2WLDA

Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYSIALIC ACID O-ACETYLTRANSFERASE
publication title Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup y
molecule tags Transferase
total genus 77
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2wldA00
5E3QA 4FCEA 4KQLA 4M99A 5E3PA 2WLGA 3R3RA 1KK5A 3R1WA 1FWYA 2IUAA 3EEVA 4EA9A 4HUSA 2IC7A 5ADXU 5DEPA 1V3WA 2W0VA 3D98A 2OI5A 3MQHA 4J18A 2XATA 3DK5A 4KPXA 4EAAA 1YP3A 3P1BA 3MC4A 2V0IA 3VNPA 4G87A 4IHHA 3GVDA 1KK4A 1MR9A 4G3QA 2I5KA 2WLCA 5F42A 3IGJA 2V0LA 3R5CA 3TDTA 3KWCA 3FWWA 2V0HA 3VBNA 4G3SA 4E79A 2OEGA 2QKXA 3TWDA 3T57A 1KQAA 3R8YA 3FTTA 4J09A 3BRKX 4EABA 3DHOA 3BSSA 1S80A 3HJJA 2WLFA 4E6TA 4E6UA 5AFUU 1V67A 4EA8A 4MYOA 4E1KA 3DJ4A 2JF2A 3ST8A 4AAWA 2QIAA 3VBMA 3MQGA 4MZUA 5DEMA 3HSQA 4HCQA 2ICXA 4MFGA 5DG3A 1HV9A 3TK8A 1FXJA 4R7PA 3NZ2A 1KHRA 2GGOA 3I3XA 4M2AA 1J2ZA 3R5BA 3OU9A 4G3PA 4H7OA 1LXAA 3JQYA 2AQ9A 3BFPA 1KGTA 3TISA 4ISXA 3Q1XA 3F1XA 3OW5A 4EQYA 2RIJA 4EGGA 4M98A 2V0JA 5U2KA 2OEFA 1TDTA 1YP4A 4HZDA 4N6BA 3VBKA 1G97A 3SRTA 2VD4A 3BSWA 1YP2A 4AC3A 4DCLA 3EH0A 4HZCA 3PMOA 3VBPA 1HM9A 4KPZA 4M2BA 1THJA 1QRGA 3I3AA 1SSQA 4KNRA 3ECTA 3FSXA 2ICYA 3OUPA 2IU9A 3P47A 4N27A 1SSTA 3KWDA 5L6SA 1MRLA 2W0WA 3EG4A 1T3DA 3VBLA 4M28A 2WLEA 3R2WA 3R5DA 1OCXA 3VBIA 1QRMA 1MR7A 5ADXV 1QRLA 1SSMA 3FS8A 1KK6A 4R36A 1HM0A 1KRRA 3V4EA 3FSYA 2OI7A 3OTMA 2OI6A 2FKOA 2GGQA 1QQ0A 2JF3A 3FOQA 2V0KA 1KRUA 5L6VA 1HM8A 2IU8A 1XATA 1KRVA 2TDTA 3R0SA 1QREA 1Z90A 4HURA 3CJ8A 3D8VA 3OTZA 3BSYA 1G95A 4EA7A 2QIVX 5E3RA 2NPOA 1QRFA 3BXYA 4IHFA 4R37A 3R5AA 1KGQA 1XHDA 4N6AA 3SPTA 3VBJA 4M9CA 2Q4JA 3C8VA 3GOSA 4N69A 4IHGA 2WLDA 3R3IA 3KWEA 2P2OA 5AFUV 3TV0A 3GUEA 3IXCA 4E75A 2VHEA 4KNXA 3TIOA 3FSCA 4K6RA 3FSBA 4AA7A
chains in the Genus database with same CATH superfamily
