3NZ2A

Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
182
structure length
182
Chain Sequence
MSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexapeptide-repeat containing-acetyltransferase
publication title Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
total genus 62
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3nz2A00
4R7PA 3R3RA 1KQAA 3Q1XA 3BSYA 1XHDA 2ICXA 5DEPA 2IUAA 2QIVX 3FWWA 3OW5A 4N6AA 1HM8A 1QRLA 4R37A 4DCLA 3TV0A 3DK5A 5L6SA 1YP4A 3MC4A 4HURA 4HZDA 1KK4A 3VBPA 3FSXA 2IU9A 2RIJA 5DG3A 1KRVA 3EH0A 4G3PA 2V0KA 5ADXU 4EQYA 1FWYA 1KK5A 1TDTA 3OUPA 5F42A 3R2WA 4EABA 3KWEA 4G87A 2ICYA 3TIOA 1KK6A 3KWCA 4J09A 1S80A 2W0WA 4J18A 3CJ8A 3IXCA 5E3PA 1Z90A 4MFGA 4E75A 4FCEA 3BFPA 1OCXA 4R36A 5U2KA 4G3QA 4E1KA 4EGGA 3JQYA 2GGOA 5AFUV 3VBIA 3BSSA 2QKXA 4HUSA 2OI7A 3GVDA 2OI6A 4M98A 2V0IA 3HJJA 2JF2A 2WLDA 2V0LA 5E3RA 3TK8A 3HSQA 3GUEA 2W0VA 1YP3A 3FSBA 3VBJA 3V4EA 1KGQA 2JF3A 3P47A 1THJA 4KNXA 2V0JA 4N69A 1HV9A 3VBMA 2WLFA 3R5DA 2XATA 1KGTA 4EA7A 1J2ZA 4H7OA 3R5BA 4MZUA 2Q4JA 3PMOA 3R0SA 3R3IA 4E79A 3C8VA 3R5AA 1MR9A 3D98A 3EG4A 4MYOA 1SSMA 4E6UA 3IGJA 3FOQA 4ISXA 3VBNA 3OU9A 3P1BA 3BSWA 4KQLA 1V67A 4K6RA 3ST8A 3VBLA 1SSQA 1KRRA 1MRLA 5E3QA 1FXJA 3FS8A 4HCQA 4M99A 5DEMA 4EA8A 1KHRA 5AFUU 3GOSA 1LXAA 1XATA 2TDTA 3R8YA 4AC3A 2I5KA 1SSTA 2OEFA 3FSYA 3R5CA 2P2OA 3BRKX 4G3SA 2WLGA 4KNRA 1G97A 1QREA 2FKOA 2OI5A 2OEGA 3MQGA 1V3WA 4AAWA 3DHOA 4N27A 2IU8A 2WLCA 1HM0A 3D8VA 3EEVA 3F1XA 3NZ2A 4M2BA 3TISA 2QIAA 3BXYA 3FTTA 4KPXA 5L6VA 1HM9A 1YP2A 2IC7A 4HZCA 3VBKA 4N6BA 3I3AA 4EA9A 1T3DA 4IHGA 1G95A 3VNPA 3T57A 3R1WA 3MQHA 2VD4A 4M2AA 5ADXV 3SRTA 3DJ4A 3OTMA 4M9CA 3ECTA 3SPTA 1KRUA 1QRMA 3KWDA 3TWDA 1QQ0A 2AQ9A 4IHFA 3TDTA 4E6TA 2NPOA 4IHHA 3OTZA 1QRFA 4EAAA 4AA7A 1MR7A 2WLEA 1QRGA 3I3XA 4KPZA 2V0HA 4M28A 2VHEA 3FSCA 2GGQA
chains in the Genus database with same CATH superfamily
