2WLDA

Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POLYSIALIC ACID O-ACETYLTRANSFERASE
publication title Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup y
total genus 77
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2wldA00
1MRLA 3BRKX 3HSQA 3HJJA 3BXYA 3DHOA 2NPOA 4M28A 5E3RA 3VBNA 4M2AA 4K6RA 3FSBA 3SRTA 4MYOA 2WLCA 3ST8A 4EAAA 1SSMA 1HM0A 1KK6A 3VBMA 2V0HA 1FWYA 4EQYA 3GVDA 5DEMA 2QIAA 2WLGA 4IHFA 3OTMA 1QRFA 4KPZA 3MQGA 1MR9A 1QRGA 1HM9A 1FXJA 3IGJA 3KWEA 4HZDA 4M2BA 2GGOA 2TDTA 3F1XA 4H7OA 3I3XA 5F42A 2P2OA 4E6TA 3FWWA 4HZCA 4HUSA 1YP4A 2JF2A 3BFPA 4N69A 1MR7A 1YP3A 2V0IA 2ICYA 3KWCA 3EEVA 3SPTA 4G3QA 4AA7A 2RIJA 5DEPA 1J2ZA 1SSTA 4MZUA 3PMOA 1QRLA 1XHDA 2I5KA 2VHEA 3VBLA 2W0VA 1KQAA 1G97A 1YP2A 4R36A 1KRRA 1SSQA 3Q1XA 3P47A 4KNRA 4KPXA 3OU9A 3R0SA 3R8YA 1QRMA 3D8VA 2ICXA 4EA8A 3FSXA 1KGTA 2W0WA 3FSCA 3FTTA 3VBIA 2OI5A 4FCEA 5DG3A 1OCXA 2OEGA 2OI6A 3FS8A 4IHGA 4ISXA 3EG4A 3EH0A 3KWDA 4M9CA 3D98A 2Q4JA 2WLFA 3MC4A 3V4EA 3TIOA 3TISA 4MFGA 1HM8A 4R37A 3BSSA 2WLEA 1QREA 3R1WA 3TWDA 4E1KA 3JQYA 3VBJA 3IXCA 1KRUA 3DJ4A 4E75A 1T3DA 2OI7A 3C8VA 5U2KA 3VBKA 4DCLA 3BSWA 5E3QA 3R3IA 3GUEA 3VNPA 4EABA 1V3WA 1Z90A 5AFUV 2IU8A 4HURA 2WLDA 4HCQA 4J18A 3I3AA 5L6SA 2V0LA 2IU9A 3R5BA 3CJ8A 1KGQA 3P1BA 2GGQA 3DK5A 3OTZA 3R2WA 3R5AA 1THJA 5L6VA 2V0JA 1S80A 3TK8A 2AQ9A 3TV0A 5ADXU 4KQLA 4AC3A 4G3SA 3NZ2A 4IHHA 4M98A 4M99A 5AFUU 3ECTA 3FOQA 4N6AA 1HV9A 2FKOA 4E6UA 4R7PA 4EGGA 1TDTA 2XATA 3MQHA 3R5CA 3OW5A 3TDTA 4AAWA 3FSYA 3GOSA 4N27A 5ADXV 2OEFA 1KRVA 2V0KA 2VD4A 3R5DA 1KK5A 3T57A 4EA7A 2QIVX 3VBPA 4N6BA 4G87A 2JF3A 4E79A 3BSYA 3OUPA 1V67A 4EA9A 2IUAA 5E3PA 2IC7A 1QQ0A 2QKXA 3R3RA 4KNXA 1G95A 1LXAA 4G3PA 1XATA 1KK4A 4J09A 1KHRA
chains in the Genus database with same CATH superfamily
