5DEPA

Structure of pseudomonas aeruginosa lpxa in complex with udp-glcnac
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
b'MSLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain pa7)
molecule tags Transferase
total genus 107
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5depA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5depA01
2OI5A 5E3PA 4EAAA 3GOSA 2V0KA 4KPXA 3IGJA 2GGOA 1MRLA 3BXYA 3OTZA 3TWDA 2ICYA 4E6TA 3FSYA 3SPTA 1HM8A 1G95A 1SSTA 3NZ2A 3EG4A 2VD4A 3BSWA 4MFGA 1TDTA 3VBNA 3TV0A 1QRFA 1QRMA 5ADXV 4G87A 1XATA 2WLGA 3GVDA 4HURA 3I3AA 4M98A 3R5AA 4G3SA 4KNXA 1KRUA 4E79A 4EA8A 4N6BA 1KK5A 3DHOA 3F1XA 3MQHA 4E1KA 2RIJA 2I5KA 1FXJA 2GGQA 3VBJA 3CJ8A 3T57A 3Q1XA 3R3IA 4M2AA 2WLCA 5ADXU 1KGQA 3D8VA 2V0LA 3IXCA 2W0WA 1S80A 2VHEA 3R5BA 3TISA 2Q4JA 3TIOA 5L6VA 3R2WA 4R36A 1Z90A 3KWCA 2FKOA 4FCEA 2JF2A 1QRGA 3R5DA 4MYOA 3C8VA 1OCXA 1T3DA 1THJA 3DJ4A 3I3XA 4E6UA 2WLEA 3OU9A 3HJJA 3DK5A 3KWDA 3D98A 5DEPA 4N6AA 2OI6A 3FSBA 4J09A 3HSQA 3V4EA 4K6RA 4EGGA 2AQ9A 3EEVA 3EH0A 4EA9A 4IHHA 4AAWA 1SSMA 2TDTA 1HM0A 4G3QA 2V0IA 3KWEA 1YP4A 2XATA 4AC3A 2QKXA 1J2ZA 4HZDA 5E3RA 1KHRA 1G97A 2V0JA 2WLFA 3ST8A 4MZUA 3BSYA 4HZCA 2IU9A 3JQYA 3TK8A 3VBMA 3FOQA 1MR9A 5L6SA 1KGTA 4HCQA 3MC4A 5U2KA 1KK4A 1QQ0A 3R1WA 3SRTA 1YP3A 3PMOA 2OEFA 4KQLA 4M99A 1KK6A 2IU8A 5E3QA 3TDTA 1FWYA 3OUPA 3VNPA 2W0VA 3OW5A 3R8YA 2WLDA 1QREA 4ISXA 3R3RA 3BSSA 4M9CA 3GUEA 1XHDA 4R37A 4EABA 2OEGA 3FSXA 3ECTA 3BFPA 3R5CA 5DG3A 1SSQA 3FS8A 4N69A 5AFUV 4H7OA 3VBPA 3P47A 1QRLA 1YP2A 4M2BA 4DCLA 3VBIA 3OTMA 4N27A 4EQYA 2P2OA 2NPOA 4G3PA 2IC7A 3VBLA 3R0SA 2QIAA 5F42A 3VBKA 3FTTA 1LXAA 1KRVA 4HUSA 2QIVX 3BRKX 4IHFA 4E75A 1MR7A 3P1BA 4AA7A 5AFUU 2OI7A 4KNRA 4KPZA 1HV9A 2JF3A 4M28A 1KRRA 2V0HA 3FSCA 1V3WA 4IHGA 1KQAA 5DEMA 2ICXA 1HM9A 2IUAA 3FWWA 4J18A 4R7PA 1V67A 3MQGA 4EA7A
chains in the Genus database with same CATH superfamily