5E3QA 4FCEA 4KQLA 4M99A 5E3PA 2WLGA 3R3RA 1KK5A 3R1WA 1FWYA 2IUAA 3EEVA 4EA9A 4HUSA 2IC7A 5ADXU 5DEPA 1V3WA 2W0VA 3D98A 2OI5A 3MQHA 3SUCA 4J18A 2XATA 3DK5A 4KPXA 4EAAA 1YP3A 3P1BA 3MC4A 2V0IA 3VNPA 4G87A 4IHHA 3GVDA 1KK4A 1L0SA 1MR9A 2I5KA 2WLCA 4G3QA 5F42A 3IGJA 2V0LA 3R5CA 3TDTA 3KWCA 3FWWA 3OGZA 2V0HA 3VBNA 4G3SA 4E79A 2OEGA 2QKXA 3TWDA 3T57A 1KQAA 3R8YA 3FTTA 4J09A 3BRKX 4EABA 3DHOA 3BSSA 1S80A 3HJJA 2WLFA 4E6TA 4E6UA 5AFUU 1V67A 4EA8A 4MYOA 3GQ9A 4E1KA 3DJ4A 2JF2A 3ST8A 4AAWA 2QIAA 3VBMA 3MQGA 4MZUA 5DEMA 3HSQA 4HCQA 2ICXA 4MFGA 5DG3A 1HV9A 3TK8A 1FXJA 4R7PA 3NZ2A 1KHRA 1N4IA 2GGOA 3I3XA 4M2AA 1J2ZA 3R5BA 3OU9A 4G3PA 3GQAA 4H7OA 1LXAA 3JQYA 2AQ9A 3BFPA 1KGTA 3TISA 4ISXA 3Q1XA 3F1XA 3OW5A 4EQYA 2RIJA 4EGGA 4M98A 2V0JA 5U2KA 2OEFA 1TDTA 1YP4A 4HZDA 4N6BA 3VBKA 1G97A 3SRTA 2VD4A 3BSWA 1YP2A 1Z2FA 4AC3A 3OH0A 4DCLA 3EH0A 4HZCA 3PMOA 3VBPA 1HM9A 4KPZA 3OH2A 4M2BA 1THJA 1QRGA 3I3AA 1SSQA 4KNRA 3ECTA 3FSXA 2ICYA 3OUPA 2IU9A 3P47A 4N27A 1SSTA 3KWDA 5L6SA 1MRLA 2W0WA 3EG4A 1T3DA 3VBLA 4M28A 2WLEA 3R2WA 3R5DA 1OCXA 3VBIA 3GQ7A 1QRMA 1MR7A 3OH4A 1QRLA 1SSMA 3FS8A 1KK6A 4R36A 5ADXV 3OH3A 1HM0A 1KRRA 3V4EA 3FSYA 2OI7A 3OTMA 2OI6A 2FKOA 2GGQA 3OH1A 1QQ0A 2JF3A 3FOQA 2V0KA 1KRUA 5L6VA 1HM8A 2IU8A 1XATA 1KRVA 2TDTA 3R0SA 1QREA 1Z90A 3GQ8A 4HURA 3CJ8A 3D8VA 3OTZA 3BSYA 1G95A 4EA7A 2QIVX 5E3RA 2NPOA 1QRFA 3BXYA 4IHFA 4R37A 1M8NA 3R5AA 1KGQA 1XHDA 4N6AA 3SPTA 3VBJA 4M9CA 2Q4JA 3C8VA 3GOSA 4N69A 4IHGA 2WLDA 3R3IA 3KWEA 2P2OA 5AFUV 3TV0A 3GUEA 3IXCA 4E75A 2VHEA 4KNXA 3TIOA 3FSCA 4K6RA 3FSBA 4AA7A 1EWWA
chains in the Genus database with same CATH topology
5E3QA 4FCEA 4KQLA 4M99A 5E3PA 2WLGA 3R3RA 1KK5A 3R1WA 1FWYA 2IUAA 3EEVA 4EA9A 4HUSA 2IC7A 5ADXU 5DEPA 1V3WA 2W0VA 3D98A 2OI5A 3MQHA 4J18A 2XATA 3DK5A 4KPXA 4EAAA 1YP3A 3P1BA 3MC4A 2V0IA 3VNPA 4G87A 4IHHA 3GVDA 1KK4A 1MR9A 4G3QA 2I5KA 2WLCA 5F42A 3IGJA 2V0LA 3R5CA 3TDTA 3KWCA 3FWWA 2V0HA 3VBNA 4G3SA 4E79A 2OEGA 2QKXA 3TWDA 3T57A 1KQAA 3R8YA 3FTTA 4J09A 3BRKX 4EABA 3DHOA 3BSSA 1S80A 3HJJA 2WLFA 4E6TA 4E6UA 5AFUU 1V67A 4EA8A 4MYOA 4E1KA 3DJ4A 2JF2A 3ST8A 4AAWA 2QIAA 3VBMA 3MQGA 4MZUA 5DEMA 3HSQA 4HCQA 2ICXA 