1MRLA 3BRKX 3HSQA 3HJJA 3BXYA 3DHOA 2NPOA 4M28A 5E3RA 3VBNA 4M2AA 4K6RA 3FSBA 1EWWA 3SRTA 4MYOA 2WLCA 3ST8A 4EAAA 1SSMA 1HM0A 1KK6A 3VBMA 2V0HA 1FWYA 3SUCA 4EQYA 3GVDA 1Z2FA 5DEMA 2QIAA 2WLGA 4IHFA 3OTMA 1QRFA 4KPZA 3MQGA 1MR9A 1QRGA 1HM9A 1FXJA 3IGJA 3KWEA 4HZDA 4M2BA 2GGOA 3OH2A 2TDTA 3F1XA 4H7OA 3I3XA 5F42A 2P2OA 4E6TA 3FWWA 4HZCA 4HUSA 1YP4A 2JF2A 3BFPA 4N69A 1MR7A 1YP3A 2V0IA 2ICYA 3KWCA 3EEVA 3SPTA 4G3QA 4AA7A 2RIJA 5DEPA 1J2ZA 1SSTA 4MZUA 3PMOA 1QRLA 1N4IA 1XHDA 2I5KA 2VHEA 3VBLA 2W0VA 1KQAA 1G97A 1YP2A 4R36A 1KRRA 3OH3A 1SSQA 3Q1XA 3P47A 3GQ7A 4KNRA 4KPXA 3OU9A 3R0SA 3R8YA 1QRMA 3D8VA 2ICXA 4EA8A 3FSXA 1KGTA 2W0WA 3FSCA 3OH4A 3FTTA 3VBIA 2OI5A 4FCEA 5DG3A 1OCXA 2OEGA 2OI6A 3FS8A 4IHGA 4ISXA 3EG4A 3EH0A 3KWDA 4M9CA 3D98A 2Q4JA 2WLFA 3MC4A 3V4EA 1L0SA 3TIOA 3TISA 4MFGA 1HM8A 4R37A 3BSSA 2WLEA 1QREA 3R1WA 3TWDA 4E1KA 3JQYA 3VBJA 3IXCA 1KRUA 3DJ4A 4E75A 1T3DA 2OI7A 3C8VA 5U2KA 3VBKA 4DCLA 3BSWA 5E3QA 3R3IA 3GUEA 3VNPA 4EABA 1V3WA 1Z90A 5AFUV 3GQ8A 2IU8A 4HURA 2WLDA 4HCQA 4J18A 3I3AA 5L6SA 2V0LA 1M8NA 2IU9A 3R5BA 3OH1A 3CJ8A 1KGQA 3P1BA 2GGQA 3DK5A 3OTZA 3R2WA 3R5AA 1THJA 5L6VA 2V0JA 1S80A 3TK8A 2AQ9A 3TV0A 5ADXU 4KQLA 4AC3A 4G3SA 3NZ2A 4IHHA 4M98A 4M99A 3GQ9A 5AFUU 3ECTA 3FOQA 4N6AA 1HV9A 2FKOA 4E6UA 4R7PA 4EGGA 1TDTA 2XATA 3MQHA 3R5CA 3OW5A 3TDTA 4AAWA 3FSYA 3GOSA 3GQAA 4N27A 5ADXV 2OEFA 1KRVA 2V0KA 2VD4A 3R5DA 1KK5A 3T57A 4EA7A 2QIVX 3VBPA 4N6BA 4G87A 2JF3A 4E79A 3BSYA 3OUPA 1V67A 3OH0A 4EA9A 2IUAA 5E3PA 2IC7A 1QQ0A 2QKXA 3R3RA 4KNXA 1G95A 1LXAA 4G3PA 1XATA 1KK4A 4J09A 3OGZA 1KHRA
chains in the Genus database with same CATH topology
1MRLA 3BRKX 3HSQA 3HJJA 3BXYA 3DHOA 2NPOA 4M28A 5E3RA 3VBNA 4M2AA 4K6RA 3FSBA 3SRTA 4MYOA 2WLCA 3ST8A 4EAAA 1SSMA 1HM0A 1KK6A 3VBMA 2V0HA 1FWYA 4EQYA 3GVDA 5DEMA 2QIAA 2WLGA 4IHFA 3OTMA 1QRFA 4KPZA 3MQGA 1MR9A 1QRGA 1HM9A 1FXJA 3IGJA 3KWEA 4HZDA 4M2BA 2GGOA 2TDTA 3F1XA 4H7OA 3I3XA 5F42A 2P2OA 4E6TA 3FWWA 4HZCA 4HUSA 1YP4A 2JF2A 3BFPA 4N69A 1MR7A 1YP3A 2V0IA 2ICYA 3KWCA 3EEVA 3SPTA 4G3QA 4AA7A 2RIJA 5DEPA 1J2ZA 1SSTA 4MZUA 3PMOA 1QRLA 1XHDA 2I5KA 2VHEA 3VBLA 2W0VA 1KQAA 1G97A 1YP2A 4R36A 1KRRA 1SSQA 3Q1XA 3P47A 4KNRA 