2OI5A 5E3PA 4EAAA 3GOSA 2V0KA 4KPXA 3IGJA 2GGOA 1MRLA 3BXYA 3OTZA 3TWDA 2ICYA 4E6TA 3FSYA 3SPTA 1HM8A 1G95A 1SSTA 3OH3A 3NZ2A 3EG4A 2VD4A 3BSWA 4MFGA 1TDTA 3VBNA 3TV0A 1QRFA 1QRMA 5ADXV 4G87A 1XATA 2WLGA 3GVDA 4HURA 3I3AA 4M98A 3R5AA 4G3SA 4KNXA 1KRUA 3OH4A 4E79A 4EA8A 4N6BA 1KK5A 3DHOA 3F1XA 3MQHA 4E1KA 2RIJA 2I5KA 1FXJA 2GGQA 3VBJA 3CJ8A 3T57A 3Q1XA 3R3IA 4M2AA 2WLCA 3OH2A 1KGQA 5ADXU 3D8VA 1N4IA 2V0LA 3IXCA 2W0WA 1S80A 2VHEA 3R5BA 3TISA 3OGZA 2Q4JA 3TIOA 5L6VA 3R2WA 4R36A 1Z90A 3KWCA 2FKOA 4FCEA 1L0SA 2JF2A 1QRGA 3R5DA 4MYOA 3C8VA 1OCXA 1T3DA 1THJA 3DJ4A 3I3XA 4E6UA 2WLEA 3OU9A 1M8NA 3HJJA 3DK5A 3GQAA 3KWDA 3D98A 5DEPA 4N6AA 2OI6A 3FSBA 4J09A 3HSQA 3V4EA 4K6RA 4EGGA 2AQ9A 3EEVA 3EH0A 4EA9A 3OH1A 4IHHA 4AAWA 1SSMA 2TDTA 1HM0A 4G3QA 2V0IA 3KWEA 1YP4A 2XATA 4AC3A 2QKXA 1J2ZA 4HZDA 5E3RA 1KHRA 3SUCA 1G97A 2V0JA 2WLFA 3ST8A 4MZUA 3BSYA 4HZCA 2IU9A 3JQYA 3TK8A 3VBMA 3FOQA 1MR9A 5L6SA 1KGTA 4HCQA 3MC4A 5U2KA 1KK4A 1QQ0A 3R1WA 3SRTA 1Z2FA 1YP3A 3PMOA 2OEFA 4KQLA 4M99A 1KK6A 2IU8A 5E3QA 3TDTA 1FWYA 3OUPA 3VNPA 2W0VA 3OW5A 3R8YA 2WLDA 1QREA 4ISXA 3R3RA 3BSSA 4M9CA 3GUEA 1XHDA 4R37A 4EABA 2OEGA 3FSXA 3ECTA 3GQ7A 3BFPA 3R5CA 5DG3A 1SSQA 3FS8A 4N69A 5AFUV 1EWWA 4H7OA 3VBPA 3P47A 3GQ8A 1QRLA 1YP2A 3OH0A 4M2BA 4DCLA 3VBIA 3OTMA 4N27A 4EQYA 2P2OA 2NPOA 4G3PA 2IC7A 3VBLA 3R0SA 2QIAA 5F42A 3VBKA 3FTTA 1LXAA 1KRVA 4HUSA 2QIVX 3BRKX 4IHFA 4E75A 1MR7A 3P1BA 4AA7A 5AFUU 2OI7A 4KNRA 4KPZA 1HV9A 2JF3A 3GQ9A 1KRRA 4M28A 2V0HA 3FSCA 1V3WA 4IHGA 1KQAA 5DEMA 2ICXA 1HM9A 2IUAA 3FWWA 4J18A 4R7PA 1V67A 3MQGA 4EA7A
chains in the Genus database with same CATH topology
2OI5A 5E3PA 4EAAA 3GOSA 2V0KA 4KPXA 3IGJA 2GGOA 1MRLA 3BXYA 3OTZA 3TWDA 2ICYA 4E6TA 3FSYA 3SPTA 1HM8A 1G95A 1SSTA 3NZ2A 3EG4A 2VD4A 3BSWA 4MFGA 1TDTA 3VBNA 3TV0A 1QRFA 1QRMA 5ADXV 4G87A 1XATA 2WLGA 3GVDA 4HURA 3I3AA 4M98A 3R5AA 4G3SA 4KNXA 1KRUA 4E79A 4EA8A 4N6BA 1KK5A 3DHOA 