE6A 3PEFA 4IQGA 4DLYA 4C76A 3R5KA 4ON9A 1QIHA 4YLEA 2C00A 1BMDA 2J3EA 5F2NA 1FFHA 1UWVA 1POXA 5C4IA 4QUBA 5IAGA 2G76A 1L0SA 2TECE 3SOZA 1SSTA 1QX3A 3L4JA 2LBPA 2R1VA 3SAJA 5BPHA 2V6GA 4CNBA 1VPWA 1BA2A 3TZQA 2X3UA 3BXYA 4DR3B 2PZMA 1NW5A 2X41A 4DSAA 2H5EA 2I2DA 4HPXB 4E15A 3C5WP 4F4IA 4MIOA 3MZ0A 3UYKA 3A2KA 1HDOA 4IDPA 2WDZA 1Z88A 5AHKA 1BVUA 1QG6A 4DR1B 3RAFC 3PUHA 3HLYA 4WCDA 2QAGC 3E18A 2PRKA 5AUQA 1CJUC 1ONSA 2P4SA 3R5XA 4L1KA 4ALMA 4DHEA 5J4VA 4ZMSA 4C30A 1QGYA 2B8JA 2FEWB 1ZNQO 3BWXA 4YT5A 1DS6A 1QBGA 3ZCRA 5IS2A 3AHGA 1N92A 2FPWA 1N1GA 2KQUA 3EAFA 1CWUA 2ODEA 1C1XB 3LVFO 4MVJE 4PYIA 3UCXA 1TUIA 3UMGA 1SVUA 4LIPD 5BRAA 8ATCA 3X1JA 5HJ5A 3I6QA 1P2TA 3PK0A 5DIZA 4D3ZA 3SQDA 3GGCA 3MMXA 4KDCA 1P80A 4BDSA 1HTWA 2OZPA 1PGJA 4ITRC 5AKXA 5EKSA 3ZCSA 1YZFA 3VU8A 4ZAFA 3R74A 1IOLA 1Z62A 5CVDA 3OOHA 3VSAA 4DXHA 3UKJA 2FPMA 4BFLA 1Y48E 3QXHA 1M1UA 1X7WA 2IU9A 2OV6A 3TG2A 1JVSA 2A78A 2JJ2D 3VM6A 3AB7A 3TLZA 1GAEO 1QIJA 4KN9S 4R6XA 4RIGA 4GPBA 1II8A 1NBEA 3TOSA 4KIWA 3RC1A 3ID6C 1NBIA 4U2FA 1U9YA 1G64A 3VR1A 2D5CA 3WBBA 2DECA 1SKQA 1ZR4A 1A9TA 4KRYA 2PA3A 5JVDF 4MGEA 4BE4A 1ZS9A 3CKLA 2X7XA 3WYNA 3L0SA 2WMOB 1ZNYA 4HDAA 5BW6B 2OPBA 1XZCA 2RHMA 3WKAA 3JD1A 4LYYA 2J6IA 2W6NA 3LVBA 1S6YA 4CKZA 4ACBA 3FJOA 1CS0B 4X61A 4J1TA 3BN3A 3E22B 1EESA 2E18A 2OOKA 3BRWD 3IHWA 1BU5A 4OSPA 5AJVB 4C78A 3GIDA 1UWLA 2VTKA 5GV8A 3NTOA 2VRCA 5KREA 4EB3A 1IRXA 1LKZA 2C31A 3N86A 4U63A 4QUAA 4ZIRA 3WFIA 3ER9A 1NLFA 3FHCB 4JUFA 5JXIA 1O5TA 3IIMA 1PZFA 2NQ2C 3AR7A 2WM8A 5LCXA 2D8AA 1MEOA 1NVGA 4FP9A 1AURA 1TW3A 2XQFA 3T12A 1M1YA 2ZJFA 2WSIA 4DCMA 1R6UA 3KZCA 4RPCA 1FYWA 3SX2A 4P7GA 1E4YA 2CXRA 3DMYA 2FRXA 2PUVA 2ZYDA 1YZLA 3HB4X 1N6LA 3SCZA 4N9WA 2CNWA 2IYAA 3GMIA 4M8IA 2XF2A 2PN1A 3B82A 2BR4A 1IHDA 4HEA1 3GAFA 3RAPR 2FFQA 5DN6D 3AL0C 1ETHA 2WLSA 1JQLB 4C87A 1T9GR 1Y1QA 3RC2A 1XIVA 3INGA 1YOVA 4HDNB 5U4QA 4M1EA 5CB8A 5ELXA 1N2BA 4RDHA 3ZZMA 1YP2A 2PUJA 3AF2A 4WOCA 3NMUF 1DTEA 1GKIA 4Z86A 2H7CA 3RSFA 2O54A 2Q28A 3X2SA 2A7QA 2OV2A 5AJUA 5DGTA 4CUZA 2W6JA 1C3OB 1Q1NA 2P6PA 3DFIA 2HK9A 4QXRA 1KU6A 4Y6RA 2ZUSA 2RIPA 4DLTA 3IR7A 4PSVA 2IH4A 5TGDA 1TYCA 1Z8FA 2V7WA 1U3DA 4FJ1A 1QIMA 4FDTA 3FVRA 2HO4A 4JP5A 4JIGA 2C7VA 3KHKA 1W96A 2JFUA 4ARSA 