2WLDA

Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
b'MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYSIALIC ACID O-ACETYLTRANSFERASE
publication title Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup y
molecule tags Transferase
total genus 77
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2wldA00
2OI7A 1KGTA 4AC3A 1MR9A 1SSMA 2W0WA 5AFUV 2WLEA 2QKXA 2QIVX 4HCQA 1YP2A 1V67A 2OI5A 5L6VA 1TDTA 3R5BA 4R36A 3EG4A 4M2AA 2ICXA 3MQHA 4N6BA 3DK5A 3VBMA 3TIOA 2OEGA 2WLCA 1QRMA 3R5CA 3FS8A 4IHHA 4KNXA 4AA7A 4HZCA 3KWCA 1FXJA 2TDTA 2AQ9A 2V0IA 4FCEA 3VBKA 1KRUA 2VHEA 3R5DA 3EEVA 1SSQA 3DJ4A 3OTZA 3R2WA 3VBNA 2IUAA 3GVDA 2WLFA 1Z90A 4HURA 4R37A 4G3QA 1T3DA 1J2ZA 3EH0A 3GUEA 4EAAA 3KWEA 2V0KA 4R7PA 4AAWA 3ECTA 3PMOA 3VBLA 1KK5A 1G95A 4HZDA 2XATA 3BSYA 3R0SA 1QRFA 1FWYA 3I3XA 4KPZA 2JF3A 1QRGA 1SSTA 4EQYA 2GGQA 2WLDA 1S80A 3BSSA 2WLGA 1MR7A 4E75A 2GGOA 3ST8A 4HUSA 5E3QA 1KHRA 2IC7A 3P47A 4M9CA 3T57A 3BXYA 2QIAA 3MC4A 3TK8A 4MYOA 4ISXA 4EABA 1QRLA 1YP3A 4KNRA 2OI6A 3V4EA 3FOQA 3D8VA 4N27A 5ADXU 2I5KA 3C8VA 4EA9A 3FWWA 4M98A 5U2KA 2VD4A 3FSXA 1KGQA 3KWDA 4N6AA 1MRLA 3VBIA 4DCLA 4EA7A 3TDTA 4E6TA 5F42A 4M2BA 4E6UA 1G97A 2NPOA 1V3WA 5ADXV 3R1WA 4K6RA 4J18A 5DG3A 4J09A 2V0JA 3BSWA 2IU8A 4M28A 3GOSA 3TISA 4E1KA 4EA8A 2V0HA 1LXAA 4EGGA 1HM9A 4G87A 3VNPA 1HV9A 4IHFA 1YP4A 5AFUU 3IGJA 2JF2A 3HJJA 5DEPA 1HM0A 4G3PA 3OTMA 3Q1XA 1KK6A 2OEFA 5L6SA 3JQYA 4G3SA 1KK4A 3FSBA 3CJ8A 3BFPA 2V0LA 3FTTA 3HSQA 2ICYA 4H7OA 2RIJA 3FSYA 4M99A 5E3RA 3SPTA 4E79A 3DHOA 4KQLA 1KRRA 1THJA 3R8YA 4KPXA 3R5AA 4N69A 3I3AA 1KRVA 3TV0A 1OCXA 1XATA 3BRKX 4MZUA 3VBPA 2P2OA 3R3RA 2W0VA 3OUPA 3OU9A 3D98A 2IU9A 3FSCA 1KQAA 3OW5A 4MFGA 3F1XA 2FKOA 4IHGA 1QREA 3TWDA 3VBJA 1XHDA 3IXCA 5DEMA 3R3IA 1QQ0A 5E3PA 2Q4JA 3P1BA 3SRTA 3NZ2A 1HM8A 3MQGA
chains in the Genus database with same CATH superfamily