4KPXA 3OU9A 3R0SA 3R8YA 1QRMA 3D8VA 2ICXA 4EA8A 3FSXA 1KGTA 2W0WA 3FSCA 3FTTA 3VBIA 2OI5A 4FCEA 5DG3A 1OCXA 2OEGA 2OI6A 3FS8A 4IHGA 4ISXA 3EG4A 3EH0A 3KWDA 4M9CA 3D98A 2Q4JA 2WLFA 3MC4A 3V4EA 3TIOA 3TISA 4MFGA 1HM8A 4R37A 3BSSA 2WLEA 1QREA 3R1WA 3TWDA 4E1KA 3JQYA 3VBJA 3IXCA 1KRUA 3DJ4A 4E75A 1T3DA 2OI7A 3C8VA 5U2KA 3VBKA 4DCLA 3BSWA 5E3QA 3R3IA 3GUEA 3VNPA 4EABA 1V3WA 1Z90A 5AFUV 2IU8A 4HURA 2WLDA 4HCQA 4J18A 3I3AA 5L6SA 2V0LA 2IU9A 3R5BA 3CJ8A 1KGQA 3P1BA 2GGQA 3DK5A 3OTZA 3R2WA 3R5AA 1THJA 5L6VA 2V0JA 1S80A 3TK8A 2AQ9A 3TV0A 5ADXU 4KQLA 4AC3A 4G3SA 3NZ2A 4IHHA 4M98A 4M99A 5AFUU 3ECTA 3FOQA 4N6AA 1HV9A 2FKOA 4E6UA 4R7PA 4EGGA 1TDTA 2XATA 3MQHA 3R5CA 3OW5A 3TDTA 4AAWA 3FSYA 3GOSA 4N27A 5ADXV 2OEFA 1KRVA 2V0KA 2VD4A 3R5DA 1KK5A 3T57A 4EA7A 2QIVX 3VBPA 4N6BA 4G87A 2JF3A 4E79A 3BSYA 3OUPA 1V67A 4EA9A 2IUAA 5E3PA 2IC7A 1QQ0A 2QKXA 3R3RA 4KNXA 1G95A 1LXAA 4G3PA 1XATA 1KK4A 4J09A 1KHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRL A;  3BRK X;  3HSQ A;  3HJJ A;  3BXY A;  3DHO A;  2NPO A;  4M28 A;  5E3R A;  3VBN A;  4M2A A;  4K6R A;  3FSB A;  3SRT A;  4MYO A;  2WLC A;  3ST8 A;  4EAA A;  1SSM A;  1HM0 A;  1KK6 A;  3VBM A;  2V0H A;  1FWY A;  4EQY A;  3GVD A;  5DEM A;  2QIA A;  2WLG A;  4IHF A;  3OTM A;  1QRF A;  4KPZ A;  3MQG A;  1MR9 A;  1QRG A;  1HM9 A;  1FXJ A;  3IGJ A;  3KWE A;  4HZD A;  4M2B A;  2GGO A;  2TDT A;  3F1X A;  4H7O A;  3I3X A;  5F42 A;  2P2O A;  4E6T A;  3FWW A;  4HZC A;  4HUS A;  1YP4 A;  2JF2 A;  3BFP A;  4N69 A;  1MR7 A;  1YP3 A;  2V0I A;  2ICY A;  3KWC A;  3EEV A;  3SPT A;  4G3Q A;  4AA7 A;  2RIJ A;  5DEP A;  1J2Z A;  1SST A;  4MZU A;  3PMO A;  1QRL A;  1XHD A;  2I5K A;  2VHE A;  3VBL A;  2W0V A;  1KQA A;  1G97 A;  1YP2 A;  4R36 A;  1KRR A;  1SSQ A;  3Q1X A;  3P47 A;  4KNR A;  4KPX A;  3OU9 A;  3R0S A;  3R8Y A;  1QRM A;  3D8V A;  2ICX A;  4EA8 A;  3FSX A;  1KGT A;  2W0W A;  3FSC A;  3FTT A;  3VBI A;  2OI5 A;  4FCE A;  5DG3 A;  1OCX A;  2OEG A;  2OI6 A;  