2YV2A 3V8QA 4DCOA 3KFXA 1E1NA 3MINB 4LMPA 1TTQB 2O2YA 4JD5A 3DOCA 2O8BB 2GILA 1U2RA 2VNKA 1KFJB 3CJRA 1U3VA 4FQ7A 1WDLA 1UBTS 4I1IA 4KMSA 4XTCS 4HXFB 2XOEA 3PRJA 4RYDA 4TTJA 3X1ZA 2A9QA 1YS1X 3C87A 3COJA 3ZWBA 2OV1A 5KS2A 4BLVA 3CB4A 5GMOA 4JP3A 2JJYA 1KP3A 4KO2S 4BKPA 1NY5A 1QTQA 2C3MA 5D3QA 2M6KA 1TOAA 3E4DA 1BOFA 1M2OB 3ABSB 1U81A 2PNFA 4FNOA 1N4AA 5THXA 5M5BA 3ULKA 2BFOA 2H7YA 2C8KA 1S8NA 1OFHA 2OCGA 4YEDA 2NSLA 1G0NA 4B80A 2WJ3A 2X8WA 4GDMA 5LNK1 2WP8J 3W78A 2D2FA 4N03A 4PHHA 3OTIA 5PNTA 4AUKA 3DR3A 3ZG6A 1MJ5A 3K30A 3ELYA 1L4GA 4CMKA 2VJMB 5ITVA 1KZGB 1O3YA 4GLOA 4Q37A 4QEDA 1SA0A 1Q7RA 4BYGA 2FDXA 3P0EA 2BP7B 5BWNA 3LWNA 3EFOA 1YE8A 3OT1A 1A1SA 1GZ5A 1N2EA 4J18A 3FR7A 1SVNA 2P1RA 3K9WA 3LF1A 3OQBA 4M7PA 2ASVA 5B64A 1NKVA 5H81A 4D74A 4FYYA 3QFHA 2JFHA 1Y1TA 3C70A 4RZHA 3QVSA 1GQRA 2H9IA 3GOSA 1NW4A 3UT0A 1DKMA 3CF2A 1O1YA 2O3QA 4LTMA 1HQKA 3KOXA 5J1TB 1PJLA 2Q5LA 2VAXA 3DR5A 1UMKA 4I4TA 4DQXA 1XTSA 2A9RA 1QGUA 3IO5A 1ZCFA 2GJ4A 4FDMA 2ZCUA 2QAIA 1D09A 1DIBA 2AX3A 4KAFA 2ZTHA 4UCFA 2X5NA 3BBPA 2H31A 3U40A 1SKYE 2FZEA 2XVZA 4NU8X 2ZEJA 1MN6A 3WNVA 3D31A 4LZAA 4AD8A 3VBCA 1HT0A 5HVNA 4IDNA 3I6MA 4WECA 5AVZA 2B5OA 2I62A 5FLYA 3CRNA 4YPFA 4E1KA 1ZOOA 4L15A 2OILA 5LQSA 1YCFA 1J2YA 3Q3HA 5F3DA 5JH7F 1RZRD 1ZD2P 1Z3IX 2ZBVA 4DL9A 2VRWA 4ZOCA 1VJ5A 1RC0A 1WNTA 2J0VA 3Q2OA 4C4TA 1B23P 2I29A 4WKOA 5EEHA 1HRKA 4G37A 4O25A 1HA3A 2WUDA 5HJ2A 3KXPA 1M7HA 3H9CA 3MQHA 2ZWAA 4XLLA 4O4IA 2GAOA 1S3SA 1TVKB 2XV1A 3C3BA 3GA0A 4NK5A 2OAQ1 3UB4A 3AIKA 1KMMA 3H7AA 1RLUA 2VTBA 2CDNA 2D1TA 3W1EA 1K75A 4E5KA 1IN1A 3ETDA 3FPLA 2VPPA 3N8NA 5IUJC 1QYIA 3VJLA 4MCAA 2Z9CA 4JJFA 3KG2A 1JHDA 4R8MA 3AHJA 1JH8A 2OCKA 3VPHA 3FF1A 3SG0A 4DREA 2GXAA 4Z4IA 4FB5A 4BHTA 4TYWA 3D8VA 4GSKA 4NDNE 5CH8A 1ENZA 5EJ8A 3PLNA 1UMDA 3M6IA 1K27A 2JFOA 4O4HB 5HA5A 4BQRA 2R8RA 3TWOA 5DF1A 3AOEC 1NYRA 2VL7A 3ZI4A 1ODSA 4DKXA 2FWMX 3U7IA 1ESNA 3UA3A 4WI1A 3MIZA 1L4NA 1D8AA 1Z0UA 3F96A 4MQEA 2VATA 1N75A 5DEPA 2HWUA 4D02A 2PRZA 5CU7A 3KDSE 1G7SA 1GUYA 2PEYA 2PKEA 3M5DA 1I3NA 4Q7KA 3KQWA 5BXQC 4ZVNA 4BGDA 2F1JA 4LYEA 4RTJA 1FP7A 1M83A 4CUKA 2C94A 2YWJA 2XR1A 4MV4A 4EUFA 1ZVKA 4LJKA 4QPPA 5M2QA 1FXJA 2AOXA 5D51S 4HYTA 3GLTA 3KKEA 1C7FA 4MW0A 4LNHA 4XYMA 