2OI7A 1KGTA 4AC3A 1MR9A 1SSMA 2W0WA 5AFUV 3OH1A 2WLEA 2QKXA 2QIVX 4HCQA 1YP2A 1V67A 2OI5A 5L6VA 1TDTA 3R5BA 4R36A 3EG4A 4M2AA 2ICXA 3MQHA 4N6BA 3DK5A 3VBMA 3TIOA 2OEGA 2WLCA 1QRMA 3R5CA 3FS8A 4IHHA 4KNXA 4AA7A 4HZCA 3KWCA 1FXJA 2TDTA 2AQ9A 2V0IA 4FCEA 3VBKA 1KRUA 3OH3A 2VHEA 3R5DA 3EEVA 1SSQA 3DJ4A 3OTZA 3R2WA 3VBNA 3OH0A 2IUAA 3GVDA 2WLFA 1Z90A 1N4IA 4HURA 4R37A 4G3QA 1T3DA 1J2ZA 3EH0A 3GUEA 4EAAA 3KWEA 2V0KA 4R7PA 4AAWA 3ECTA 3PMOA 3VBLA 1KK5A 1G95A 4HZDA 2XATA 3BSYA 3R0SA 1QRFA 1EWWA 1FWYA 3I3XA 4KPZA 2JF3A 1QRGA 1SSTA 4EQYA 2GGQA 2WLDA 1S80A 3BSSA 2WLGA 1MR7A 4E75A 2GGOA 3ST8A 4HUSA 5E3QA 1KHRA 2IC7A 3P47A 4M9CA 3T57A 3BXYA 2QIAA 3MC4A 3TK8A 4MYOA 4ISXA 4EABA 1QRLA 1YP3A 4KNRA 2OI6A 3V4EA 3FOQA 3D8VA 4N27A 5ADXU 2I5KA 3C8VA 4EA9A 3FWWA 4M98A 5U2KA 2VD4A 3FSXA 1KGQA 3KWDA 1L0SA 1MRLA 4N6AA 3VBIA 4DCLA 3TDTA 4EA7A 4E6TA 5F42A 3GQAA 4M2BA 4E6UA 3GQ8A 1G97A 2NPOA 1V3WA 5ADXV 3R1WA 3OH4A 4K6RA 4J18A 5DG3A 4J09A 2V0JA 3BSWA 2IU8A 4M28A 3GOSA 3GQ9A 3SUCA 3TISA 4E1KA 4EA8A 2V0HA 1LXAA 4EGGA 1HM9A 4G87A 3VNPA 1HV9A 4IHFA 1YP4A 1M8NA 5AFUU 3IGJA 2JF2A 3HJJA 5DEPA 1HM0A 3GQ7A 4G3PA 3OTMA 3Q1XA 1KK6A 2OEFA 5L6SA 3JQYA 4G3SA 1KK4A 3FSBA 3CJ8A 3BFPA 2V0LA 3FTTA 3HSQA 2ICYA 4H7OA 2RIJA 3FSYA 4M99A 3OH2A 5E3RA 1Z2FA 3SPTA 4E79A 3DHOA 4KQLA 1KRRA 1THJA 3R8YA 3OGZA 4KPXA 3R5AA 4N69A 3I3AA 1KRVA 3TV0A 1OCXA 1XATA 3BRKX 4MZUA 3VBPA 2P2OA 3R3RA 2W0VA 3OUPA 3OU9A 3D98A 2IU9A 3FSCA 1KQAA 3OW5A 4MFGA 3F1XA 2FKOA 4IHGA 1QREA 3TWDA 3VBJA 1XHDA 3IXCA 5DEMA 3R3IA 1QQ0A 5E3PA 2Q4JA 3P1BA 3SRTA 3NZ2A 1HM8A 3MQGA
chains in the Genus database with same CATH topology
2OI7A 1KGTA 4AC3A 1MR9A 1SSMA 2W0WA 5AFUV 2WLEA 2QKXA 2QIVX 4HCQA 1YP2A 1V67A 2OI5A 5L6VA 1TDTA 3R5BA 4R36A 3EG4A 4M2AA 2ICXA 3MQHA 4N6BA 3DK5A 3VBMA 3TIOA 2OEGA 2WLCA 1QRMA 3R5CA 3FS8A 4IHHA 4KNXA 4AA7A 4HZCA 3KWCA 1FXJA 2TDTA 2AQ9A 2V0IA 4FCEA 3VBKA 1KRUA 2VHEA 3R5DA 3EEVA 1SSQA 3DJ4A 3OTZA 3R2WA 3VBNA 2IUAA 3GVDA 2WLFA 1Z90A 4HURA 4R37A 4G3QA 1T3DA 1J2ZA 3EH0A 3GUEA 4EAAA 3KWEA 2V0KA 4R7PA 4AAWA 3ECTA 3PMOA 3VBLA 1KK5A 1G95A 4HZDA 2XATA 3BSYA 3R0SA 1QRFA 1FWYA 