4R7PA 3R3RA 1KQAA 3Q1XA 3BSYA 1XHDA 2ICXA 5DEPA 2IUAA 2QIVX 3FWWA 3OW5A 4N6AA 1HM8A 1QRLA 3GQ7A 4R37A 4DCLA 3TV0A 3DK5A 5L6SA 1YP4A 3GQ8A 3MC4A 4HURA 1KK4A 4HZDA 3VBPA 3FSXA 2IU9A 2RIJA 5DG3A 1KRVA 1EWWA 3EH0A 4G3PA 2V0KA 5ADXU 4EQYA 1FWYA 1KK5A 1TDTA 3OUPA 5F42A 3R2WA 4EABA 3KWEA 4G87A 2ICYA 3TIOA 1KK6A 3KWCA 4J09A 1S80A 2W0WA 4J18A 1N4IA 3CJ8A 3IXCA 1Z90A 5E3PA 4MFGA 4E75A 4FCEA 3BFPA 1OCXA 4R36A 5U2KA 4G3QA 4E1KA 4EGGA 3JQYA 2GGOA 5AFUV 3VBIA 3BSSA 2QKXA 4HUSA 2OI7A 3GVDA 2OI6A 4M98A 2V0IA 3HJJA 2JF2A 2WLDA 2V0LA 5E3RA 3TK8A 3HSQA 3GUEA 2W0VA 1YP3A 3FSBA 3VBJA 3V4EA 1KGQA 2JF3A 3OH4A 3P47A 1THJA 4KNXA 2V0JA 4N69A 1HV9A 3VBMA 2WLFA 3R5DA 2XATA 1KGTA 4EA7A 1J2ZA 4H7OA 3R5BA 4MZUA 2Q4JA 3PMOA 3R0SA 3R3IA 4E79A 3C8VA 3R5AA 3OH0A 1MR9A 3D98A 3EG4A 4MYOA 3OH2A 1SSMA 4E6UA 3IGJA 3FOQA 4ISXA 3VBNA 3OU9A 3P1BA 3BSWA 4KQLA 1V67A 4K6RA 3ST8A 3VBLA 1SSQA 1KRRA 1MRLA 5E3QA 1FXJA 3FS8A 3GQ9A 4HCQA 4M99A 5DEMA 4EA8A 1KHRA 5AFUU 3GOSA 3OGZA 1LXAA 1XATA 2TDTA 3R8YA 4AC3A 2I5KA 1SSTA 2OEFA 3FSYA 3R5CA 2P2OA 3BRKX 4G3SA 2WLGA 4KNRA 1L0SA 1G97A 1QREA 2FKOA 2OI5A 2OEGA 3MQGA 1V3WA 4AAWA 3DHOA 4N27A 2IU8A 2WLCA 1HM0A 3D8VA 3EEVA 3F1XA 3NZ2A 4M2BA 3TISA 2QIAA 3BXYA 3FTTA 4KPXA 5L6VA 1HM9A 1YP2A 2IC7A 4HZCA 3VBKA 4N6BA 3I3AA 3SUCA 4EA9A 1T3DA 4IHGA 1G95A 3VNPA 3OH1A 3T57A 3R1WA 3MQHA 2VD4A 4M2AA 5ADXV 3SRTA 3DJ4A 3OTMA 4M9CA 1M8NA 3ECTA 3SPTA 1KRUA 1QRMA 3KWDA 3GQAA 3TWDA 1QQ0A 2AQ9A 4IHFA 3TDTA 4E6TA 2NPOA 4IHHA 3OTZA 1QRFA 4EAAA 4AA7A 1MR7A 2WLEA 1QRGA 1Z2FA 3I3XA 4KPZA 2V0HA 4M28A 2VHEA 3FSCA 2GGQA 3OH3A
chains in the Genus database with same CATH topology
4R7PA 3R3RA 1KQAA 3Q1XA 3BSYA 1XHDA 2ICXA 5DEPA 2IUAA 2QIVX 3FWWA 3OW5A 4N6AA 1HM8A 1QRLA 4R37A 4DCLA 3TV0A 3DK5A 5L6SA 1YP4A 3MC4A 4HURA 4HZDA 1KK4A 3VBPA 3FSXA 2IU9A 2RIJA 5DG3A 1KRVA 3EH0A 4G3PA 2V0KA 5ADXU 4EQYA 1FWYA 1KK5A 1TDTA 3OUPA 5F42A 3R2WA 4EABA 3KWEA 4G87A 2ICYA 3TIOA 1KK6A 3KWCA 4J09A 1S80A 2W0WA 4J18A 3CJ8A 3IXCA 5E3PA 1Z90A 4MFGA 4E75A 4FCEA 3BFPA 1OCXA 4R36A 5U2KA 4G3QA 4E1KA 4EGGA 3JQYA 2GGOA 5AFUV 3VBIA 3BSSA 2QKXA 4HUSA 2OI7A 3GVDA 