2Q27A 3AHDA 4NQRA 4BO4A 3L0PA 2J0QA 4GNRA 5HILA 2HR1A 3FTCA 4DWOA 3FUXA 1ZQ1A 3N28A 2ZXUA 1TLLA 5AI9A 3THWB 3EZNA 2GHIA 4IDGA 1U0GA 1R5BA 2XA2A 3RF6A 3JRNA 2B1QA 4R1LA 3WL6A 5TEWA 3MLBA 1JECA 1JILA 3O8QA 3RVSA 3HV2A 1A76A 4C4XA 2X0NA 3KP1A 1HF3A 4TYMA 2XMDA 3CY6A 1RP1A 3RR2A 2ORWA 4QLBA 1QIDA 4ZO8A 1NNI1 1QBKC 2Y1FA 4GOXA 5COAA 1W7AA 1TRKA 4HDOB 1Z2PX 2YWCA 1XI2A 4UMVA 4ZEVA 1H1TA 2FW9A 3WWDA 3OSZA 1L5HB 3VNRA 5LDHA 1JJAA 3M6UA 1U3WA 4OP2A 3HYLA 2QZJA 3V1TC 4ENUA 4IXTA 5MHTA 1AC5A 1R3UA 1Y3HA 3RABA 2O0HA 2XADA 4PPQA 3UJNA 3DZIA 3UAZA 2BGIA 2HC9A 2SNIE 3HEMA 5DI3B 3OJCA 3H4IA 4DMKA 4DG8A 1JRLA 4CM7A 3ZDAA 3DCNA 3KJIA 5CXXA 3FD8A 1L5FA 4PN7A 3O31A 4POAA 4QXOA 3BUSA 3PIDA 3Q8LA 1AGPA 4OHBA 2ZE7A 1V8OA 3BA6A 4D9FA 3HADA 1LPNA 3QYAA 2Z98A 1T3DA 3QJ5A 4FX2A 2W9XA 2ONZA 3GUCA 2G40A 2V8BA 3EOZA 4N6NA 1S7GA 4JJGA 4ARZA 1G97A 2F90A 2PV0A 5LP6A 1HEYA 4RY2A 4EA9A 4Q9LA 3IESA 1CY0A 4L51A 4L8LA 1N3IA 3AEZA 3QPWA 1OVGA 2PL9A 4HATA 4OFZA 3MCUA 2CKMA 3GZNB 4ND2A 2C0PA 5TS3A 1O6FA 3TSAA 5KKAA 3F9IA 3O8LA 4RDCA 1GYQA 4IX9A 2CDCA 3BL5A 3H87A 4JXKA 2AV6A 4Y2XA 4O8ZA 2PX5A 1MA0A 3VR3A 2P67A 4PX2A 4LRYA 1V43A 3W6OA 4BGUA 1P1HA 4CMIB 2Z08A 2RC5A 2FN7A 4R40A 5LOVA 3MN1A 2BFNA 3HA2A 1NIJA 3ZU5A 4LZOA 3E2PA 3UUFA 4DMCA 1SPXA 4XGNA 3AKZA 3RJMA 5IDYA 3ZD9A 2C3OA 4Q7EA 5B2EA 1NVUQ 2WOOA 4GP9A 4QOIA 2ZUWA 4UDNA 4WNIA 4FMDF 2C7RA 4FYWA 5BRNA 3VBNA 2ID8A 1VJRA 1R4MB 1BOOA 3M1IA 1N8KA 1YVRA 4HMPA 4TL7A 3W2IA 4YMVA 2VJDA 1RXEA 2WLFA 1NNUA 2QTBA 1AKYA 2QPAA 1P4SA 2OZKA 2R1ZA 4TXHA 1BAPA 1UCFA 1U2TA 2WAOA 4L75A 2JJ1D 1VHWA 3HJAA 4N5NA 4RPKA 5HF6A 1WMDA 4L4SA 2P4QA 5IJ9B 3SPXA 2K2WA 1XVLA 1P7VA 4P93A 4US1R 5D7NA 3SGLA 3VJMA 1Z8HA 1X38A 1BG6A 1KK2A 1R8JA 2I4IA 3JARB 4R31A 5IVPA 4PAMA 3CO0S 3RVNA 4L0CA 5EFZA 3W8DA 4JOQA 2VF2A 1QDEA 4K6HA 3LDGA 4F7WA 4V0NA 1P2DA 1KO8A 4JI1B 1CIJA 1LRKA 1FUIA 1WB4A 3NCHA 5I45A 2AJCA 3GJ7A 3LP5A 4PYKA 1Z4LA 2PZLA 4TS3A 4UOQA 4QYTA 2LDXA 3KWDA 2FEKA 2OP1A 4DG9A 2P1DA 5JS1A 1YTUA 5LSAA 1XU9A 1P8JA 1DLIA 2D1RA 2Q1UA 5JASA 4NFSA 3QLVC 1H8HD 1KGDA 2DY1A 3L77A 4Q19A 1T6NA 3ZDBA 1VKRA 2BEUA 2ZBQA 1KORA 1G6OA 4JZKA 1ZJZA 2XECA 1ZW6A 1DC4A 3PE3A 2ETXA 3LG2A 5JCJD 1OV4A 3W90A 4TQGA 1K1EA 2XLCA 2ZJ1A 3CXRA 4CT0A 5DNUA 3ZOZA 