3I3XA 4KPZA 2JF3A 1QRGA 1SSTA 4EQYA 2GGQA 2WLDA 1S80A 3BSSA 2WLGA 1MR7A 4E75A 2GGOA 3ST8A 4HUSA 5E3QA 1KHRA 2IC7A 3P47A 4M9CA 3T57A 3BXYA 2QIAA 3MC4A 3TK8A 4MYOA 4ISXA 4EABA 1QRLA 1YP3A 4KNRA 2OI6A 3V4EA 3FOQA 3D8VA 4N27A 5ADXU 2I5KA 3C8VA 4EA9A 3FWWA 4M98A 5U2KA 2VD4A 3FSXA 1KGQA 3KWDA 4N6AA 1MRLA 3VBIA 4DCLA 4EA7A 3TDTA 4E6TA 5F42A 4M2BA 4E6UA 1G97A 2NPOA 1V3WA 5ADXV 3R1WA 4K6RA 4J18A 5DG3A 4J09A 2V0JA 3BSWA 2IU8A 4M28A 3GOSA 3TISA 4E1KA 4EA8A 2V0HA 1LXAA 4EGGA 1HM9A 4G87A 3VNPA 1HV9A 4IHFA 1YP4A 5AFUU 3IGJA 2JF2A 3HJJA 5DEPA 1HM0A 4G3PA 3OTMA 3Q1XA 1KK6A 2OEFA 5L6SA 3JQYA 4G3SA 1KK4A 3FSBA 3CJ8A 3BFPA 2V0LA 3FTTA 3HSQA 2ICYA 4H7OA 2RIJA 3FSYA 4M99A 5E3RA 3SPTA 4E79A 3DHOA 4KQLA 1KRRA 1THJA 3R8YA 4KPXA 3R5AA 4N69A 3I3AA 1KRVA 3TV0A 1OCXA 1XATA 3BRKX 4MZUA 3VBPA 2P2OA 3R3RA 2W0VA 3OUPA 3OU9A 3D98A 2IU9A 3FSCA 1KQAA 3OW5A 4MFGA 3F1XA 2FKOA 4IHGA 1QREA 3TWDA 3VBJA 1XHDA 3IXCA 5DEMA 3R3IA 1QQ0A 5E3PA 2Q4JA 3P1BA 3SRTA 3NZ2A 1HM8A 3MQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI7 A;  1KGT A;  4AC3 A;  1MR9 A;  1SSM A;  2W0W A;  5AFU V;  2WLE A;  2QKX A;  2QIV X;  4HCQ A;  1YP2 A;  1V67 A;  2OI5 A;  5L6V A;  1TDT A;  3R5B A;  4R36 A;  3EG4 A;  4M2A A;  2ICX A;  3MQH A;  4N6B A;  3DK5 A;  3VBM A;  3TIO A;  2OEG A;  2WLC A;  1QRM A;  3R5C A;  3FS8 A;  4IHH A;  4KNX A;  4AA7 A;  4HZC A;  3KWC A;  1FXJ A;  2TDT A;  2AQ9 A;  2V0I A;  4FCE A;  3VBK A;  1KRU A;  2VHE A;  3R5D A;  3EEV A;  1SSQ A;  3DJ4 A;  3OTZ A;  3R2W A;  3VBN A;  2IUA A;  3GVD A;  2WLF A;  1Z90 A;  4HUR A;  4R37 A;  4G3Q A;  1T3D A;  1J2Z A;  3EH0 A;  3GUE A;  4EAA A;  3KWE A;  2V0K A;  4R7P A;  4AAW A;  3ECT A;  3PMO A;  3VBL A;  1KK5 A;  1G95 A;  4HZD A;  2XAT A;  3BSY A;  3R0S A;  1QRF A;  1FWY A;  3I3X A;  4KPZ A;  2JF3 A;  1QRG A;  1SST A;  4EQY A;  2GGQ A;  2WLD A;  1S80 A;  3BSS A;  2WLG A;  1MR7 A;  4E75 A;  2GGO A;  3ST8 A;  4HUS A;  5E3Q A;  1KHR A;  2IC7 A;  3P47 A;  4M9C A;  3T57 A;  3BXY A;  2QIA A;  3MC4 