3NZ2A

Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
182
structure length
182
Chain Sequence
MSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
molecule keywords Hexapeptide-repeat containing-acetyltransferase
total genus 62
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3nz2A00
1XATA 1FWYA 2Q4JA 2W0VA 3DK5A 2V0JA 5AFUU 3OU9A 3R3IA 5E3RA 3R8YA 5AFUV 1HM0A 3JQYA 4M2AA 3EH0A 4M2BA 3NZ2A 3I3XA 3VBPA 1QREA 2NPOA 3TK8A 1KRUA 4FCEA 3OW5A 4HUSA 1V67A 4MFGA 2RIJA 1XHDA 5F42A 2WLCA 3ST8A 1SSMA 3CJ8A 2VHEA 3TDTA 4KNRA 3VBNA 3IXCA 4H7OA 1YP2A 3BFPA 3R5BA 1KRRA 3FWWA 1Z90A 3P47A 4J09A 4N69A 4E75A 4E6TA 3BSWA 4HZDA 4EGGA 5L6SA 2ICXA 2TDTA 2QIAA 3VBJA 4AAWA 3V4EA 2GGQA 4AA7A 3TV0A 1QQ0A 1YP4A 1THJA 3FS8A 4EAAA 2IC7A 4M28A 3DJ4A 3R2WA 3D8VA 4G87A 4EA9A 2XATA 3R0SA 3FSCA 4EQYA 3MC4A 3R5DA 4M9CA 1SSQA 5L6VA 3VBMA 3HJJA 3C8VA 4HURA 3F1XA 4J18A 3SRTA 4IHHA 1HM9A 1QRFA 3MQHA 1G95A 5E3PA 1OCXA 3BSSA 3TIOA 3OTMA 4HZCA 3BRKX 1KK6A 1LXAA 3Q1XA 3SPTA 4KPXA 5U2KA 1KGQA 1KRVA 4KPZA 2OEFA 1T3DA 1KK4A 1FXJA 1KGTA 3ECTA 2QKXA 2OI7A 3KWEA 3R1WA 3MQGA 1MR9A 2OEGA 3D98A 2VD4A 1G97A 1S80A 3PMOA 2FKOA 4K6RA 1QRLA 1HV9A 4N27A 2WLFA 3GUEA 4G3QA 2IU8A 2AQ9A 3FSXA 3KWDA 3KWCA 1KK5A 1KQAA 4KNXA 3T57A 4N6AA 3R3RA 4HCQA 3EEVA 3IGJA 4EA8A 2WLGA 3EG4A 4EABA 2JF2A 2V0KA 3GVDA 5DEPA 3P1BA 4M99A 3I3AA 2JF3A 3FSYA 2WLEA 1V3WA 2W0WA 4ISXA 3VBLA 1KHRA 5E3QA 4EA7A 3HSQA 5DG3A 1YP3A 3BXYA 3OTZA 4MYOA 3TISA 4AC3A 4DCLA 5ADXU 2GGOA 2OI5A 3VNPA 4N6BA 2P2OA 4R7PA 2V0LA 3BSYA 3FTTA 3FOQA 4E1KA 4G3SA 3R5CA 2QIVX 2IUAA 4R36A 4E79A 4KQLA 4G3PA 3VBIA 1MR7A 2IU9A 3GOSA 3VBKA 2V0IA 4R37A 1MRLA 3OUPA 2V0HA 4IHFA 2ICYA 4M98A 2WLDA 1QRGA 3FSBA 1TDTA 4IHGA 3DHOA 2I5KA 2OI6A 1HM8A 1J2ZA 1SSTA 3R5AA 3TWDA 5DEMA 4E6UA 5ADXV 1QRMA 4MZUA
chains in the Genus database with same CATH superfamily
