5ADXU

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
173
structure length
169
Chain Sequence
PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
total genus 31
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5adxU00
1QQ0A 1S80A 4HCQA 2V0IA 4M9CA 5E3RA 5AFUV 4N27A 3OTZA 3P1BA 4R7PA 3CJ8A 3Q1XA 4MYOA 3VBNA 3VBLA 3DK5A 2GGOA 2V0KA 3MQGA 3BRKX 3SPTA 4J18A 2I5KA 5E3QA 2IU9A 2TDTA 4HZDA 5F42A 2P2OA 2IUAA 2QKXA 2OI7A 3TISA 3V4EA 4R37A 4H7OA 4KNXA 2IC7A 3R5BA 3I3XA 5L6VA 1G97A 2WLFA 4EA7A 3VBKA 3GOSA 4N69A 4KNRA 4G3QA 4KPZA 4MFGA 2QIVX 3FSCA 3DHOA 1FXJA 3NZ2A 3BFPA 3OUPA 3OW5A 1QRMA 1QRGA 2OEFA 3MC4A 3DJ4A 3R5DA 4M2AA 4EGGA 1G95A 1SSQA 1TDTA 3VBIA 1KRUA 1LXAA 3OTMA 4EQYA 2OEGA 2VHEA 2GGQA 1XHDA 3FSBA 4IHFA 2JF3A 4FCEA 1HM8A 4J09A 4E6UA 2OI5A 3P47A 2WLDA 5DEPA 5DG3A 2W0WA 3R8YA 3TK8A 1HV9A 3FSYA 3TIOA 3TV0A 2OI6A 3ECTA 4N6BA 1KGTA 4E6TA 3VBMA 3EEVA 4AA7A 3FTTA 1V67A 4HZCA 1YP3A 1J2ZA 4E1KA 3KWEA 1SSTA 1T3DA 4E79A 3BSWA 3F1XA 4G87A 5L6SA 2ICYA 5DEMA 4M2BA 1KRRA 3C8VA 1HM0A 1MR7A 1QREA 3FSXA 2AQ9A 3BSSA 3OU9A 2V0HA 3R3RA 2QIAA 2WLCA 4KQLA 3KWCA 3IGJA 4HUSA 3GUEA 3EG4A 1HM9A 3R5AA 3VBPA 5ADXU 3R2WA 5ADXV 1OCXA 3D98A 4IHGA 4EABA 3VNPA 4M98A 1QRLA 4KPXA 4K6RA 2WLEA 3VBJA 4EA8A 2RIJA 1KK4A 3R3IA 3D8VA 3FS8A 3HSQA 4E75A 1KQAA 2V0JA 1SSMA 4DCLA 4EAAA 2Q4JA 3GVDA 3MQHA 3BSYA 3R0SA 2FKOA 2XATA 1THJA 1Z90A 3JQYA 5AFUU 2NPOA 1KGQA 1MRLA 4G3SA 3FOQA 4ISXA 1YP4A 3HJJA 4IHHA 4EA9A 2JF2A 1KHRA 3SRTA 4AC3A 3IXCA 3KWDA 1KK5A 1KRVA 5U2KA 3R5CA 1YP2A 4HURA 4M28A 4N6AA 2V0LA 4G3PA 3T57A 3BXYA 4MZUA 1XATA 3TWDA 3PMOA 2VD4A 1QRFA 3R1WA 3ST8A 1KK6A 1FWYA 2ICXA 3I3AA 1V3WA 2IU8A 2W0VA 3FWWA 4R36A 3EH0A 5E3PA 4M99A 1MR9A 2WLGA 4AAWA 3TDTA
chains in the Genus database with same CATH superfamily