2OI6A 4M98A 2V0IA 3HJJA 2JF2A 2WLDA 2V0LA 5E3RA 3TK8A 3HSQA 3GUEA 2W0VA 1YP3A 3FSBA 3VBJA 3V4EA 1KGQA 2JF3A 3P47A 1THJA 4KNXA 2V0JA 4N69A 1HV9A 3VBMA 2WLFA 3R5DA 2XATA 1KGTA 4EA7A 1J2ZA 4H7OA 3R5BA 4MZUA 2Q4JA 3PMOA 3R0SA 3R3IA 4E79A 3C8VA 3R5AA 1MR9A 3D98A 3EG4A 4MYOA 1SSMA 4E6UA 3IGJA 3FOQA 4ISXA 3VBNA 3OU9A 3P1BA 3BSWA 4KQLA 1V67A 4K6RA 3ST8A 3VBLA 1SSQA 1KRRA 1MRLA 5E3QA 1FXJA 3FS8A 4HCQA 4M99A 5DEMA 4EA8A 1KHRA 5AFUU 3GOSA 1LXAA 1XATA 2TDTA 3R8YA 4AC3A 2I5KA 1SSTA 2OEFA 3FSYA 3R5CA 2P2OA 3BRKX 4G3SA 2WLGA 4KNRA 1G97A 1QREA 2FKOA 2OI5A 2OEGA 3MQGA 1V3WA 4AAWA 3DHOA 4N27A 2IU8A 2WLCA 1HM0A 3D8VA 3EEVA 3F1XA 3NZ2A 4M2BA 3TISA 2QIAA 3BXYA 3FTTA 4KPXA 5L6VA 1HM9A 1YP2A 2IC7A 4HZCA 3VBKA 4N6BA 3I3AA 4EA9A 1T3DA 4IHGA 1G95A 3VNPA 3T57A 3R1WA 3MQHA 2VD4A 4M2AA 5ADXV 3SRTA 3DJ4A 3OTMA 4M9CA 3ECTA 3SPTA 1KRUA 1QRMA 3KWDA 3TWDA 1QQ0A 2AQ9A 4IHFA 3TDTA 4E6TA 2NPOA 4IHHA 3OTZA 1QRFA 4EAAA 4AA7A 1MR7A 2WLEA 1QRGA 3I3XA 4KPZA 2V0HA 4M28A 2VHEA 3FSCA 2GGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7P A;  3R3R A;  1KQA A;  3Q1X A;  3BSY A;  1XHD A;  2ICX A;  5DEP A;  2IUA A;  2QIV X;  3FWW A;  3OW5 A;  4N6A A;  1HM8 A;  1QRL A;  4R37 A;  4DCL A;  3TV0 A;  3DK5 A;  5L6S A;  1YP4 A;  3MC4 A;  4HUR A;  4HZD A;  1KK4 A;  3VBP A;  3FSX A;  2IU9 A;  2RIJ A;  5DG3 A;  1KRV A;  3EH0 A;  4G3P A;  2V0K A;  5ADX U;  4EQY A;  1FWY A;  1KK5 A;  1TDT A;  3OUP A;  5F42 A;  3R2W A;  4EAB A;  3KWE A;  4G87 A;  2ICY A;  3TIO A;  1KK6 A;  3KWC A;  4J09 A;  1S80 A;  2W0W A;  4J18 A;  3CJ8 A;  3IXC A;  5E3P A;  1Z90 A;  4MFG A;  4E75 A;  4FCE A;  3BFP A;  1OCX A;  4R36 A;  5U2K A;  4G3Q A;  4E1K A;  4EGG A;  3JQY A;  2GGO A;  5AFU V;  3VBI A;  3BSS A;  2QKX A;  4HUS A;  2OI7 A;  3GVD A;  2OI6 A;  4M98 A;  2V0I A;  3HJJ A;  2JF2 A;  2WLD A;  2V0L A;  5E3R A;  3TK8 A;  3HSQ A;  3GUE A;  2W0V A;  1YP3 A;  3FSB A;  3VBJ A;  3V4E A;  1KGQ A;  2JF3 A;  3P47 A;  1THJ A;  4KNX A;  2V0J A;  4N69 A;  1HV9 A;  3VBM A;  2WLF