1XATA 1FWYA 2Q4JA 2W0VA 3DK5A 2V0JA 5AFUU 3OU9A 3R3IA 5E3RA 3R8YA 5AFUV 1HM0A 3JQYA 4M2AA 3EH0A 4M2BA 3NZ2A 3I3XA 3VBPA 1QREA 2NPOA 3TK8A 1KRUA 4FCEA 3OW5A 4HUSA 1V67A 4MFGA 2RIJA 3GQ9A 1XHDA 3OGZA 2WLCA 5F42A 1SSMA 3ST8A 3CJ8A 2VHEA 3TDTA 4KNRA 3VBNA 3IXCA 4H7OA 1YP2A 3BFPA 3R5BA 1KRRA 3FWWA 1L0SA 1Z90A 3OH3A 3P47A 4J09A 4N69A 4E75A 3OH2A 3SUCA 3BSWA 4E6TA 4HZDA 4EGGA 5L6SA 2ICXA 2TDTA 2QIAA 3VBJA 4AAWA 3V4EA 2GGQA 3GQ7A 4AA7A 3TV0A 1QQ0A 1YP4A 1THJA 3FS8A 4EAAA 2IC7A 4M28A 3DJ4A 3R2WA 3D8VA 4G87A 4EA9A 2XATA 3R0SA 3FSCA 4EQYA 3MC4A 3R5DA 4M9CA 1SSQA 5L6VA 3VBMA 3HJJA 3C8VA 4HURA 3F1XA 4J18A 3SRTA 4IHHA 1HM9A 1QRFA 3MQHA 1G95A 5E3PA 1OCXA 3BSSA 3TIOA 3OTMA 4HZCA 3BRKX 1KK6A 1LXAA 3Q1XA 3SPTA 1Z2FA 4KPXA 5U2KA 1KGQA 1KRVA 4KPZA 2OEFA 1T3DA 1KK4A 1FXJA 1KGTA 3ECTA 2QKXA 2OI7A 3KWEA 3R1WA 3MQGA 1MR9A 1EWWA 2OEGA 3D98A 2VD4A 1G97A 1S80A 3PMOA 2FKOA 4K6RA 1QRLA 1HV9A 4N27A 2WLFA 3GUEA 4G3QA 2IU8A 2AQ9A 3FSXA 3KWDA 3KWCA 1KK5A 1KQAA 4KNXA 3T57A 4N6AA 3R3RA 4HCQA 3EEVA 3GQAA 3IGJA 4EA8A 2WLGA 3EG4A 4EABA 2JF2A 3OH0A 2V0KA 3GVDA 5DEPA 3P1BA 4M99A 3I3AA 2JF3A 3FSYA 2WLEA 3OH4A 1V3WA 2W0WA 4ISXA 3VBLA 1KHRA 5E3QA 4EA7A 1M8NA 3GQ8A 3HSQA 5DG3A 1YP3A 3BXYA 3OTZA 4MYOA 3TISA 4AC3A 4DCLA 5ADXU 2GGOA 2OI5A 3VNPA 4N6BA 2P2OA 4R7PA 2V0LA 3BSYA 3FTTA 3FOQA 4E1KA 4G3SA 3R5CA 2QIVX 2IUAA 4R36A 4E79A 4KQLA 4G3PA 3VBIA 1MR7A 2IU9A 3GOSA 3VBKA 2V0IA 4R37A 1MRLA 1N4IA 3OUPA 2V0HA 4IHFA 2ICYA 4M98A 2WLDA 1QRGA 3FSBA 1TDTA 4IHGA 3DHOA 2I5KA 2OI6A 1HM8A 1J2ZA 1SSTA 3OH1A 3R5AA 3TWDA 5DEMA 4E6UA 5ADXV 1QRMA 4MZUA
chains in the Genus database with same CATH topology
1XATA 1FWYA 2Q4JA 2W0VA 3DK5A 2V0JA 5AFUU 3OU9A 3R3IA 5E3RA 3R8YA 5AFUV 1HM0A 3JQYA 4M2AA 3EH0A 4M2BA 3NZ2A 3I3XA 3VBPA 1QREA 2NPOA 3TK8A 1KRUA 4FCEA 3OW5A 4HUSA 1V67A 4MFGA 2RIJA 1XHDA 5F42A 2WLCA 3ST8A 1SSMA 3CJ8A 2VHEA 3TDTA 4KNRA 3VBNA 3IXCA 4H7OA 1YP2A 3BFPA 3R5BA 1KRRA 3FWWA 1Z90A 3P47A 4J09A 4N69A 4E75A 4E6TA 3BSWA 4HZDA 4EGGA 5L6SA 2ICXA 2TDTA 2QIAA 3VBJA 4AAWA 3V4EA 2GGQA 4AA7A 3TV0A 1QQ0A 1YP4A 1THJA 3FS8A 4EAAA 2IC7A 4M28A 3DJ4A 3R2WA 3D8VA 4G87A 4EA9A 2XATA 3R0SA 3FSCA 4EQYA 