1QQ0A 1S80A 4HCQA 2V0IA 4M9CA 5E3RA 3OH0A 5AFUV 4N27A 3OTZA 3P1BA 4R7PA 3CJ8A 3Q1XA 4MYOA 3VBNA 3VBLA 3DK5A 2GGOA 2V0KA 3MQGA 3BRKX 3SPTA 4J18A 2I5KA 5E3QA 2IU9A 2TDTA 4HZDA 5F42A 2P2OA 2IUAA 2QKXA 2OI7A 3TISA 3V4EA 4R37A 4H7OA 4KNXA 2IC7A 3R5BA 3I3XA 5L6VA 1G97A 2WLFA 4EA7A 3VBKA 3GOSA 4N69A 4KNRA 4G3QA 4KPZA 3OH4A 4MFGA 2QIVX 3FSCA 3DHOA 1FXJA 3NZ2A 3BFPA 3OUPA 3GQ9A 3GQAA 3OW5A 1QRMA 1QRGA 2OEFA 3MC4A 3DJ4A 3R5DA 4M2AA 4EGGA 3OGZA 1G95A 1SSQA 1TDTA 3OH2A 3SUCA 3VBIA 1KRUA 1LXAA 3OTMA 4EQYA 2OEGA 2VHEA 2GGQA 1XHDA 3FSBA 4IHFA 2JF3A 4FCEA 1HM8A 3OH1A 4J09A 2OI5A 4E6UA 3P47A 2WLDA 5DEPA 5DG3A 2W0WA 3R8YA 3TK8A 1HV9A 3FSYA 3TIOA 3TV0A 2OI6A 3ECTA 4N6BA 1KGTA 1EWWA 4E6TA 3VBMA 3EEVA 4AA7A 3FTTA 1V67A 4HZCA 1YP3A 1J2ZA 4E1KA 3KWEA 1SSTA 1T3DA 4E79A 3BSWA 3F1XA 4G87A 1Z2FA 5L6SA 2ICYA 5DEMA 4M2BA 1KRRA 3C8VA 1HM0A 1MR7A 1QREA 3FSXA 2AQ9A 3BSSA 3OU9A 2V0HA 3R3RA 2QIAA 2WLCA 4KQLA 3KWCA 3IGJA 4HUSA 3OH3A 3GUEA 3EG4A 1HM9A 3R5AA 3VBPA 5ADXU 3R2WA 5ADXV 1OCXA 3D98A 4IHGA 4EABA 3VNPA 4M98A 1QRLA 4KPXA 4K6RA 2WLEA 3VBJA 4EA8A 2RIJA 1KK4A 3R3IA 3D8VA 3FS8A 3HSQA 4E75A 1KQAA 2V0JA 1SSMA 4DCLA 4EAAA 2Q4JA 3GVDA 3MQHA 3BSYA 3R0SA 2FKOA 2XATA 1THJA 1Z90A 3JQYA 5AFUU 2NPOA 1KGQA 1MRLA 4G3SA 3FOQA 4ISXA 1YP4A 1L0SA 3HJJA 4IHHA 4EA9A 1M8NA 2JF2A 3GQ8A 1KHRA 3SRTA 4AC3A 3IXCA 3GQ7A 3KWDA 1KK5A 1KRVA 5U2KA 3R5CA 1YP2A 4HURA 4M28A 4N6AA 2V0LA 4G3PA 3T57A 3BXYA 4MZUA 1XATA 3TWDA 3PMOA 2VD4A 1QRFA 3R1WA 3ST8A 1KK6A 1FWYA 2ICXA 3I3AA 1V3WA 2IU8A 2W0VA 3FWWA 4R36A 3EH0A 5E3PA 4M99A 1MR9A 1N4IA 2WLGA 4AAWA 3TDTA
chains in the Genus database with same CATH topology
1QQ0A 1S80A 4HCQA 2V0IA 4M9CA 5E3RA 5AFUV 4N27A 3OTZA 3P1BA 4R7PA 3CJ8A 3Q1XA 4MYOA 3VBNA 3VBLA 3DK5A 2GGOA 2V0KA 3MQGA 3BRKX 3SPTA 4J18A 2I5KA 5E3QA 2IU9A 2TDTA 4HZDA 5F42A 2P2OA 2IUAA 2QKXA 2OI7A 3TISA 3V4EA 4R37A 4H7OA 4KNXA 2IC7A 3R5BA 3I3XA 5L6VA 1G97A 2WLFA 4EA7A 3VBKA 3GOSA 4N69A 4KNRA 4G3QA 4KPZA 4MFGA 2QIVX 3FSCA 3DHOA 1FXJA 3NZ2A 3BFPA 3OUPA 3OW5A 1QRMA 1QRGA 2OEFA 3MC4A 3DJ4A 3R5DA 4M2AA 4EGGA 1G95A 1SSQA 1TDTA 3VBIA 1KRUA 1LXAA 3OTMA 4EQYA 2OEGA 2VHEA 2GGQA 1XHDA 3FSBA 4IHFA 2JF3A 4FCEA 1HM8A 4J09A 4E6UA 2OI5A 3P47A 