3FS8 A;  4IHG A;  4ISX A;  3EG4 A;  3EH0 A;  3KWD A;  4M9C A;  3D98 A;  2Q4J A;  2WLF A;  3MC4 A;  3V4E A;  3TIO A;  3TIS A;  4MFG A;  1HM8 A;  4R37 A;  3BSS A;  2WLE A;  1QRE A;  3R1W A;  3TWD A;  4E1K A;  3JQY A;  3VBJ A;  3IXC A;  1KRU A;  3DJ4 A;  4E75 A;  1T3D A;  2OI7 A;  3C8V A;  5U2K A;  3VBK A;  4DCL A;  3BSW A;  5E3Q A;  3R3I A;  3GUE A;  3VNP A;  4EAB A;  1V3W A;  1Z90 A;  5AFU V;  2IU8 A;  4HUR A;  2WLD A;  4HCQ A;  4J18 A;  3I3A A;  5L6S A;  2V0L A;  2IU9 A;  3R5B A;  3CJ8 A;  1KGQ A;  3P1B A;  2GGQ A;  3DK5 A;  3OTZ A;  3R2W A;  3R5A A;  1THJ A;  5L6V A;  2V0J A;  1S80 A;  3TK8 A;  2AQ9 A;  3TV0 A;  5ADX U;  4KQL A;  4AC3 A;  4G3S A;  3NZ2 A;  4IHH A;  4M98 A;  4M99 A;  5AFU U;  3ECT A;  3FOQ A;  4N6A A;  1HV9 A;  2FKO A;  4E6U A;  4R7P A;  4EGG A;  1TDT A;  2XAT A;  3MQH A;  3R5C A;  3OW5 A;  3TDT A;  4AAW A;  3FSY A;  3GOS A;  4N27 A;  5ADX V;  2OEF A;  1KRV A;  2V0K A;  2VD4 A;  3R5D A;  1KK5 A;  3T57 A;  4EA7 A;  2QIV X;  3VBP A;  4N6B A;  4G87 A;  2JF3 A;  4E79 A;  3BSY A;  3OUP A;  1V67 A;  4EA9 A;  2IUA A;  5E3P A;  2IC7 A;  1QQ0 A;  2QKX A;  3R3R A;  4KNX A;  1G95 A;  1LXA A;  4G3P A;  1XAT A;  1KK4 A;  4J09 A;  1KHR A; 
#chains in the Genus database with same CATH topology
 1MRL A;  3BRK X;  3HSQ A;  3HJJ A;  3BXY A;  3DHO A;  2NPO A;  4M28 A;  5E3R A;  3VBN A;  4M2A A;  4K6R A;  3FSB A;  1EWW A;  3SRT A;  4MYO A;  2WLC A;  3ST8 A;  4EAA A;  1SSM A;  1HM0 A;  1KK6 A;  3VBM A;  2V0H A;  1FWY A;  3SUC A;  4EQY A;  3GVD A;  1Z2F A;  5DEM A;  2QIA A;  2WLG A;  4IHF A;  3OTM A;  1QRF A;  4KPZ A;  3MQG A;  1MR9 A;  1QRG A;  1HM9 A;  1FXJ A;  3IGJ A;  3KWE A;  4HZD A;  4M2B A;  2GGO A;  3OH2 A;  2TDT A;  3F1X A;  4H7O A;  3I3X A;  5F42 A;  2P2O A;  4E6T A;  3FWW A;  4HZC A;  4HUS A;  1YP4 A;  2JF2 A;  3BFP A;  4N69 A;  1MR7 A;  1YP3 A;  2V0I A;  2ICY A;  3KWC A;  3EEV A;  3SPT A;  4G3Q A;  4AA7 A;  2RIJ A;  5DEP A;  1J2Z A;  1SST A;  4MZU A;  3PMO A;  1QRL