3MC4A 3R5DA 4M9CA 1SSQA 5L6VA 3VBMA 3HJJA 3C8VA 4HURA 3F1XA 4J18A 3SRTA 4IHHA 1HM9A 1QRFA 3MQHA 1G95A 5E3PA 1OCXA 3BSSA 3TIOA 3OTMA 4HZCA 3BRKX 1KK6A 1LXAA 3Q1XA 3SPTA 4KPXA 5U2KA 1KGQA 1KRVA 4KPZA 2OEFA 1T3DA 1KK4A 1FXJA 1KGTA 3ECTA 2QKXA 2OI7A 3KWEA 3R1WA 3MQGA 1MR9A 2OEGA 3D98A 2VD4A 1G97A 1S80A 3PMOA 2FKOA 4K6RA 1QRLA 1HV9A 4N27A 2WLFA 3GUEA 4G3QA 2IU8A 2AQ9A 3FSXA 3KWDA 3KWCA 1KK5A 1KQAA 4KNXA 3T57A 4N6AA 3R3RA 4HCQA 3EEVA 3IGJA 4EA8A 2WLGA 3EG4A 4EABA 2JF2A 2V0KA 3GVDA 5DEPA 3P1BA 4M99A 3I3AA 2JF3A 3FSYA 2WLEA 1V3WA 2W0WA 4ISXA 3VBLA 1KHRA 5E3QA 4EA7A 3HSQA 5DG3A 1YP3A 3BXYA 3OTZA 4MYOA 3TISA 4AC3A 4DCLA 5ADXU 2GGOA 2OI5A 3VNPA 4N6BA 2P2OA 4R7PA 2V0LA 3BSYA 3FTTA 3FOQA 4E1KA 4G3SA 3R5CA 2QIVX 2IUAA 4R36A 4E79A 4KQLA 4G3PA 3VBIA 1MR7A 2IU9A 3GOSA 3VBKA 2V0IA 4R37A 1MRLA 3OUPA 2V0HA 4IHFA 2ICYA 4M98A 2WLDA 1QRGA 3FSBA 1TDTA 4IHGA 3DHOA 2I5KA 2OI6A 1HM8A 1J2ZA 1SSTA 3R5AA 3TWDA 5DEMA 4E6UA 5ADXV 1QRMA 4MZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XAT A;  1FWY A;  2Q4J A;  2W0V A;  3DK5 A;  2V0J A;  5AFU U;  3OU9 A;  3R3I A;  5E3R A;  3R8Y A;  5AFU V;  1HM0 A;  3JQY A;  4M2A A;  3EH0 A;  4M2B A;  3NZ2 A;  3I3X A;  3VBP A;  1QRE A;  2NPO A;  3TK8 A;  1KRU A;  4FCE A;  3OW5 A;  4HUS A;  1V67 A;  4MFG A;  2RIJ A;  1XHD A;  5F42 A;  2WLC A;  3ST8 A;  1SSM A;  3CJ8 A;  2VHE A;  3TDT A;  4KNR A;  3VBN A;  3IXC A;  4H7O A;  1YP2 A;  3BFP A;  3R5B A;  1KRR A;  3FWW A;  1Z90 A;  3P47 A;  4J09 A;  4N69 A;  4E75 A;  4E6T A;  3BSW A;  4HZD A;  4EGG A;  5L6S A;  2ICX A;  2TDT A;  2QIA A;  3VBJ A;  4AAW A;  3V4E A;  2GGQ A;  4AA7 A;  3TV0 A;  1QQ0 A;  1YP4 A;  1THJ A;  3FS8 A;  4EAA A;  2IC7 A;  4M28 A;  3DJ4 A;  3R2W A;  3D8V A;  4G87 A;  4EA9 A;  2XAT A;  3R0S A;  3FSC A;  4EQY A;  3MC4 A;  3R5D A;  4M9C A;  1SSQ A;  5L6V A;  3VBM A;  3HJJ A;  3C8V A;  4HUR A;  3F1X A;  4J18 A;  3SRT A;  4IHH A;  1HM9 A;  1QRF A;  3MQH A;  1G95 A;  5E3P A;  1OCX A;  3BSS A;  3TIO A;  3OTM A;  