4MFGA 5DG3A 1HV9A 3TK8A 1FXJA 4R7PA 3NZ2A 1KHRA 2GGOA 3I3XA 4M2AA 1J2ZA 3R5BA 3OU9A 4G3PA 4H7OA 1LXAA 3JQYA 2AQ9A 3BFPA 1KGTA 3TISA 4ISXA 3Q1XA 3F1XA 3OW5A 4EQYA 2RIJA 4EGGA 4M98A 2V0JA 5U2KA 2OEFA 1TDTA 1YP4A 4HZDA 4N6BA 3VBKA 1G97A 3SRTA 2VD4A 3BSWA 1YP2A 4AC3A 4DCLA 3EH0A 4HZCA 3PMOA 3VBPA 1HM9A 4KPZA 4M2BA 1THJA 1QRGA 3I3AA 1SSQA 4KNRA 3ECTA 3FSXA 2ICYA 3OUPA 2IU9A 3P47A 4N27A 1SSTA 3KWDA 5L6SA 1MRLA 2W0WA 3EG4A 1T3DA 3VBLA 4M28A 2WLEA 3R2WA 3R5DA 1OCXA 3VBIA 1QRMA 1MR7A 5ADXV 1QRLA 1SSMA 3FS8A 1KK6A 4R36A 1HM0A 1KRRA 3V4EA 3FSYA 2OI7A 3OTMA 2OI6A 2FKOA 2GGQA 1QQ0A 2JF3A 3FOQA 2V0KA 1KRUA 5L6VA 1HM8A 2IU8A 1XATA 1KRVA 2TDTA 3R0SA 1QREA 1Z90A 4HURA 3CJ8A 3D8VA 3OTZA 3BSYA 1G95A 4EA7A 2QIVX 5E3RA 2NPOA 1QRFA 3BXYA 4IHFA 4R37A 3R5AA 1KGQA 1XHDA 4N6AA 3SPTA 3VBJA 4M9CA 2Q4JA 3C8VA 3GOSA 4N69A 4IHGA 2WLDA 3R3IA 3KWEA 2P2OA 5AFUV 3TV0A 3GUEA 3IXCA 4E75A 2VHEA 4KNXA 3TIOA 3FSCA 4K6RA 3FSBA 4AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3Q A;  4FCE A;  4KQL A;  4M99 A;  5E3P A;  2WLG A;  3R3R A;  1KK5 A;  3R1W A;  1FWY A;  2IUA A;  3EEV A;  4EA9 A;  4HUS A;  2IC7 A;  5ADX U;  5DEP A;  1V3W A;  2W0V A;  3D98 A;  2OI5 A;  3MQH A;  4J18 A;  2XAT A;  3DK5 A;  4KPX A;  4EAA A;  1YP3 A;  3P1B A;  3MC4 A;  2V0I A;  3VNP A;  4G87 A;  4IHH A;  3GVD A;  1KK4 A;  1MR9 A;  4G3Q A;  2I5K A;  2WLC A;  5F42 A;  3IGJ A;  2V0L A;  3R5C A;  3TDT A;  3KWC A;  3FWW A;  2V0H A;  3VBN A;  4G3S A;  4E79 A;  2OEG A;  2QKX A;  3TWD A;  3T57 A;  1KQA A;  3R8Y A;  3FTT A;  4J09 A;  3BRK X;  4EAB A;  3DHO A;  3BSS A;  1S80 A;  3HJJ A;  2WLF A;  4E6T A;  4E6U A;  5AFU U;  1V67 A;  4EA8 A;  4MYO A;  4E1K A;  3DJ4 A;  2JF2 A;  3ST8 A;  4AAW A;  2QIA A;  3VBM A;  3MQG A;  4MZU A;  5DEM A;  3HSQ A;  4HCQ A;  2ICX A;  4MFG A;  5DG3 A;  1HV9 A;  3TK8 A;  1FXJ A;  4R7P A;  3NZ2 A;  1KHR A;  2GGO A;  3I3X A;  4M2A A;  1J2Z A;  3R5B A;  3OU9 A;  4G3P A;  4H7O A;  1LXA A;  3JQY A;  2AQ9 A;  3BFP A;  1KGT A;  