A;  3TK8 A;  4MYO A;  4ISX A;  4EAB A;  1QRL A;  1YP3 A;  4KNR A;  2OI6 A;  3V4E A;  3FOQ A;  3D8V A;  4N27 A;  5ADX U;  2I5K A;  3C8V A;  4EA9 A;  3FWW A;  4M98 A;  5U2K A;  2VD4 A;  3FSX A;  1KGQ A;  3KWD A;  4N6A A;  1MRL A;  3VBI A;  4DCL A;  4EA7 A;  3TDT A;  4E6T A;  5F42 A;  4M2B A;  4E6U A;  1G97 A;  2NPO A;  1V3W A;  5ADX V;  3R1W A;  4K6R A;  4J18 A;  5DG3 A;  4J09 A;  2V0J A;  3BSW A;  2IU8 A;  4M28 A;  3GOS A;  3TIS A;  4E1K A;  4EA8 A;  2V0H A;  1LXA A;  4EGG A;  1HM9 A;  4G87 A;  3VNP A;  1HV9 A;  4IHF A;  1YP4 A;  5AFU U;  3IGJ A;  2JF2 A;  3HJJ A;  5DEP A;  1HM0 A;  4G3P A;  3OTM A;  3Q1X A;  1KK6 A;  2OEF A;  5L6S A;  3JQY A;  4G3S A;  1KK4 A;  3FSB A;  3CJ8 A;  3BFP A;  2V0L A;  3FTT A;  3HSQ A;  2ICY A;  4H7O A;  2RIJ A;  3FSY A;  4M99 A;  5E3R A;  3SPT A;  4E79 A;  3DHO A;  4KQL A;  1KRR A;  1THJ A;  3R8Y A;  4KPX A;  3R5A A;  4N69 A;  3I3A A;  1KRV A;  3TV0 A;  1OCX A;  1XAT A;  3BRK X;  4MZU A;  3VBP A;  2P2O A;  3R3R A;  2W0V A;  3OUP A;  3OU9 A;  3D98 A;  2IU9 A;  3FSC A;  1KQA A;  3OW5 A;  4MFG A;  3F1X A;  2FKO A;  4IHG A;  1QRE A;  3TWD A;  3VBJ A;  1XHD A;  3IXC A;  5DEM A;  3R3I A;  1QQ0 A;  5E3P A;  2Q4J A;  3P1B A;  3SRT A;  3NZ2 A;  1HM8 A;  3MQG A; 
#chains in the Genus database with same CATH topology
 2OI7 A;  1KGT A;  4AC3 A;  1MR9 A;  1SSM A;  2W0W A;  5AFU V;  3OH1 A;  2WLE A;  2QKX A;  2QIV X;  4HCQ A;  1YP2 A;  1V67 A;  2OI5 A;  5L6V A;  1TDT A;  3R5B A;  4R36 A;  3EG4 A;  4M2A A;  2ICX A;  3MQH A;  4N6B A;  3DK5 A;  3VBM A;  3TIO A;  2OEG A;  2WLC A;  1QRM A;  3R5C A;  3FS8 A;  4IHH A;  4KNX A;  4AA7 A;  4HZC A;  3KWC A;  1FXJ A;  2TDT A;  2AQ9 A;  2V0I A;  4FCE A;  3VBK A;  1KRU A;  3OH3 A;  2VHE A;  3R5D A;  3EEV A;  1SSQ A;  3DJ4 A;  3OTZ A;  3R2W A;  3VBN A;  3OH0 A;  2IUA A;  3GVD A;  2WLF A;  1Z90 A;  1N4I A;  4HUR A;  4R37 A;  4G3Q A;  1T3D A;  1J2Z A;  3EH0 A;  3GUE A;  4EAA A;  3KWE A;  2V0K A;  4R7P A;  4AAW A;  3ECT A;  3PMO A;  3VBL