4HZC A;  3BRK X;  1KK6 A;  1LXA A;  3Q1X A;  3SPT A;  4KPX A;  5U2K A;  1KGQ A;  1KRV A;  4KPZ A;  2OEF A;  1T3D A;  1KK4 A;  1FXJ A;  1KGT A;  3ECT A;  2QKX A;  2OI7 A;  3KWE A;  3R1W A;  3MQG A;  1MR9 A;  2OEG A;  3D98 A;  2VD4 A;  1G97 A;  1S80 A;  3PMO A;  2FKO A;  4K6R A;  1QRL A;  1HV9 A;  4N27 A;  2WLF A;  3GUE A;  4G3Q A;  2IU8 A;  2AQ9 A;  3FSX A;  3KWD A;  3KWC A;  1KK5 A;  1KQA A;  4KNX A;  3T57 A;  4N6A A;  3R3R A;  4HCQ A;  3EEV A;  3IGJ A;  4EA8 A;  2WLG A;  3EG4 A;  4EAB A;  2JF2 A;  2V0K A;  3GVD A;  5DEP A;  3P1B A;  4M99 A;  3I3A A;  2JF3 A;  3FSY A;  2WLE A;  1V3W A;  2W0W A;  4ISX A;  3VBL A;  1KHR A;  5E3Q A;  4EA7 A;  3HSQ A;  5DG3 A;  1YP3 A;  3BXY A;  3OTZ A;  4MYO A;  3TIS A;  4AC3 A;  4DCL A;  5ADX U;  2GGO A;  2OI5 A;  3VNP A;  4N6B A;  2P2O A;  4R7P A;  2V0L A;  3BSY A;  3FTT A;  3FOQ A;  4E1K A;  4G3S A;  3R5C A;  2QIV X;  2IUA A;  4R36 A;  4E79 A;  4KQL A;  4G3P A;  3VBI A;  1MR7 A;  2IU9 A;  3GOS A;  3VBK A;  2V0I A;  4R37 A;  1MRL A;  3OUP A;  2V0H A;  4IHF A;  2ICY A;  4M98 A;  2WLD A;  1QRG A;  3FSB A;  1TDT A;  4IHG A;  3DHO A;  2I5K A;  2OI6 A;  1HM8 A;  1J2Z A;  1SST A;  3R5A A;  3TWD A;  5DEM A;  4E6U A;  5ADX V;  1QRM A;  4MZU A; 
#chains in the Genus database with same CATH topology
 1XAT A;  1FWY A;  2Q4J A;  2W0V A;  3DK5 A;  2V0J A;  5AFU U;  3OU9 A;  3R3I A;  5E3R A;  3R8Y A;  5AFU V;  1HM0 A;  3JQY A;  4M2A A;  3EH0 A;  4M2B A;  3NZ2 A;  3I3X A;  3VBP A;  1QRE A;  2NPO A;  3TK8 A;  1KRU A;  4FCE A;  3OW5 A;  4HUS A;  1V67 A;  4MFG A;  2RIJ A;  3GQ9 A;  1XHD A;  3OGZ A;  2WLC A;  5F42 A;  1SSM A;  3ST8 A;  3CJ8 A;  2VHE A;  3TDT A;  4KNR A;  3VBN A;  3IXC A;  4H7O A;  1YP2 A;  3BFP A;  3R5B A;  1KRR A;  3FWW A;  1L0S A;  1Z90 A;  3OH3 A;  3P47 A;  4J09 A;  4N69 A;  4E75 A;  3OH2 A;  3SUC A;  3BSW A;  4E6T A;  4HZD A;  4EGG A;  5L6S A;  2ICX A;  2TDT A;  2QIA A;  3VBJ A;  4AAW A;  3V4E A;  2GGQ A;  3GQ7 A;  4AA7 A;  3TV0 A;  1QQ0 A;  1YP4 