A;  3R5D A;  2XAT A;  1KGT A;  4EA7 A;  1J2Z A;  4H7O A;  3R5B A;  4MZU A;  2Q4J A;  3PMO A;  3R0S A;  3R3I A;  4E79 A;  3C8V A;  3R5A A;  1MR9 A;  3D98 A;  3EG4 A;  4MYO A;  1SSM A;  4E6U A;  3IGJ A;  3FOQ A;  4ISX A;  3VBN A;  3OU9 A;  3P1B A;  3BSW A;  4KQL A;  1V67 A;  4K6R A;  3ST8 A;  3VBL A;  1SSQ A;  1KRR A;  1MRL A;  5E3Q A;  1FXJ A;  3FS8 A;  4HCQ A;  4M99 A;  5DEM A;  4EA8 A;  1KHR A;  5AFU U;  3GOS A;  1LXA A;  1XAT A;  2TDT A;  3R8Y A;  4AC3 A;  2I5K A;  1SST A;  2OEF A;  3FSY A;  3R5C A;  2P2O A;  3BRK X;  4G3S A;  2WLG A;  4KNR A;  1G97 A;  1QRE A;  2FKO A;  2OI5 A;  2OEG A;  3MQG A;  1V3W A;  4AAW A;  3DHO A;  4N27 A;  2IU8 A;  2WLC A;  1HM0 A;  3D8V A;  3EEV A;  3F1X A;  3NZ2 A;  4M2B A;  3TIS A;  2QIA A;  3BXY A;  3FTT A;  4KPX A;  5L6V A;  1HM9 A;  1YP2 A;  2IC7 A;  4HZC A;  3VBK A;  4N6B A;  3I3A A;  4EA9 A;  1T3D A;  4IHG A;  1G95 A;  3VNP A;  3T57 A;  3R1W A;  3MQH A;  2VD4 A;  4M2A A;  5ADX V;  3SRT A;  3DJ4 A;  3OTM A;  4M9C A;  3ECT A;  3SPT A;  1KRU A;  1QRM A;  3KWD A;  3TWD A;  1QQ0 A;  2AQ9 A;  4IHF A;  3TDT A;  4E6T A;  2NPO A;  4IHH A;  3OTZ A;  1QRF A;  4EAA A;  4AA7 A;  1MR7 A;  2WLE A;  1QRG A;  3I3X A;  4KPZ A;  2V0H A;  4M28 A;  2VHE A;  3FSC A;  2GGQ A; 
#chains in the Genus database with same CATH topology
 4R7P A;  3R3R A;  1KQA A;  3Q1X A;  3BSY A;  1XHD A;  2ICX A;  5DEP A;  2IUA A;  2QIV X;  3FWW A;  3OW5 A;  4N6A A;  1HM8 A;  1QRL A;  3GQ7 A;  4R37 A;  4DCL A;  3TV0 A;  3DK5 A;  5L6S A;  1YP4 A;  3GQ8 A;  3MC4 A;  4HUR A;  1KK4 A;  4HZD A;  3VBP A;  3FSX A;  2IU9 A;  2RIJ A;  5DG3 A;  1KRV A;  1EWW A;  3EH0 A;  4G3P A;  2V0K A;  5ADX U;  4EQY A;  1FWY A;  1KK5 A;  1TDT A;  3OUP A;  5F42 A;  3R2W A;  4EAB A;  3KWE A;  4G87 A;  2ICY A;  3TIO A;  1KK6 A;  3KWC A;  4J09 A;  1S80 A;  2W0W A;  4J18 A;  1N4I A;  3CJ8 A;  3IXC A;  1Z90 A;  5E3P A;  4MFG A;  4E75 A;  4FCE A;  3BFP A;  1OCX A;  4R36 A;  5U2K A;  4G3Q A;  4E1K A;  4EGG A;  3JQY A;  2GGO