4C0LA 1L1QA 2FEXA 1O6GA 1R4NA 2IHVA 2ONYA 4I1RA 4ILEA 4G63A 4EG7A 8LDHA 3LPCA 4XSHA 4DSUA 3I53A 2WA1A 1UP7A 4LOJA 3AUYA 3S2ZA 5H1YA 4WK0B 3QKIA 5CW1A 4OYHA 3RGGA 1E0KA 2XGMA 3CNLA 5FV4A 2M6SA 3V1KA 1AQ6A 3OA0A 3QWIA 1RQNA 2VA9A 4KBGA 4QYIA 4GM1A 5DV9A 1OBFO 2ZVDA 4NG4A 3AVYA 4WBSA 2B2CA 4ZAYA 1J8YF 2H63A 3T4EA 1GZDA 2XYPA 5ESDA 3UGJA 3IBTA 3WLPA 3FMFA 1EYZA 1S8FA 1IQ0A 4HXYA 3I28A 3JR7A 4MAMA 4Y30A 1SCUA 1BEUB 2PM8A 2XI4A 5LYJA 5JI3E 4K2AA 4GL2A 5DBOA 3NGMA 3FX2A 4H1VA 4IZOA 4G4SP 3FWWA 1A4UA 1NMYA 3MNFA 4GGPA 4Q01A 4YFYA 4ZVMA 3IGJA 2V6IA 4WLOA 5ALHA 3VX4A 4G8JA 1KDTA 2ZIZA 1JEYB 3PGMA 3EMDA 2J0UB 2D00A 2ZRCA 1BKSB 3OI7A 3B2EA 1D2NA 3PDIB 5B58T 1BJRE 1Y1LA 3STTA 1TRHA 2VDLB 1AA9A 2GXSA 4QYMA 4YRKA 4C7OA 5JJLA 1UZAA 2BFMA 4S1NA 2Z6UA 4AIRA 1FDTA 1QHYA 1QLWA 2WUWE 3TIFA 3WLFA 4ENVA 3W7AA 2PX6A 2R86A 5EWMB 1M8JA 2C0CA 2FV8A 3R77A 3OC6A 5ESXA 3O4JA 5LYYA 4ZMRA 4E88A 3GLGB 1ZL0A 3WKDA 5AVQA 1ZUNB 1ZFNA 4LOKA 1C1XA 1JYEA 1B2RA 2OB2A 3R3RA 2JBAB 2OGTA 4M9ZA 4I1PA 2ROQA 2O05A 4IZ6A 1YFJA 1YL5A 3AY0A 3N58A 3RNOA 4A6EA 1JKJB 3CLUC 2XB4A 5FQNA 2Y27A 2JBHA 2WSYB 4XB6B 5HE8A 1MA3A 2GBPA 3QU5A 1GSOA 1RHKA 4ZT7A 4CIBA 5DBEX 4YMUA 1ONPA 2ECQA 4G1EB 2AYXA 4X64B 3ZDQA 1EB8A 2GWHA 4NJOA 5HF8A 1SK8A 2F62A 3WGHA 3F2VA 1TE2A 3HNPA 3DB1A 4LBZA 1UQUA 3TRHA 2XTZA 4I5DA 5G4KB 4F96A 5E6UB 3GRRA 5I7SA 2Q5HA 2ZW9A 4ZVRA 3M4XA 4MVYA 3U3RA 1SK9A 1PZNA 3IUPA 3VSBA 2PE5A 2B8TA 4CL8A 3NBKA 2QVZX 3RRMA 2PG3A 4I5EA 3URMA 1K7SN 4V3CA 3OX2A 1KEUA 2A5JA 4DT1B 2YN2A 5D86A 1JIVA 1BNCA 2G5CA 4RVOA 3U4HA 4AF6A 1VJCA 1C7IA 1VL1A 4GPAA 1JTVA 1ZMTA 3IKVA 4ZPJA 1CEYA 1EDZA 5KNCD 3T3PB 2A0YA 4KHPB 4B4KA 4YUVA 3B5JA 2MCFA 3G0HA 3MQGA 3IUJA 2GF2A 1VPDA 3E22A 2PL3A 5DFAA 2Z6AA 1FXWA 2J3LA 5EWJB 1SCIA 2Q0HA 3FOEC 4ENRA 1TMYA 1MC5A 3E1SA 3RT9A 5U1PA 3ILYA 2RKWA 2VT2A 3FJ1A 4W99A 3ZKWB 4CHGA 4OBBA 4IFBA 2BN4A 1HURA 1ZI9A 3OZEA 1A8PA 2IFTA 5DO9A 1PS8A 2X9NA 1EVLA 4HJXA 4OHUA 4Z9YA 1Z18A 1IN6A 1ZWLA 4KIGA 5K3SA 4LGVA 3PDUA 1EIZA 2A9JA 4L0DA 1NRWA 3AR4A 4YR7A 2PT9A 4O4IF 1ZITA 3OESA 5JAQA 2R65A 4CU5A 1SVMA 2O8FB 4CHTA 1FMFA 1FSPA 1JEOA 2B25A 3IBYA 5F98A 2ZAMA 1YP3A 2QYSA 3TFQA 2F8SA 4EQZA 3VR5A 4O5AA 2NV6A 3SKYA 4KQXA 3L41A 3UJ7A 5LB2A 1T1GA 2B7LA 3QNUA 