3TIS A;  4ISX A;  3Q1X A;  3F1X A;  3OW5 A;  4EQY A;  2RIJ A;  4EGG A;  4M98 A;  2V0J A;  5U2K A;  2OEF A;  1TDT A;  1YP4 A;  4HZD A;  4N6B A;  3VBK A;  1G97 A;  3SRT A;  2VD4 A;  3BSW A;  1YP2 A;  4AC3 A;  4DCL A;  3EH0 A;  4HZC A;  3PMO A;  3VBP A;  1HM9 A;  4KPZ A;  4M2B A;  1THJ A;  1QRG A;  3I3A A;  1SSQ A;  4KNR A;  3ECT A;  3FSX A;  2ICY A;  3OUP A;  2IU9 A;  3P47 A;  4N27 A;  1SST A;  3KWD A;  5L6S A;  1MRL A;  2W0W A;  3EG4 A;  1T3D A;  3VBL A;  4M28 A;  2WLE A;  3R2W A;  3R5D A;  1OCX A;  3VBI A;  1QRM A;  1MR7 A;  5ADX V;  1QRL A;  1SSM A;  3FS8 A;  1KK6 A;  4R36 A;  1HM0 A;  1KRR A;  3V4E A;  3FSY A;  2OI7 A;  3OTM A;  2OI6 A;  2FKO A;  2GGQ A;  1QQ0 A;  2JF3 A;  3FOQ A;  2V0K A;  1KRU A;  5L6V A;  1HM8 A;  2IU8 A;  1XAT A;  1KRV A;  2TDT A;  3R0S A;  1QRE A;  1Z90 A;  4HUR A;  3CJ8 A;  3D8V A;  3OTZ A;  3BSY A;  1G95 A;  4EA7 A;  2QIV X;  5E3R A;  2NPO A;  1QRF A;  3BXY A;  4IHF A;  4R37 A;  3R5A A;  1KGQ A;  1XHD A;  4N6A A;  3SPT A;  3VBJ A;  4M9C A;  2Q4J A;  3C8V A;  3GOS A;  4N69 A;  4IHG A;  2WLD A;  3R3I A;  3KWE A;  2P2O A;  5AFU V;  3TV0 A;  3GUE A;  3IXC A;  4E75 A;  2VHE A;  4KNX A;  3TIO A;  3FSC A;  4K6R A;  3FSB A;  4AA7 A; 
#chains in the Genus database with same CATH topology
 5E3Q A;  4FCE A;  4KQL A;  4M99 A;  5E3P A;  2WLG A;  3R3R A;  1KK5 A;  3R1W A;  1FWY A;  2IUA A;  3EEV A;  4EA9 A;  4HUS A;  2IC7 A;  5ADX U;  5DEP A;  1V3W A;  2W0V A;  3D98 A;  2OI5 A;  3MQH A;  3SUC A;  4J18 A;  2XAT A;  3DK5 A;  4KPX A;  4EAA A;  1YP3 A;  3P1B A;  3MC4 A;  2V0I A;  3VNP A;  4G87 A;  4IHH A;  3GVD A;  1KK4 A;  1L0S A;  1MR9 A;  2I5K A;  2WLC A;  4G3Q A;  5F42 A;  3IGJ A;  2V0L A;  3R5C A;  3TDT A;  3KWC A;  3FWW A;  3OGZ A;  2V0H A;  3VBN A;  4G3S A;  4E79 A;  2OEG A;  2QKX A;  3TWD A;  3T57 A;  1KQA A;  3R8Y A;  3FTT A;  4J09 A;  3BRK X;  4EAB A;  3DHO A;  3BSS A;  1S80 A;  3HJJ A;  2WLF A;  4E6T A;  4E6U A;  5AFU U;  1V67 A;  4EA8 A;  4MYO A;  3GQ9 