A;  1THJ A;  3FS8 A;  4EAA A;  2IC7 A;  4M28 A;  3DJ4 A;  3R2W A;  3D8V A;  4G87 A;  4EA9 A;  2XAT A;  3R0S A;  3FSC A;  4EQY A;  3MC4 A;  3R5D A;  4M9C A;  1SSQ A;  5L6V A;  3VBM A;  3HJJ A;  3C8V A;  4HUR A;  3F1X A;  4J18 A;  3SRT A;  4IHH A;  1HM9 A;  1QRF A;  3MQH A;  1G95 A;  5E3P A;  1OCX A;  3BSS A;  3TIO A;  3OTM A;  4HZC A;  3BRK X;  1KK6 A;  1LXA A;  3Q1X A;  3SPT A;  1Z2F A;  4KPX A;  5U2K A;  1KGQ A;  1KRV A;  4KPZ A;  2OEF A;  1T3D A;  1KK4 A;  1FXJ A;  1KGT A;  3ECT A;  2QKX A;  2OI7 A;  3KWE A;  3R1W A;  3MQG A;  1MR9 A;  1EWW A;  2OEG A;  3D98 A;  2VD4 A;  1G97 A;  1S80 A;  3PMO A;  2FKO A;  4K6R A;  1QRL A;  1HV9 A;  4N27 A;  2WLF A;  3GUE A;  4G3Q A;  2IU8 A;  2AQ9 A;  3FSX A;  3KWD A;  3KWC A;  1KK5 A;  1KQA A;  4KNX A;  3T57 A;  4N6A A;  3R3R A;  4HCQ A;  3EEV A;  3GQA A;  3IGJ A;  4EA8 A;  2WLG A;  3EG4 A;  4EAB A;  2JF2 A;  3OH0 A;  2V0K A;  3GVD A;  5DEP A;  3P1B A;  4M99 A;  3I3A A;  2JF3 A;  3FSY A;  2WLE A;  3OH4 A;  1V3W A;  2W0W A;  4ISX A;  3VBL A;  1KHR A;  5E3Q A;  4EA7 A;  1M8N A;  3GQ8 A;  3HSQ A;  5DG3 A;  1YP3 A;  3BXY A;  3OTZ A;  4MYO A;  3TIS A;  4AC3 A;  4DCL A;  5ADX U;  2GGO A;  2OI5 A;  3VNP A;  4N6B A;  2P2O A;  4R7P A;  2V0L A;  3BSY A;  3FTT A;  3FOQ A;  4E1K A;  4G3S A;  3R5C A;  2QIV X;  2IUA A;  4R36 A;  4E79 A;  4KQL A;  4G3P A;  3VBI A;  1MR7 A;  2IU9 A;  3GOS A;  3VBK A;  2V0I A;  4R37 A;  1MRL A;  1N4I A;  3OUP A;  2V0H A;  4IHF A;  2ICY A;  4M98 A;  2WLD A;  1QRG A;  3FSB A;  1TDT A;  4IHG A;  3DHO A;  2I5K A;  2OI6 A;  1HM8 A;  1J2Z A;  1SST A;  3OH1 A;  3R5A A;  3TWD A;  5DEM A;  4E6U A;  5ADX V;  1QRM A;  4MZU A; 
#chains in the Genus database with same CATH homology