3DLCA 5FUQA 2QD1A 3PHCA 3QYPA 3HCOA 5DTIA 2RI1A 3DT9A 1S89A 4Q7LA 2BBTA 3QKWA 1SQ5A 1EDBA 2J3KA 2VG8A 4UE3S 5G3ZA 1RS0A 2D5AA 3N2YA 3ORRA 3FTPA 3WGKA 4J3JA 2DKNA 3GAMA 3G8DA 2PAAA 1KP2A 1LVGA 3D02A 4JYPA 1SQSA 1TPYA 2Y9PB 3D3KA 3T3MB 1QVVA 3GVPA 1XNHA 2X6QA 4GYKA 3GZ4A 3AGQA 5J58A 3IXLA 2R6ZA 4I1VA 2VOEA 3K1ZA 2PKQP 3CB2A 3ZY4A 4AO6A 4EFDA 4EUEA 3O6VA 4BB5A 1QO0D 1Y3IA 2CJFA 3PXGA 3TRFA 3WIUA 1DMRA 3A9TA 4BAZA 1WR8A 2XMBA 3I62A 1SXJE 4KE8A 4ASUA 1OLXB 2WINI 5JECA 4E6UA 4RQAA 4RXUA 1ZI6A 1B8UA 2ZAIA 4M22A 4NARA 4MDEA 3SYLA 1AOXA 2J5XA 2BGKA 3O8DA 4RFVA 1KQAA 4M6WB 2VXCA 5IVKA 2OFFA 3MINA 4ENWA 2VI5A 3U1VA 2FQQA 2ORIA 3W79A 4JB0A 4Q3LA 3H5TA 4G24A 2ZWVA 4WKPA 2O8BA 1XGKA 1EQUA 2QVGA 2W8BB 3I72A 4CT5A 4MITA 1OBCA 2VC2B 3I04M 2VSQA 3PUYA 3VU0A 5JUWA 4F60A 3LBHA 1QRGA 5I7EA 4E6PA 1G8YA 1OU0A 1IM2A 2A4KA 3KKNA 4CM5A 2I34A 3RS8A 4ZJUA 4D96A 4MJ7A 1IYZA 1I0IA 1J4AA 2PO5A 3HACA 3S81A 1WV0A 2W8ZA 3Q9NA 4ENQA 3THOA 1QE0A 5BUCA 3UXEA 4F9TA 3EF3A 1MGOA 2YZNA 4PHCA 2YXNA 3B6EA 2MMGA 4V38A 1K7FB 4DCPA 5DWVA 2CEKA 1D2GA 1MJHA 4G3XA 3BD9A 3Q3VA 1G6Q1 3HN2A 2VJMA 3FVTA 5DIFA 2UUBB 4Z49A 4KRFA 2JNWA 4LS3A 1N0UA 4N0QA 2BP7A 2UVPB 2P5UA 1C81A 3PJEA 3QXCA 4PC6A 2HNKA 4RZIA 3VXKA 5DYGA 3CPJB 2OMKA 5KCMA 3Q7RA 1NIPA 3KPJA 4NDZA 2Z83A 5LZ2A 1HLPA 3LHDA 3DL4A 1Y6QA 1RM3A 2ZQYA 4RO0A 5B2FA 5ANRB 4NDAA 4QHSA 3CS3A 4JQSA 2R96A 3PHGA 1B93A 1GGKA 2B8NA 5EEGA 3G1TA 3OZRA 1Z0JA 1M2GA 2IT1A 3CUWA 3EWAA 3DHOA 2DQZA 1XATA 5A4KA 3WJAA 5ICEA 4LJ8A 1S4QA 1J9GA 4N7MA 2YNMC 4P98A 3SIPA 1QMGA 2BUBA 3LT1A 2JRCA 5KYVA 2H2WA 2AG1A 2PZGA 2QTGA 4R2JA 5IWCA 3VX3A 2JFQA 2I7TA 4GXRA 3EUEA 1MJGM 1MB4A 3DNPA 1KOJA 3KSRA 2TMYA 4MI6A 2RH9B 3TAUA 2PRYA 3IAFA 4NVRA 4C03A 5K03A 3Q6NA 1OYYA 1EFVA 2VIIA 1KAQA 4LOAA 4GPZA 4P3YA 2XQGA 7AT1A 3K0FB 3GPIA 4R1MA 2V0KA 2QX4A 3DBOB 1XLUA 3RYIB 4BFVA 1KZ9A 5K6TA 1WZ2A 1L2TA 1RCTE 1MQSA 3ZD6A 5CIYA 5EL0A 2R66A 3MQFA 3HCEA 5CHYA 4LE1A 1SQ6A 5IX8A 2QK4A 1CUCA 1DBVO 1TVKA 3QE3A 3A1TA 2IU3A 1RXSA 1IXRC 2NSYA 4BFZA 3RU7A 2B4TO 3DH0A 1N7JA 3ONEA 1CUSA 1OAOC 4WKBA 4X63A 3ZZ0A 2CYBA 2OBNA 4RPIA 3TEFA 2X15A 3WP0A 1FUKA 3LO8A 2IPMA 4UPEA 1PBTA 4IS2A 4DCLA 1YQDA 2F00A 1N2SA 2QT0A 3E7PA 1YFZA 2G1PA 4MPDA 1WLYA 3R1IA 2HI0A 1X1RA 1RE0A 