A;  1N4I A;  1XHD A;  2I5K A;  2VHE A;  3VBL A;  2W0V A;  1KQA A;  1G97 A;  1YP2 A;  4R36 A;  1KRR A;  3OH3 A;  1SSQ A;  3Q1X A;  3P47 A;  3GQ7 A;  4KNR A;  4KPX A;  3OU9 A;  3R0S A;  3R8Y A;  1QRM A;  3D8V A;  2ICX A;  4EA8 A;  3FSX A;  1KGT A;  2W0W A;  3FSC A;  3OH4 A;  3FTT A;  3VBI A;  2OI5 A;  4FCE A;  5DG3 A;  1OCX A;  2OEG A;  2OI6 A;  3FS8 A;  4IHG A;  4ISX A;  3EG4 A;  3EH0 A;  3KWD A;  4M9C A;  3D98 A;  2Q4J A;  2WLF A;  3MC4 A;  3V4E A;  1L0S A;  3TIO A;  3TIS A;  4MFG A;  1HM8 A;  4R37 A;  3BSS A;  2WLE A;  1QRE A;  3R1W A;  3TWD A;  4E1K A;  3JQY A;  3VBJ A;  3IXC A;  1KRU A;  3DJ4 A;  4E75 A;  1T3D A;  2OI7 A;  3C8V A;  5U2K A;  3VBK A;  4DCL A;  3BSW A;  5E3Q A;  3R3I A;  3GUE A;  3VNP A;  4EAB A;  1V3W A;  1Z90 A;  5AFU V;  3GQ8 A;  2IU8 A;  4HUR A;  2WLD A;  4HCQ A;  4J18 A;  3I3A A;  5L6S A;  2V0L A;  1M8N A;  2IU9 A;  3R5B A;  3OH1 A;  3CJ8 A;  1KGQ A;  3P1B A;  2GGQ A;  3DK5 A;  3OTZ A;  3R2W A;  3R5A A;  1THJ A;  5L6V A;  2V0J A;  1S80 A;  3TK8 A;  2AQ9 A;  3TV0 A;  5ADX U;  4KQL A;  4AC3 A;  4G3S A;  3NZ2 A;  4IHH A;  4M98 A;  4M99 A;  3GQ9 A;  5AFU U;  3ECT A;  3FOQ A;  4N6A A;  1HV9 A;  2FKO A;  4E6U A;  4R7P A;  4EGG A;  1TDT A;  2XAT A;  3MQH A;  3R5C A;  3OW5 A;  3TDT A;  4AAW A;  3FSY A;  3GOS A;  3GQA A;  4N27 A;  5ADX V;  2OEF A;  1KRV A;  2V0K A;  2VD4 A;  3R5D A;  1KK5 A;  3T57 A;  4EA7 A;  2QIV X;  3VBP A;  4N6B A;  4G87 A;  2JF3 A;  4E79 A;  3BSY A;  3OUP A;  1V67 A;  3OH0 A;  4EA9 A;  2IUA A;  5E3P A;  2IC7 A;  1QQ0 A;  2QKX A;  3R3R A;  4KNX A;  1G95 A;  1LXA A;  4G3P A;  1XAT A;  1KK4 A;  4J09 A;  3OGZ A;  1KHR A; 
#chains in the Genus database with same CATH homology