A;  4E1K A;  3DJ4 A;  2JF2 A;  3ST8 A;  4AAW A;  2QIA A;  3VBM A;  3MQG A;  4MZU A;  5DEM A;  3HSQ A;  4HCQ A;  2ICX A;  4MFG A;  5DG3 A;  1HV9 A;  3TK8 A;  1FXJ A;  4R7P A;  3NZ2 A;  1KHR A;  1N4I A;  2GGO A;  3I3X A;  4M2A A;  1J2Z A;  3R5B A;  3OU9 A;  4G3P A;  3GQA A;  4H7O A;  1LXA A;  3JQY A;  2AQ9 A;  3BFP A;  1KGT A;  3TIS A;  4ISX A;  3Q1X A;  3F1X A;  3OW5 A;  4EQY A;  2RIJ A;  4EGG A;  4M98 A;  2V0J A;  5U2K A;  2OEF A;  1TDT A;  1YP4 A;  4HZD A;  4N6B A;  3VBK A;  1G97 A;  3SRT A;  2VD4 A;  3BSW A;  1YP2 A;  1Z2F A;  4AC3 A;  3OH0 A;  4DCL A;  3EH0 A;  4HZC A;  3PMO A;  3VBP A;  1HM9 A;  4KPZ A;  3OH2 A;  4M2B A;  1THJ A;  1QRG A;  3I3A A;  1SSQ A;  4KNR A;  3ECT A;  3FSX A;  2ICY A;  3OUP A;  2IU9 A;  3P47 A;  4N27 A;  1SST A;  3KWD A;  5L6S A;  1MRL A;  2W0W A;  3EG4 A;  1T3D A;  3VBL A;  4M28 A;  2WLE A;  3R2W A;  3R5D A;  1OCX A;  3VBI A;  3GQ7 A;  1QRM A;  1MR7 A;  3OH4 A;  1QRL A;  1SSM A;  3FS8 A;  1KK6 A;  4R36 A;  5ADX V;  3OH3 A;  1HM0 A;  1KRR A;  3V4E A;  3FSY A;  2OI7 A;  3OTM A;  2OI6 A;  2FKO A;  2GGQ A;  3OH1 A;  1QQ0 A;  2JF3 A;  3FOQ A;  2V0K A;  1KRU A;  5L6V A;  1HM8 A;  2IU8 A;  1XAT A;  1KRV A;  2TDT A;  3R0S A;  1QRE A;  1Z90 A;  3GQ8 A;  4HUR A;  3CJ8 A;  3D8V A;  3OTZ A;  3BSY A;  1G95 A;  4EA7 A;  2QIV X;  5E3R A;  2NPO A;  1QRF A;  3BXY A;  4IHF A;  4R37 A;  1M8N A;  3R5A A;  1KGQ A;  1XHD A;  4N6A A;  3SPT A;  3VBJ A;  4M9C A;  2Q4J A;  3C8V A;  3GOS A;  4N69 A;  4IHG A;  2WLD A;  3R3I A;  3KWE A;  2P2O A;  5AFU V;  3TV0 A;  3GUE A;  3IXC A;  4E75 A;  2VHE A;  4KNX A;  3TIO A;  3FSC A;  4K6R A;  3FSB A;  4AA7 A;  1EWW A; 
#chains in the Genus database with same CATH homology