4QYWA 4WASA 1DEHA 5L3RA 3TIGA 5BSKA 4NBSA 4N0DA 4PV7A 4PEVA 1H4VB 3D4OA 4O4HA 3GB9A 4EMBA 1T3LA 1WV1A 1Z0ZA 1M0TA 2W5UA 4WERA 1M8KA 4IIGA 4R2WA 4Z1MA 1NQXA 3KB8A 2FOLA 3QTTA 1QGZA 1DPFA 1TZMA 3FFAA 1EVYA 4OP1A 4R8LA 4WN3A 3TLBA 3ZCTA 5EJEA 1A2KC 1TB4A 1U1EA 5SY4A 4IVQA 4KMOA 3AH8A 1Z29A 4EHNA 4UU0A 3DGFC 1W8IA 3CZMA 2JZCA 4FMCB 2OYSA 1XNJA 1EH5A 2H2FA 3JPYA 4U02A 1OTHA 4YGYA 3CONA 5AI5A 4GQAA 3ASUA 4YMSA 5JJ5A 1MUUA 1MC4A 3OKPA 4IHAA 3I39X 1JX6A 4DNPA 2EEPA 4WBNB 1IJEA 4EGAA 3ZU6A 1XVAA 1HG1A 1IZZA 2WVAA 3E9RA 3KAJA 4IQFA 3GNLA 5CIQA 3WGZA 4K0KB 3OEHD 3OZFA 4J6EA 3F1KA 2MOKA 1FDRA 2CLEB 3RAJA 1HDYA 1FVFA 3OWOA 4Z4FA 3MJCA 5A3QA 4DF3A 3F3MA 3RH0A 3RFCA 3EA5A 5JD3A 3JYQA 2BM1A 4A27A 3KS9A 1LBHA 2HMTA 3THWA 2MSNA 4TMTA 4UOZA 1ZLXA 4HYEA 1WTAA 3DQQA 1G7TA 3JALB 4UFPA 2Y6VA 1NMZA 1NVKA 2PGAA 2D3TA 2Q3JA 2WUFA 4K6KA 5KJEA 5CJJA 4EJFA 1VHJA 3L8MA 3WK5A 4ETMA 2RHCA 3ANLA 3O4GA 1SXQA 4EH1A 1JSCA 1O2DA 2E49A 4EPRA 1U2GC 3NPAA 1SNYA 4QVGA 1PI3A 3DMTA 4GWKA 1N2OA 3UATA 1E69A 4C06A 1RLMA 3JQAB 4Y98A 5KDDA 1B8NA 4X7RA 3RG2A 3ZX5A 1MC1A 3NYQA 4ADSG 2IC5A 4JQZA 1OH7A 3ZV5A 2ZWIA 5CUQA 4N3NA 4MGZR 3DJYA 3WK4A 2BR3A 1WS6A 3GLKA 3K9QO 4OLJA 3S1AA 4A9AA 1ZM3A 5ED4A 3BCRA 3FCSB 4YJ2B 3E3OA 5DI3A 1EIWA 3O9MA 1X0VA 3UV7A 4LI0A 2O6HA 3HVIA 2N75A 2VUTA 2WU3A 3RIXA 2GBGA 4ZQEA 3SC4A 3HU3A 4WDQA 1RI5A 2QQ5A 3R7NA 1NXOA 4KO1S 3HEAA 4QULA 3MCZA 5AH0A 1BVHA 4MLCA 3K70B 1NFQA 1FX0B 1WL8A 2WM3A 5KBYA 4MZXA 1QQ7A 3DM5A 2VPWA 1BW9B 3HFRA 4U7WA 3IR5A 2ZKIA 1KO7A 2O2DA 4R6WA 1IIBA 4ZTBA 2JAUA 2JIDA 4OK5A 3BYZA 2E7ZA 2QLNA 2BGMA 1JDJA 1KZ6A 2EZ9A 5IDVA 4RE6A 3IIJA 4EKYA 2RJ3A 3QWFA 1EEHA 1Q0QA 2IYYA 3WI7A 3O4RA 3CX3A 3PFWO 4C43A 3BTOA 2HY7A 4BNJA 2B99A 2R68A 1IUNA 4UBLA 1O94A 4MV8A 1Z0IA 3W6UA 1ZPDA 4LPKA 5C8XA 3R0XA 3U13A 4PYLA 1WABA 1Z4KA 3JY6A 3OU2A 2AQ8A 3KTOA 2G82A 1EWWA 4CLEA 3TJRA 4PG4A 4CDGA 2CN1A 2NO9A 4D6PA 1YT5A 3TUJC 3U0BA 3AQIA 5AVWA 5KWEA 4AX4A 1FQWA 4FQ8A 2CFTA 3I9FA 2GLTA 2V9ZA 3HCPA 3LYAA 4XEUA 5B1YA 1XTKA 1DG9A 3K94A 1Y8ZA 3EWSA 3ELDA 1N6KA 4RV5A 4DR2B 1XU4A 1YONA 2KW5A 3CKMA 2FUG1 1DZ3A 2GT1A 1VLVA 1EFKA 1QIIA 2I54A 2V0JA 3ANYB 1ZVQA 3QVXA 3PEWA 2YX1A 4HNHA 4OMCA 4Y2VA 3NP7A 4N54A 4J7AA 3SM3A 4B81A 3VMMA 4YCDA 1FCJA 