A;  1KK5 A;  1G95 A;  4HZD A;  2XAT A;  3BSY A;  3R0S A;  1QRF A;  1EWW A;  1FWY A;  3I3X A;  4KPZ A;  2JF3 A;  1QRG A;  1SST A;  4EQY A;  2GGQ A;  2WLD A;  1S80 A;  3BSS A;  2WLG A;  1MR7 A;  4E75 A;  2GGO A;  3ST8 A;  4HUS A;  5E3Q A;  1KHR A;  2IC7 A;  3P47 A;  4M9C A;  3T57 A;  3BXY A;  2QIA A;  3MC4 A;  3TK8 A;  4MYO A;  4ISX A;  4EAB A;  1QRL A;  1YP3 A;  4KNR A;  2OI6 A;  3V4E A;  3FOQ A;  3D8V A;  4N27 A;  5ADX U;  2I5K A;  3C8V A;  4EA9 A;  3FWW A;  4M98 A;  5U2K A;  2VD4 A;  3FSX A;  1KGQ A;  3KWD A;  1L0S A;  1MRL A;  4N6A A;  3VBI A;  4DCL A;  3TDT A;  4EA7 A;  4E6T A;  5F42 A;  3GQA A;  4M2B A;  4E6U A;  3GQ8 A;  1G97 A;  2NPO A;  1V3W A;  5ADX V;  3R1W A;  3OH4 A;  4K6R A;  4J18 A;  5DG3 A;  4J09 A;  2V0J A;  3BSW A;  2IU8 A;  4M28 A;  3GOS A;  3GQ9 A;  3SUC A;  3TIS A;  4E1K A;  4EA8 A;  2V0H A;  1LXA A;  4EGG A;  1HM9 A;  4G87 A;  3VNP A;  1HV9 A;  4IHF A;  1YP4 A;  1M8N A;  5AFU U;  3IGJ A;  2JF2 A;  3HJJ A;  5DEP A;  1HM0 A;  3GQ7 A;  4G3P A;  3OTM A;  3Q1X A;  1KK6 A;  2OEF A;  5L6S A;  3JQY A;  4G3S A;  1KK4 A;  3FSB A;  3CJ8 A;  3BFP A;  2V0L A;  3FTT A;  3HSQ A;  2ICY A;  4H7O A;  2RIJ A;  3FSY A;  4M99 A;  3OH2 A;  5E3R A;  1Z2F A;  3SPT A;  4E79 A;  3DHO A;  4KQL A;  1KRR A;  1THJ A;  3R8Y A;  3OGZ A;  4KPX A;  3R5A A;  4N69 A;  3I3A A;  1KRV A;  3TV0 A;  1OCX A;  1XAT A;  3BRK X;  4MZU A;  3VBP A;  2P2O A;  3R3R A;  2W0V A;  3OUP A;  3OU9 A;  3D98 A;  2IU9 A;  3FSC A;  1KQA A;  3OW5 A;  4MFG A;  3F1X A;  2FKO A;  4IHG A;  1QRE A;  3TWD A;  3VBJ A;  1XHD A;  3IXC A;  5DEM A;  3R3I A;  1QQ0 A;  5E3P A;  2Q4J A;  3P1B A;  3SRT A;  3NZ2 A;  1HM8 A;  3MQG A; 
#chains in the Genus database with same CATH homology