2WLDA 5DEPA 5DG3A 2W0WA 3R8YA 3TK8A 1HV9A 3FSYA 3TIOA 3TV0A 2OI6A 3ECTA 4N6BA 1KGTA 4E6TA 3VBMA 3EEVA 4AA7A 3FTTA 1V67A 4HZCA 1YP3A 1J2ZA 4E1KA 3KWEA 1SSTA 1T3DA 4E79A 3BSWA 3F1XA 4G87A 5L6SA 2ICYA 5DEMA 4M2BA 1KRRA 3C8VA 1HM0A 1MR7A 1QREA 3FSXA 2AQ9A 3BSSA 3OU9A 2V0HA 3R3RA 2QIAA 2WLCA 4KQLA 3KWCA 3IGJA 4HUSA 3GUEA 3EG4A 1HM9A 3R5AA 3VBPA 5ADXU 3R2WA 5ADXV 1OCXA 3D98A 4IHGA 4EABA 3VNPA 4M98A 1QRLA 4KPXA 4K6RA 2WLEA 3VBJA 4EA8A 2RIJA 1KK4A 3R3IA 3D8VA 3FS8A 3HSQA 4E75A 1KQAA 2V0JA 1SSMA 4DCLA 4EAAA 2Q4JA 3GVDA 3MQHA 3BSYA 3R0SA 2FKOA 2XATA 1THJA 1Z90A 3JQYA 5AFUU 2NPOA 1KGQA 1MRLA 4G3SA 3FOQA 4ISXA 1YP4A 3HJJA 4IHHA 4EA9A 2JF2A 1KHRA 3SRTA 4AC3A 3IXCA 3KWDA 1KK5A 1KRVA 5U2KA 3R5CA 1YP2A 4HURA 4M28A 4N6AA 2V0LA 4G3PA 3T57A 3BXYA 4MZUA 1XATA 3TWDA 3PMOA 2VD4A 1QRFA 3R1WA 3ST8A 1KK6A 1FWYA 2ICXA 3I3AA 1V3WA 2IU8A 2W0VA 3FWWA 4R36A 3EH0A 5E3PA 4M99A 1MR9A 2WLGA 4AAWA 3TDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ0 A;  1S80 A;  4HCQ A;  2V0I A;  4M9C A;  5E3R A;  5AFU V;  4N27 A;  3OTZ A;  3P1B A;  4R7P A;  3CJ8 A;  3Q1X A;  4MYO A;  3VBN A;  3VBL A;  3DK5 A;  2GGO A;  2V0K A;  3MQG A;  3BRK X;  3SPT A;  4J18 A;  2I5K A;  5E3Q A;  2IU9 A;  2TDT A;  4HZD A;  5F42 A;  2P2O A;  2IUA A;  2QKX A;  2OI7 A;  3TIS A;  3V4E A;  4R37 A;  4H7O A;  4KNX A;  2IC7 A;  3R5B A;  3I3X A;  5L6V A;  1G97 A;  2WLF A;  4EA7 A;  3VBK A;  3GOS A;  4N69 A;  4KNR A;  4G3Q A;  4KPZ A;  4MFG A;  2QIV X;  3FSC A;  3DHO A;  1FXJ A;  3NZ2 A;  3BFP A;  3OUP A;  3OW5 A;  1QRM A;  1QRG A;  2OEF A;  3MC4 A;  3DJ4 A;  3R5D A;  4M2A A;  4EGG A;  1G95 A;  1SSQ A;  1TDT A;  3VBI A;  1KRU A;  1LXA A;  3OTM A;  4EQY A;  2OEG A;  2VHE A;  2GGQ A;  1XHD A;  3FSB A;  4IHF A;  2JF3 A;  4FCE A;  1HM8 A;  4J09 A;  4E6U A;  2OI5 A;  3P47 A;  2WLD A;  5DEP A;  5DG3 A;  2W0W A;  3R8Y A;  3TK8 A;  1HV9 A;  3FSY A;  3TIO A;  3TV0 A;  2OI6 A;  3ECT A;  4N6B A;  1KGT A;  4E6T A;  3VBM A;  3EEV A;  4AA7 A;  3FTT A;  