1CW2B 4I4NA 2XUQA 4MUIA 1ZEJA 2F8LA 3COVA 2R4UA 1FFDA 3GEHA 3BRQA 4G56A 4P4UA 3A0UA 4KQWA 4MKXA 5EE0A 4DV3B 3AUJB 3WISA 3KE8A 4BQOA 5IJ9A 3PFNA 4BX0A 5E2IA 5F7OA 4QDKA 5THKA 3ICEA 4MQUA 4UTOA 4LFAB 3UQZA 1AH2A 3JARA 3WWEA 4R83A 1V3UA 2GHRA 3R4CA 4HAYA 4J0JA 4Q9KA 1YJCA 4CBVA 1ZZEA 1ZESA 1KJQA 5JWHA 1FRNA 3C85A 3PUVA 1I6LA 3V7UA 1LLFA 5JNUA 5EERA 2NTYC 3FPJA 3SS8A 1OLUB 1AS0A 1MENA 1NBMA 1ZGZA 3HUUA 4ONEA 5AW3A 2WBLC 4YV0A 2EERA 5I4KA 3QXGA 4PC3A 1UEIA 2EYQA 4QPNA 1X9HA 4QARA 5SYMA 3DDZX 3TQRA 2IXGA 1W5AA 1W5EA 1KK4A 1Z4QA 3IP9A 2P9CA 2BVNA 3NHRA 5IARA 5HIIA 1KZHA 1X13A 4Z0TA 5BYKA 4ZV9A 4OF4A 1ICEA 1LFDB 2RHLA 4ZMBA 3AEXA 3B6KA 1QKKA 2C4UA 2TMKA 4J1TC 4A15A 1L3IA 5F42A 2AIRA 1QK4A 3ITEA 5EFOA 4Z7JA 3G9TA 4G6ZA 1E0JA 1UBLS 3E15A 2ZIFA 3ZGXA 2Q3CA 1KI1A 1W4LA 4PAOA 2AX4A 4HGNA 1EUDB 1GRRA 1UBOS 4QVKA 2QPOA 1JHPA 3EC1A 3A3YA 3L79A 4MWSA 3FTDA 1SZJG 3NTVA 3B9PA 4UTZA 5FFMA 4EDFA 4URXR 4YCLA 1J2EA 3FBGA 1E32A 2Q8PA 3DEYX 4F56A 1Y5RA 1QV9A 4O3FA 2Y67A 1B26A 4QFBA 2PIAA 2K6GA 5IWAB 2PLRA 1U98A 1E3TA 4I81A 4GWGA 1AHPA 1PGOA 1ZN2A 2OCYC 1XXHA 3ZV4A 1FIUA 2J45A 4E5MA 3TTXA 1RRFA 5C0OE 2HHHB 3RFFA 3AVWA 1JIIA 2Z8YA 3ZIAA 1PR0A 4UXHA 1PX0A 4DSNA 2Q3EA 3CX4A 3ESQA 4NK4A 3RSHA 3WYAA 1JFVA 1J8QA 2PO7A 4HZCA 2CXXA 1A5AB 3VR4D 3GVXA 1OZHA 3FTTA 3DW3X 3IC5A 4L85A 4XIJA 5DNDA 3UG6A 5DGCA 3LGAA 4ED9A 4EHLA 5JS6A 1Z37A 1C1YA 2DWPA 2PWBA 3AKEA 3K5HA 3FCCA 4M2LA 4R36A 2IUEA 5EQTA 5FNVB 5DU2A 1DBWA 4LNAA 3D98A 1VFNA 5U4XA 4KDEA 4UQOA 3VUFA 1MLDA 1WY5A 3OZWA 1EGQA 1JEYA 1KAEA 2J0UA 3PDIA 3LRXA 2QIAA 1MH9A 2R7AA 1TNDA 1FY2A 1GOTA 1L4FA 1M0WA 3AM4A 3F9CA 1R0WA 1O6ZA 1RYBA 3SYKA 3T1TA 1M76A 1E64A 4KXMA 4RQBA 4NCXA 1N4DA 4L8YA 4D3DA 1A9OA 2I2BA 4DQDA 1HDXA 1SKYB 1X94A 2FPLA 2IE8A 3Q0TA 1SXHA 3DDHA 5EWMA 4HFJA 3U48A 1M2KA 4F91B 1WMSA 3STYA 4C6TB 4M1YA 3TUZC 5DXFA 2GQ0A 5ALFA 4JEHA 4F4CA 3GLGA 2GJSA 1WMAA 1ZUNA 2BGRA 3G2NA 4FNGA 2PY6A 4H17A 2B3TA 4H4CA 4IKEA 4V24A 4A5SA 2HNBA 1F4PA 2OWDA 4TMVA 3WC4A 2HLPA 2Q6KA 3UJCA 5FLKA 1XTUA 3UWDA 3ZCXA 3EVNA 4GKBA 1XZDA 5AW4A 1NVMB 5KNBA 9MHTA 2FN3A 1JHAA 3PFCA 4PPFA 3RUHA 1DTWA 1JKJA 2HFJA 2ZAYA 4X3CA 1NQWA 1RI3A 3VH2A 5CB4F 5JR3A 3OZSA 2WM9B 1DDGA 1LQTA 1MT0A 1P18A 3ESXA 3NT5A 1NUSA 2Z58A 