 5E3Q A;  4FCE A;  4KQL A;  4M99 A;  5E3P A;  2WLG A;  3R3R A;  1KK5 A;  3R1W A;  1FWY A;  2IUA A;  3EEV A;  4EA9 A;  4HUS A;  2IC7 A;  5ADX U;  5DEP A;  1V3W A;  2W0V A;  3D98 A;  2OI5 A;  3MQH A;  4J18 A;  2XAT A;  3DK5 A;  4KPX A;  4EAA A;  1YP3 A;  3P1B A;  3MC4 A;  2V0I A;  3VNP A;  4G87 A;  4IHH A;  3GVD A;  1KK4 A;  1MR9 A;  4G3Q A;  2I5K A;  2WLC A;  5F42 A;  3IGJ A;  2V0L A;  3R5C A;  3TDT A;  3KWC A;  3FWW A;  2V0H A;  3VBN A;  4G3S A;  4E79 A;  2OEG A;  2QKX A;  3TWD A;  3T57 A;  1KQA A;  3R8Y A;  3FTT A;  4J09 A;  3BRK X;  4EAB A;  3DHO A;  3BSS A;  1S80 A;  3HJJ A;  2WLF A;  4E6T A;  4E6U A;  5AFU U;  1V67 A;  4EA8 A;  4MYO A;  4E1K A;  3DJ4 A;  2JF2 A;  3ST8 A;  4AAW A;  2QIA A;  3VBM A;  3MQG A;  4MZU A;  5DEM A;  3HSQ A;  4HCQ A;  2ICX A;  4MFG A;  5DG3 A;  1HV9 A;  3TK8 A;  1FXJ A;  4R7P A;  3NZ2 A;  1KHR A;  2GGO A;  3I3X A;  4M2A A;  1J2Z A;  3R5B A;  3OU9 A;  4G3P A;  4H7O A;  1LXA A;  3JQY A;  2AQ9 A;  3BFP A;  1KGT A;  3TIS A;  4ISX A;  3Q1X A;  3F1X A;  3OW5 A;  4EQY A;  2RIJ A;  4EGG A;  4M98 A;  2V0J A;  5U2K A;  2OEF A;  1TDT A;  1YP4 A;  4HZD A;  4N6B A;  3VBK A;  1G97 A;  3SRT A;  2VD4 A;  3BSW A;  1YP2 A;  4AC3 A;  4DCL A;  3EH0 A;  4HZC A;  3PMO A;  3VBP A;  1HM9 A;  4KPZ A;  4M2B A;  1THJ A;  1QRG A;  3I3A A;  1SSQ A;  4KNR A;  3ECT A;  3FSX A;  2ICY A;  3OUP A;  2IU9 A;  3P47 A;  4N27 A;  1SST A;  3KWD A;  5L6S A;  1MRL A;  2W0W A;  3EG4 A;  1T3D A;  3VBL A;  4M28 A;  2WLE A;  3R2W A;  3R5D A;  1OCX A;  3VBI A;  1QRM A;  1MR7 A;  5ADX V;  1QRL A;  1SSM A;  3FS8 A;  1KK6 A;  4R36 A;  1HM0 A;  1KRR A;  3V4E A;  3FSY A;  2OI7 A;  3OTM A;  2OI6 A;  2FKO A;  2GGQ A;  1QQ0 A;  2JF3 A;  3FOQ A;  2V0K A;  1KRU A;  5L6V A;  1HM8 A;  2IU8 A;  1XAT A;  1KRV A;  2TDT A;  3R0S A;  1QRE A;  1Z90 A;  4HUR A;  3CJ8 A;  3D8V A;  3OTZ A;  3BSY A;  1G95 A;  4EA7 A;  2QIV X;  5E3R A;  2NPO A;  1QRF A;  3BXY A;  4IHF A;  4R37 A;  3R5A A;  1KGQ A;  1XHD A;  4N6A A;  3SPT A;  3VBJ A;  4M9C A;  2Q4J A;  3C8V A;  3GOS A;  4N69 A;  4IHG A;  2WLD A;  3R3I A;  3KWE A;  2P2O A;  5AFU V;  3TV0 A;  3GUE A;  3IXC A;  4E75 A;  2VHE A;  4KNX A;  3TIO A;  3FSC A;  4K6R A;  3FSB A;  4AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...