 1MRL A;  3BRK X;  3HSQ A;  3HJJ A;  3BXY A;  3DHO A;  2NPO A;  4M28 A;  5E3R A;  3VBN A;  4M2A A;  4K6R A;  3FSB A;  3SRT A;  4MYO A;  2WLC A;  3ST8 A;  4EAA A;  1SSM A;  1HM0 A;  1KK6 A;  3VBM A;  2V0H A;  1FWY A;  4EQY A;  3GVD A;  5DEM A;  2QIA A;  2WLG A;  4IHF A;  3OTM A;  1QRF A;  4KPZ A;  3MQG A;  1MR9 A;  1QRG A;  1HM9 A;  1FXJ A;  3IGJ A;  3KWE A;  4HZD A;  4M2B A;  2GGO A;  2TDT A;  3F1X A;  4H7O A;  3I3X A;  5F42 A;  2P2O A;  4E6T A;  3FWW A;  4HZC A;  4HUS A;  1YP4 A;  2JF2 A;  3BFP A;  4N69 A;  1MR7 A;  1YP3 A;  2V0I A;  2ICY A;  3KWC A;  3EEV A;  3SPT A;  4G3Q A;  4AA7 A;  2RIJ A;  5DEP A;  1J2Z A;  1SST A;  4MZU A;  3PMO A;  1QRL A;  1XHD A;  2I5K A;  2VHE A;  3VBL A;  2W0V A;  1KQA A;  1G97 A;  1YP2 A;  4R36 A;  1KRR A;  1SSQ A;  3Q1X A;  3P47 A;  4KNR A;  4KPX A;  3OU9 A;  3R0S A;  3R8Y A;  1QRM A;  3D8V A;  2ICX A;  4EA8 A;  3FSX A;  1KGT A;  2W0W A;  3FSC A;  3FTT A;  3VBI A;  2OI5 A;  4FCE A;  5DG3 A;  1OCX A;  2OEG A;  2OI6 A;  3FS8 A;  4IHG A;  4ISX A;  3EG4 A;  3EH0 A;  3KWD A;  4M9C A;  3D98 A;  2Q4J A;  2WLF A;  3MC4 A;  3V4E A;  3TIO A;  3TIS A;  4MFG A;  1HM8 A;  4R37 A;  3BSS A;  2WLE A;  1QRE A;  3R1W A;  3TWD A;  4E1K A;  3JQY A;  3VBJ A;  3IXC A;  1KRU A;  3DJ4 A;  4E75 A;  1T3D A;  2OI7 A;  3C8V A;  5U2K A;  3VBK A;  4DCL A;  3BSW A;  5E3Q A;  3R3I A;  3GUE A;  3VNP A;  4EAB A;  1V3W A;  1Z90 A;  5AFU V;  2IU8 A;  4HUR A;  2WLD A;  4HCQ A;  4J18 A;  3I3A A;  5L6S A;  2V0L A;  2IU9 A;  3R5B A;  3CJ8 A;  1KGQ A;  3P1B A;  2GGQ A;  3DK5 A;  3OTZ A;  3R2W A;  3R5A A;  1THJ A;  5L6V A;  2V0J A;  1S80 A;  3TK8 A;  2AQ9 A;  3TV0 A;  5ADX U;  4KQL A;  4AC3 A;  4G3S A;  3NZ2 A;  4IHH A;  4M98 A;  4M99 A;  5AFU U;  3ECT A;  3FOQ A;  4N6A A;  1HV9 A;  2FKO A;  4E6U A;  4R7P A;  4EGG A;  1TDT A;  2XAT A;  3MQH A;  3R5C A;  3OW5 A;  3TDT A;  4AAW A;  3FSY A;  3GOS A;  4N27 A;  5ADX V;  2OEF A;  1KRV A;  2V0K A;  2VD4 A;  3R5D A;  1KK5 A;  3T57 A;  4EA7 A;  2QIV X;  3VBP A;  4N6B A;  4G87 A;  2JF3 A;  4E79 A;  3BSY A;  3OUP A;  1V67 A;  4EA9 A;  2IUA A;  5E3P A;  2IC7 A;  1QQ0 A;  2QKX A;  3R3R A;  4KNX A;  1G95 A;  1LXA A;  4G3P A;  1XAT A;  1KK4 A;  4J09 A;  1KHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...