1N2HA 3DOOA 3KB1A 3R6LA 3EYWA 3PC2A 3NHJA 3W2TA 3GLIB 2XB2A 4NOKA 5G4KA 2BTQA 3GJ8A 5FWAA 4EEKA 1SH7A 4OHMA 3RREA 2O8CB 1C0IA 2J9RA 1C0KA 1R64A 3NTRA 3IXMA 1MRZA 4I50B 5F73A 1QHHB 3M6WA 3LK7A 4MCHA 4EUSA 3I8XA 3WK6A 4FMBB 2BT4A 2O50A 2Q5IA 3KSZO 4HS9A 1CR6A 3FZEA 3N70A 3TTWA 3IULA 4YREA 3GA7A 2GKSA 4K9LA 4JT4A 1S8OA 4M76B 5FORA 1R8QA 4DT1A 3EF0A 4TTTS 2CLSA 4YUXA 1CKEA 2ID9A 1U0OC 2B4KA 3SZOA 1KI7A 3ZIDA 1ID8A 4IFIA 1JFTA 2YBDA 3WA6A 2FW6A 4AM8A 2J7PD 2ZUTA 3FYTA 3MTGA 1HZJA 5CK5A 2ZR0A 3MC4A 1JTEA 1NATA 2PS1A 2J9ZB 5FPPA 3ZCQA 3T9EA 3TFOA 2LNDA 2BKVA 3KTAB 4NR0A 5EWJA 4WUVA 3CG0A 4MQFA 4K26A 4EQYA 3E2IA 1F6WA 1W88A 4XOIA 3ZKWA 4L27A 1WW8A 2ADFA 1H3NA 3NAGA 5AQ1A 2FMTA 1VSTA 3LBIA 2YYSA 3CNEA 1F6BA 2FPPB 3KT6A 4MRPA 1P5FA 4Y6LA 5JO9A 4AO8A 1M2EA 1WXHA 2JEOA 3EZXA 2QRUA 3BE8A 2WD7A 4EKGA 1ZA1A 2B1IA 2O8FA 2CJPA 5J2UA 3N2EA 3SP1A 1QREA 2NT3A 1PP4A 2QSJA 3PPVA 5ALGA 3T61A 2ZETA 3T7SA 3D4NA 1N1DA 2AXQA 1UK9A 2XYVA 4EITA 3T34A 1L7VC 3PF8A 5EMNA 1TZCA 2FMHA 5DP1A 4A92A 2P41A 4E6EA 4EW6A 2PVSA 2IRWA 4LGMA 1ZH2A 3VVCA 4TROA 3MGAA 4X90A 3IJPA 5K8LA 1DEAA 2PBFA 3FOBA 5TQJA 2WAMA 5T7BA 2F4NA 4F6LA 4DWVA 1P81A 3F7MA 4KH0A 4W1SA 1HFJA 4LI3X 2QIVX 1BJTA 1Z5VA 1F2UB 2EKQA 2WFLB 3GEDA 3QNWA 1ND5A 2WLDA 1AGRA 4LDNA 4YRJA 4D4LA 3TMKA 2YWBA 4CL2A 5BOVA 1ZICA 2AEFA 4G85A 2O8DB 4YDSA 1C80A 2AEJA 3MRTA 3P52A 3W9YA 3SHFA 1OLXA 1Z6TA 4MV9A 4Y2GA 4C6HA 4QSHA 4CR8A 3EG4A 1ZVJA 1XN1A 3CNBA 1DAHA 1OXMA 4J43A 1RM4A 3P9RA 1I8TA 4M6WA 1LPMA 3C3PA 4INAA 3GQBA 3BREA 3EB9A 1P4HA 3KM0A 4TT8A 1ZJWA 2QUKA 3JPWA 3KSDO 1MJNA 4QOEA 5DHPA 2W8BA 4G0PA 3DD5A 3O1IC 1Q2UA 2XUPA 3AG6A 5C2JB 2B4RO 2V8OA 4KMRA 4OHCA 3CUYA 4D0RA 3HXKA 5CVUA 1FMCA 1L1FA 4P86A 2VNHA 2YWGA 4R2KA 4BFYA 3SJCA 3QG5A 3EEBA 3I09A 4MJXA 4OQDA 4DG5A 4XD2A 1SVIA 3HUDA 1E7SA 3PNVA 1QC5B 4MMYB 1NUAA 4YHHB 3KLBA 4B46A 1FDSA 4OQYA 1T15A 1E3QA 1RJWA 3C6MA 5HZMA 1E20A 3QKSB 3R2JA 4GRDA 5FHRA 5REQA 3IA2A 3E7FA 4DLNA 1Q3HA 3D2CA 3WGOA 3NHYA 1RPAA 5E3RA 1PDWA 4L7VA 2QVCA 4LCJA 1Q77A 3LM8A 1G9XA 5ELMA 8ABPA 4KV7A 1IJBA 1AE1A 1H2ZA 1TJ4A 2WT8A 2UVPA 4C05A 4F3RA 4KIJA 5MN5A 4G1BA 2QHXA 4GVXA 4W9RA 3S55A 3E23A 3NQ41 3OIVA 1O95A 4ZHSA 4Z3OA 1WP4A 4F12A 5EINA 3KEMA 4CE6A 4KK3A 3W8EA 2Y2VA 3K2QA