 1XAT A;  1FWY A;  2Q4J A;  2W0V A;  3DK5 A;  2V0J A;  5AFU U;  3OU9 A;  3R3I A;  5E3R A;  3R8Y A;  5AFU V;  1HM0 A;  3JQY A;  4M2A A;  3EH0 A;  4M2B A;  3NZ2 A;  3I3X A;  3VBP A;  1QRE A;  2NPO A;  3TK8 A;  1KRU A;  4FCE A;  3OW5 A;  4HUS A;  1V67 A;  4MFG A;  2RIJ A;  1XHD A;  5F42 A;  2WLC A;  3ST8 A;  1SSM A;  3CJ8 A;  2VHE A;  3TDT A;  4KNR A;  3VBN A;  3IXC A;  4H7O A;  1YP2 A;  3BFP A;  3R5B A;  1KRR A;  3FWW A;  1Z90 A;  3P47 A;  4J09 A;  4N69 A;  4E75 A;  4E6T A;  3BSW A;  4HZD A;  4EGG A;  5L6S A;  2ICX A;  2TDT A;  2QIA A;  3VBJ A;  4AAW A;  3V4E A;  2GGQ A;  4AA7 A;  3TV0 A;  1QQ0 A;  1YP4 A;  1THJ A;  3FS8 A;  4EAA A;  2IC7 A;  4M28 A;  3DJ4 A;  3R2W A;  3D8V A;  4G87 A;  4EA9 A;  2XAT A;  3R0S A;  3FSC A;  4EQY A;  3MC4 A;  3R5D A;  4M9C A;  1SSQ A;  5L6V A;  3VBM A;  3HJJ A;  3C8V A;  4HUR A;  3F1X A;  4J18 A;  3SRT A;  4IHH A;  1HM9 A;  1QRF A;  3MQH A;  1G95 A;  5E3P A;  1OCX A;  3BSS A;  3TIO A;  3OTM A;  4HZC A;  3BRK X;  1KK6 A;  1LXA A;  3Q1X A;  3SPT A;  4KPX A;  5U2K A;  1KGQ A;  1KRV A;  4KPZ A;  2OEF A;  1T3D A;  1KK4 A;  1FXJ A;  1KGT A;  3ECT A;  2QKX A;  2OI7 A;  3KWE A;  3R1W A;  3MQG A;  1MR9 A;  2OEG A;  3D98 A;  2VD4 A;  1G97 A;  1S80 A;  3PMO A;  2FKO A;  4K6R A;  1QRL A;  1HV9 A;  4N27 A;  2WLF A;  3GUE A;  4G3Q A;  2IU8 A;  2AQ9 A;  3FSX A;  3KWD A;  3KWC A;  1KK5 A;  1KQA A;  4KNX A;  3T57 A;  4N6A A;  3R3R A;  4HCQ A;  3EEV A;  3IGJ A;  4EA8 A;  2WLG A;  3EG4 A;  4EAB A;  2JF2 A;  2V0K A;  3GVD A;  5DEP A;  3P1B A;  4M99 A;  3I3A A;  2JF3 A;  3FSY A;  2WLE A;  1V3W A;  2W0W A;  4ISX A;  3VBL A;  1KHR A;  5E3Q A;  4EA7 A;  3HSQ A;  5DG3 A;  1YP3 A;  3BXY A;  3OTZ A;  4MYO A;  3TIS A;  4AC3 A;  4DCL A;  5ADX U;  2GGO A;  2OI5 A;  3VNP A;  4N6B A;  2P2O A;  4R7P A;  2V0L A;  3BSY A;  3FTT A;  3FOQ A;  4E1K A;  4G3S A;  3R5C A;  2QIV X;  2IUA A;  4R36 A;  4E79 A;  4KQL A;  4G3P A;  3VBI A;  1MR7 A;  2IU9 A;  3GOS A;  3VBK A;  2V0I A;  4R37 A;  1MRL A;  3OUP A;  2V0H A;  4IHF A;  2ICY A;  4M98 A;  2WLD A;  1QRG A;  3FSB A;  1TDT A;  4IHG A;  3DHO A;  2I5K A;  2OI6 A;  1HM8 A;  1J2Z A;  1SST A;  3R5A A;  3TWD A;  5DEM A;  4E6U A;  5ADX V;  1QRM A;  4MZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...