1V67 A;  4HZC A;  1YP3 A;  1J2Z A;  4E1K A;  3KWE A;  1SST A;  1T3D A;  4E79 A;  3BSW A;  3F1X A;  4G87 A;  5L6S A;  2ICY A;  5DEM A;  4M2B A;  1KRR A;  3C8V A;  1HM0 A;  1MR7 A;  1QRE A;  3FSX A;  2AQ9 A;  3BSS A;  3OU9 A;  2V0H A;  3R3R A;  2QIA A;  2WLC A;  4KQL A;  3KWC A;  3IGJ A;  4HUS A;  3GUE A;  3EG4 A;  1HM9 A;  3R5A A;  3VBP A;  5ADX U;  3R2W A;  5ADX V;  1OCX A;  3D98 A;  4IHG A;  4EAB A;  3VNP A;  4M98 A;  1QRL A;  4KPX A;  4K6R A;  2WLE A;  3VBJ A;  4EA8 A;  2RIJ A;  1KK4 A;  3R3I A;  3D8V A;  3FS8 A;  3HSQ A;  4E75 A;  1KQA A;  2V0J A;  1SSM A;  4DCL A;  4EAA A;  2Q4J A;  3GVD A;  3MQH A;  3BSY A;  3R0S A;  2FKO A;  2XAT A;  1THJ A;  1Z90 A;  3JQY A;  5AFU U;  2NPO A;  1KGQ A;  1MRL A;  4G3S A;  3FOQ A;  4ISX A;  1YP4 A;  3HJJ A;  4IHH A;  4EA9 A;  2JF2 A;  1KHR A;  3SRT A;  4AC3 A;  3IXC A;  3KWD A;  1KK5 A;  1KRV A;  5U2K A;  3R5C A;  1YP2 A;  4HUR A;  4M28 A;  4N6A A;  2V0L A;  4G3P A;  3T57 A;  3BXY A;  4MZU A;  1XAT A;  3TWD A;  3PMO A;  2VD4 A;  1QRF A;  3R1W A;  3ST8 A;  1KK6 A;  1FWY A;  2ICX A;  3I3A A;  1V3W A;  2IU8 A;  2W0V A;  3FWW A;  4R36 A;  3EH0 A;  5E3P A;  4M99 A;  1MR9 A;  2WLG A;  4AAW A;  3TDT A; 
#chains in the Genus database with same CATH topology
 1QQ0 A;  1S80 A;  4HCQ A;  2V0I A;  4M9C A;  5E3R A;  3OH0 A;  5AFU V;  4N27 A;  3OTZ A;  3P1B A;  4R7P A;  3CJ8 A;  3Q1X A;  4MYO A;  3VBN A;  3VBL A;  3DK5 A;  2GGO A;  2V0K A;  3MQG A;  3BRK X;  3SPT A;  4J18 A;  2I5K A;  5E3Q A;  2IU9 A;  2TDT A;  4HZD A;  5F42 A;  2P2O A;  2IUA A;  2QKX A;  2OI7 A;  3TIS A;  3V4E A;  4R37 A;  4H7O A;  4KNX A;  2IC7 A;  3R5B A;  3I3X A;  5L6V A;  1G97 A;  2WLF A;  4EA7 A;  3VBK A;  3GOS A;  4N69 A;  4KNR A;  4G3Q A;  4KPZ A;  3OH4 A;  4MFG A;  2QIV X;  3FSC A;  3DHO A;  1FXJ A;  3NZ2 A;  3BFP A;  3OUP A;  3GQ9 A;  3GQA A;  3OW5 A;  1QRM A;  1QRG A;  2OEF A;  3MC4 A;  3DJ4 A;  3R5D A;  4M2A A;  4EGG A;  3OGZ A;  1G95 A;  1SSQ A;  1TDT A;  3OH2 A;  