A;  5AFU V;  3VBI A;  3BSS A;  2QKX A;  4HUS A;  2OI7 A;  3GVD A;  2OI6 A;  4M98 A;  2V0I A;  3HJJ A;  2JF2 A;  2WLD A;  2V0L A;  5E3R A;  3TK8 A;  3HSQ A;  3GUE A;  2W0V A;  1YP3 A;  3FSB A;  3VBJ A;  3V4E A;  1KGQ A;  2JF3 A;  3OH4 A;  3P47 A;  1THJ A;  4KNX A;  2V0J A;  4N69 A;  1HV9 A;  3VBM A;  2WLF A;  3R5D A;  2XAT A;  1KGT A;  4EA7 A;  1J2Z A;  4H7O A;  3R5B A;  4MZU A;  2Q4J A;  3PMO A;  3R0S A;  3R3I A;  4E79 A;  3C8V A;  3R5A A;  3OH0 A;  1MR9 A;  3D98 A;  3EG4 A;  4MYO A;  3OH2 A;  1SSM A;  4E6U A;  3IGJ A;  3FOQ A;  4ISX A;  3VBN A;  3OU9 A;  3P1B A;  3BSW A;  4KQL A;  1V67 A;  4K6R A;  3ST8 A;  3VBL A;  1SSQ A;  1KRR A;  1MRL A;  5E3Q A;  1FXJ A;  3FS8 A;  3GQ9 A;  4HCQ A;  4M99 A;  5DEM A;  4EA8 A;  1KHR A;  5AFU U;  3GOS A;  3OGZ A;  1LXA A;  1XAT A;  2TDT A;  3R8Y A;  4AC3 A;  2I5K A;  1SST A;  2OEF A;  3FSY A;  3R5C A;  2P2O A;  3BRK X;  4G3S A;  2WLG A;  4KNR A;  1L0S A;  1G97 A;  1QRE A;  2FKO A;  2OI5 A;  2OEG A;  3MQG A;  1V3W A;  4AAW A;  3DHO A;  4N27 A;  2IU8 A;  2WLC A;  1HM0 A;  3D8V A;  3EEV A;  3F1X A;  3NZ2 A;  4M2B A;  3TIS A;  2QIA A;  3BXY A;  3FTT A;  4KPX A;  5L6V A;  1HM9 A;  1YP2 A;  2IC7 A;  4HZC A;  3VBK A;  4N6B A;  3I3A A;  3SUC A;  4EA9 A;  1T3D A;  4IHG A;  1G95 A;  3VNP A;  3OH1 A;  3T57 A;  3R1W A;  3MQH A;  2VD4 A;  4M2A A;  5ADX V;  3SRT A;  3DJ4 A;  3OTM A;  4M9C A;  1M8N A;  3ECT A;  3SPT A;  1KRU A;  1QRM A;  3KWD A;  3GQA A;  3TWD A;  1QQ0 A;  2AQ9 A;  4IHF A;  3TDT A;  4E6T A;  2NPO A;  4IHH A;  3OTZ A;  1QRF A;  4EAA A;  4AA7 A;  1MR7 A;  2WLE A;  1QRG A;  1Z2F A;  3I3X A;  4KPZ A;  2V0H A;  4M28 A;  2VHE A;  3FSC A;  2GGQ A;  3OH3 A; 
#chains in the Genus database with same CATH homology