 2OI7 A;  1KGT A;  4AC3 A;  1MR9 A;  1SSM A;  2W0W A;  5AFU V;  2WLE A;  2QKX A;  2QIV X;  4HCQ A;  1YP2 A;  1V67 A;  2OI5 A;  5L6V A;  1TDT A;  3R5B A;  4R36 A;  3EG4 A;  4M2A A;  2ICX A;  3MQH A;  4N6B A;  3DK5 A;  3VBM A;  3TIO A;  2OEG A;  2WLC A;  1QRM A;  3R5C A;  3FS8 A;  4IHH A;  4KNX A;  4AA7 A;  4HZC A;  3KWC A;  1FXJ A;  2TDT A;  2AQ9 A;  2V0I A;  4FCE A;  3VBK A;  1KRU A;  2VHE A;  3R5D A;  3EEV A;  1SSQ A;  3DJ4 A;  3OTZ A;  3R2W A;  3VBN A;  2IUA A;  3GVD A;  2WLF A;  1Z90 A;  4HUR A;  4R37 A;  4G3Q A;  1T3D A;  1J2Z A;  3EH0 A;  3GUE A;  4EAA A;  3KWE A;  2V0K A;  4R7P A;  4AAW A;  3ECT A;  3PMO A;  3VBL A;  1KK5 A;  1G95 A;  4HZD A;  2XAT A;  3BSY A;  3R0S A;  1QRF A;  1FWY A;  3I3X A;  4KPZ A;  2JF3 A;  1QRG A;  1SST A;  4EQY A;  2GGQ A;  2WLD A;  1S80 A;  3BSS A;  2WLG A;  1MR7 A;  4E75 A;  2GGO A;  3ST8 A;  4HUS A;  5E3Q A;  1KHR A;  2IC7 A;  3P47 A;  4M9C A;  3T57 A;  3BXY A;  2QIA A;  3MC4 A;  3TK8 A;  4MYO A;  4ISX A;  4EAB A;  1QRL A;  1YP3 A;  4KNR A;  2OI6 A;  3V4E A;  3FOQ A;  3D8V A;  4N27 A;  5ADX U;  2I5K A;  3C8V A;  4EA9 A;  3FWW A;  4M98 A;  5U2K A;  2VD4 A;  3FSX A;  1KGQ A;  3KWD A;  4N6A A;  1MRL A;  3VBI A;  4DCL A;  4EA7 A;  3TDT A;  4E6T A;  5F42 A;  4M2B A;  4E6U A;  1G97 A;  2NPO A;  1V3W A;  5ADX V;  3R1W A;  4K6R A;  4J18 A;  5DG3 A;  4J09 A;  2V0J A;  3BSW A;  2IU8 A;  4M28 A;  3GOS A;  3TIS A;  4E1K A;  4EA8 A;  2V0H A;  1LXA A;  4EGG A;  1HM9 A;  4G87 A;  3VNP A;  1HV9 A;  4IHF A;  1YP4 A;  5AFU U;  3IGJ A;  2JF2 A;  3HJJ A;  5DEP A;  1HM0 A;  4G3P A;  3OTM A;  3Q1X A;  1KK6 A;  2OEF A;  5L6S A;  3JQY A;  4G3S A;  1KK4 A;  3FSB A;  3CJ8 A;  3BFP A;  2V0L A;  3FTT A;  3HSQ A;  2ICY A;  4H7O A;  2RIJ A;  3FSY A;  4M99 A;  5E3R A;  3SPT A;  4E79 A;  3DHO A;  4KQL A;  1KRR A;  1THJ A;  3R8Y A;  4KPX A;  3R5A A;  4N69 A;  3I3A A;  1KRV A;  3TV0 A;  1OCX A;  1XAT A;  3BRK X;  4MZU A;  3VBP A;  2P2O A;  3R3R A;  2W0V A;  3OUP A;  3OU9 A;  3D98 A;  2IU9 A;  3FSC A;  1KQA A;  3OW5 A;  4MFG A;  3F1X A;  2FKO A;  4IHG A;  1QRE A;  3TWD A;  3VBJ A;  1XHD A;  3IXC A;  5DEM A;  3R3I A;  1QQ0 A;  5E3P A;  2Q4J A;  3P1B A;  3SRT A;  3NZ2 A;  1HM8 A;  3MQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...