3SUC A;  3VBI A;  1KRU A;  1LXA A;  3OTM A;  4EQY A;  2OEG A;  2VHE A;  2GGQ A;  1XHD A;  3FSB A;  4IHF A;  2JF3 A;  4FCE A;  1HM8 A;  3OH1 A;  4J09 A;  2OI5 A;  4E6U A;  3P47 A;  2WLD A;  5DEP A;  5DG3 A;  2W0W A;  3R8Y A;  3TK8 A;  1HV9 A;  3FSY A;  3TIO A;  3TV0 A;  2OI6 A;  3ECT A;  4N6B A;  1KGT A;  1EWW A;  4E6T A;  3VBM A;  3EEV A;  4AA7 A;  3FTT A;  1V67 A;  4HZC A;  1YP3 A;  1J2Z A;  4E1K A;  3KWE A;  1SST A;  1T3D A;  4E79 A;  3BSW A;  3F1X A;  4G87 A;  1Z2F A;  5L6S A;  2ICY A;  5DEM A;  4M2B A;  1KRR A;  3C8V A;  1HM0 A;  1MR7 A;  1QRE A;  3FSX A;  2AQ9 A;  3BSS A;  3OU9 A;  2V0H A;  3R3R A;  2QIA A;  2WLC A;  4KQL A;  3KWC A;  3IGJ A;  4HUS A;  3OH3 A;  3GUE A;  3EG4 A;  1HM9 A;  3R5A A;  3VBP A;  5ADX U;  3R2W A;  5ADX V;  1OCX A;  3D98 A;  4IHG A;  4EAB A;  3VNP A;  4M98 A;  1QRL A;  4KPX A;  4K6R A;  2WLE A;  3VBJ A;  4EA8 A;  2RIJ A;  1KK4 A;  3R3I A;  3D8V A;  3FS8 A;  3HSQ A;  4E75 A;  1KQA A;  2V0J A;  1SSM A;  4DCL A;  4EAA A;  2Q4J A;  3GVD A;  3MQH A;  3BSY A;  3R0S A;  2FKO A;  2XAT A;  1THJ A;  1Z90 A;  3JQY A;  5AFU U;  2NPO A;  1KGQ A;  1MRL A;  4G3S A;  3FOQ A;  4ISX A;  1YP4 A;  1L0S A;  3HJJ A;  4IHH A;  4EA9 A;  1M8N A;  2JF2 A;  3GQ8 A;  1KHR A;  3SRT A;  4AC3 A;  3IXC A;  3GQ7 A;  3KWD A;  1KK5 A;  1KRV A;  5U2K A;  3R5C A;  1YP2 A;  4HUR A;  4M28 A;  4N6A A;  2V0L A;  4G3P A;  3T57 A;  3BXY A;  4MZU A;  1XAT A;  3TWD A;  3PMO A;  2VD4 A;  1QRF A;  3R1W A;  3ST8 A;  1KK6 A;  1FWY A;  2ICX A;  3I3A A;  1V3W A;  2IU8 A;  2W0V A;  3FWW A;  4R36 A;  3EH0 A;  5E3P A;  4M99 A;  1MR9 A;  1N4I A;  2WLG A;  4AAW A;  3TDT A; 
#chains in the Genus database with same CATH homology