 4R7P A;  3R3R A;  1KQA A;  3Q1X A;  3BSY A;  1XHD A;  2ICX A;  5DEP A;  2IUA A;  2QIV X;  3FWW A;  3OW5 A;  4N6A A;  1HM8 A;  1QRL A;  4R37 A;  4DCL A;  3TV0 A;  3DK5 A;  5L6S A;  1YP4 A;  3MC4 A;  4HUR A;  4HZD A;  1KK4 A;  3VBP A;  3FSX A;  2IU9 A;  2RIJ A;  5DG3 A;  1KRV A;  3EH0 A;  4G3P A;  2V0K A;  5ADX U;  4EQY A;  1FWY A;  1KK5 A;  1TDT A;  3OUP A;  5F42 A;  3R2W A;  4EAB A;  3KWE A;  4G87 A;  2ICY A;  3TIO A;  1KK6 A;  3KWC A;  4J09 A;  1S80 A;  2W0W A;  4J18 A;  3CJ8 A;  3IXC A;  5E3P A;  1Z90 A;  4MFG A;  4E75 A;  4FCE A;  3BFP A;  1OCX A;  4R36 A;  5U2K A;  4G3Q A;  4E1K A;  4EGG A;  3JQY A;  2GGO A;  5AFU V;  3VBI A;  3BSS A;  2QKX A;  4HUS A;  2OI7 A;  3GVD A;  2OI6 A;  4M98 A;  2V0I A;  3HJJ A;  2JF2 A;  2WLD A;  2V0L A;  5E3R A;  3TK8 A;  3HSQ A;  3GUE A;  2W0V A;  1YP3 A;  3FSB A;  3VBJ A;  3V4E A;  1KGQ A;  2JF3 A;  3P47 A;  1THJ A;  4KNX A;  2V0J A;  4N69 A;  1HV9 A;  3VBM A;  2WLF A;  3R5D A;  2XAT A;  1KGT A;  4EA7 A;  1J2Z A;  4H7O A;  3R5B A;  4MZU A;  2Q4J A;  3PMO A;  3R0S A;  3R3I A;  4E79 A;  3C8V A;  3R5A A;  1MR9 A;  3D98 A;  3EG4 A;  4MYO A;  1SSM A;  4E6U A;  3IGJ A;  3FOQ A;  4ISX A;  3VBN A;  3OU9 A;  3P1B A;  3BSW A;  4KQL A;  1V67 A;  4K6R A;  3ST8 A;  3VBL A;  1SSQ A;  1KRR A;  1MRL A;  5E3Q A;  1FXJ A;  3FS8 A;  4HCQ A;  4M99 A;  5DEM A;  4EA8 A;  1KHR A;  5AFU U;  3GOS A;  1LXA A;  1XAT A;  2TDT A;  3R8Y A;  4AC3 A;  2I5K A;  1SST A;  2OEF A;  3FSY A;  3R5C A;  2P2O A;  3BRK X;  4G3S A;  2WLG A;  4KNR A;  1G97 A;  1QRE A;  2FKO A;  2OI5 A;  2OEG A;  3MQG A;  1V3W A;  4AAW A;  3DHO A;  4N27 A;  2IU8 A;  2WLC A;  1HM0 A;  3D8V A;  3EEV A;  3F1X A;  3NZ2 A;  4M2B A;  3TIS A;  2QIA A;  3BXY A;  3FTT A;  4KPX A;  5L6V A;  1HM9 A;  1YP2 A;  2IC7 A;  4HZC A;  3VBK A;  4N6B A;  3I3A A;  4EA9 A;  1T3D A;  4IHG A;  1G95 A;  3VNP A;  3T57 A;  3R1W A;  3MQH A;  2VD4 A;  4M2A A;  5ADX V;  3SRT A;  3DJ4 A;  3OTM A;  4M9C A;  3ECT A;  3SPT A;  1KRU A;  1QRM A;  3KWD A;  3TWD A;  1QQ0 A;  2AQ9 A;  4IHF A;  3TDT A;  4E6T A;  2NPO A;  4IHH A;  3OTZ A;  1QRF A;  4EAA A;  4AA7 A;  1MR7 A;  2WLE A;  1QRG A;  3I3X A;  4KPZ A;  2V0H A;  4M28 A;  2VHE A;  3FSC A;  2GGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...