 1QQ0 A;  1S80 A;  4HCQ A;  2V0I A;  4M9C A;  5E3R A;  5AFU V;  4N27 A;  3OTZ A;  3P1B A;  4R7P A;  3CJ8 A;  3Q1X A;  4MYO A;  3VBN A;  3VBL A;  3DK5 A;  2GGO A;  2V0K A;  3MQG A;  3BRK X;  3SPT A;  4J18 A;  2I5K A;  5E3Q A;  2IU9 A;  2TDT A;  4HZD A;  5F42 A;  2P2O A;  2IUA A;  2QKX A;  2OI7 A;  3TIS A;  3V4E A;  4R37 A;  4H7O A;  4KNX A;  2IC7 A;  3R5B A;  3I3X A;  5L6V A;  1G97 A;  2WLF A;  4EA7 A;  3VBK A;  3GOS A;  4N69 A;  4KNR A;  4G3Q A;  4KPZ A;  4MFG A;  2QIV X;  3FSC A;  3DHO A;  1FXJ A;  3NZ2 A;  3BFP A;  3OUP A;  3OW5 A;  1QRM A;  1QRG A;  2OEF A;  3MC4 A;  3DJ4 A;  3R5D A;  4M2A A;  4EGG A;  1G95 A;  1SSQ A;  1TDT A;  3VBI A;  1KRU A;  1LXA A;  3OTM A;  4EQY A;  2OEG A;  2VHE A;  2GGQ A;  1XHD A;  3FSB A;  4IHF A;  2JF3 A;  4FCE A;  1HM8 A;  4J09 A;  4E6U A;  2OI5 A;  3P47 A;  2WLD A;  5DEP A;  5DG3 A;  2W0W A;  3R8Y A;  3TK8 A;  1HV9 A;  3FSY A;  3TIO A;  3TV0 A;  2OI6 A;  3ECT A;  4N6B A;  1KGT A;  4E6T A;  3VBM A;  3EEV A;  4AA7 A;  3FTT A;  1V67 A;  4HZC A;  1YP3 A;  1J2Z A;  4E1K A;  3KWE A;  1SST A;  1T3D A;  4E79 A;  3BSW A;  3F1X A;  4G87 A;  5L6S A;  2ICY A;  5DEM A;  4M2B A;  1KRR A;  3C8V A;  1HM0 A;  1MR7 A;  1QRE A;  3FSX A;  2AQ9 A;  3BSS A;  3OU9 A;  2V0H A;  3R3R A;  2QIA A;  2WLC A;  4KQL A;  3KWC A;  3IGJ A;  4HUS A;  3GUE A;  3EG4 A;  1HM9 A;  3R5A A;  3VBP A;  5ADX U;  3R2W A;  5ADX V;  1OCX A;  3D98 A;  4IHG A;  4EAB A;  3VNP A;  4M98 A;  1QRL A;  4KPX A;  4K6R A;  2WLE A;  3VBJ A;  4EA8 A;  2RIJ A;  1KK4 A;  3R3I A;  3D8V A;  3FS8 A;  3HSQ A;  4E75 A;  1KQA A;  2V0J A;  1SSM A;  4DCL A;  4EAA A;  2Q4J A;  3GVD A;  3MQH A;  3BSY A;  3R0S A;  2FKO A;  2XAT A;  1THJ A;  1Z90 A;  3JQY A;  5AFU U;  2NPO A;  1KGQ A;  1MRL A;  4G3S A;  3FOQ A;  4ISX A;  1YP4 A;  3HJJ A;  4IHH A;  4EA9 A;  2JF2 A;  1KHR A;  3SRT A;  4AC3 A;  3IXC A;  3KWD A;  1KK5 A;  1KRV A;  5U2K A;  3R5C A;  1YP2 A;  4HUR A;  4M28 A;  4N6A A;  2V0L A;  4G3P A;  3T57 A;  3BXY A;  4MZU A;  1XAT A;  3TWD A;  3PMO A;  2VD4 A;  1QRF A;  3R1W A;  3ST8 A;  1KK6 A;  1FWY A;  2ICX A;  3I3A A;  1V3W A;  2IU8 A;  2W0V A;  3FWW A;  4R36 A;  3EH0 A;  5E3P A;  4M99 A;  1MR9 A;  2WLG A;  4AAW A;  3TDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...