3F1XA 3MQHA 4E1KA 2RIJA 2I5KA 1FXJA 2GGQA 3VBJA 3CJ8A 3T57A 3Q1XA 3R3IA 4M2AA 2WLCA 5ADXU 1KGQA 3D8VA 2V0LA 3IXCA 2W0WA 1S80A 2VHEA 3R5BA 3TISA 2Q4JA 3TIOA 5L6VA 3R2WA 4R36A 1Z90A 3KWCA 2FKOA 4FCEA 2JF2A 1QRGA 3R5DA 4MYOA 3C8VA 1OCXA 1T3DA 1THJA 3DJ4A 3I3XA 4E6UA 2WLEA 3OU9A 3HJJA 3DK5A 3KWDA 3D98A 5DEPA 4N6AA 2OI6A 3FSBA 4J09A 3HSQA 3V4EA 4K6RA 4EGGA 2AQ9A 3EEVA 3EH0A 4EA9A 4IHHA 4AAWA 1SSMA 2TDTA 1HM0A 4G3QA 2V0IA 3KWEA 1YP4A 2XATA 4AC3A 2QKXA 1J2ZA 4HZDA 5E3RA 1KHRA 1G97A 2V0JA 2WLFA 3ST8A 4MZUA 3BSYA 4HZCA 2IU9A 3JQYA 3TK8A 3VBMA 3FOQA 1MR9A 5L6SA 1KGTA 4HCQA 3MC4A 5U2KA 1KK4A 1QQ0A 3R1WA 3SRTA 1YP3A 3PMOA 2OEFA 4KQLA 4M99A 1KK6A 2IU8A 5E3QA 3TDTA 1FWYA 3OUPA 3VNPA 2W0VA 3OW5A 3R8YA 2WLDA 1QREA 4ISXA 3R3RA 3BSSA 4M9CA 3GUEA 1XHDA 4R37A 4EABA 2OEGA 3FSXA 3ECTA 3BFPA 3R5CA 5DG3A 1SSQA 3FS8A 4N69A 5AFUV 4H7OA 3VBPA 3P47A 1QRLA 1YP2A 4M2BA 4DCLA 3VBIA 3OTMA 4N27A 4EQYA 2P2OA 2NPOA 4G3PA 2IC7A 3VBLA 3R0SA 2QIAA 5F42A 3VBKA 3FTTA 1LXAA 1KRVA 4HUSA 2QIVX 3BRKX 4IHFA 4E75A 1MR7A 3P1BA 4AA7A 5AFUU 2OI7A 4KNRA 4KPZA 1HV9A 2JF3A 4M28A 1KRRA 2V0HA 3FSCA 1V3WA 4IHGA 1KQAA 5DEMA 2ICXA 1HM9A 2IUAA 3FWWA 4J18A 4R7PA 1V67A 3MQGA 4EA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI5 A;  5E3P A;  4EAA A;  3GOS A;  2V0K A;  4KPX A;  3IGJ A;  2GGO A;  1MRL A;  3BXY A;  3OTZ A;  3TWD A;  2ICY A;  4E6T A;  3FSY A;  3SPT A;  1HM8 A;  1G95 A;  1SST A;  3NZ2 A;  3EG4 A;  2VD4 A;  3BSW A;  4MFG A;  1TDT A;  3VBN A;  3TV0 A;  1QRF A;  1QRM A;  5ADX V;  4G87 A;  1XAT A;  2WLG A;  3GVD A;  4HUR A;  3I3A A;  4M98 A;  3R5A A;  4G3S A;  4KNX A;  1KRU A;  4E79 A;  4EA8 A;  4N6B A;  1KK5 A;  3DHO A;  3F1X A;  3MQH A;  4E1K A;  2RIJ A;  2I5K A;  1FXJ A;  2GGQ A;  3VBJ A;  3CJ8 A;  3T57 A;  3Q1X A;  3R3I A;  4M2A A;  2WLC A;  5ADX U;  1KGQ A;  3D8V A;  2V0L A;  3IXC A;  2W0W A;  1S80 A;  2VHE A;  3R5B A;  3TIS A;  2Q4J A;  3TIO A;  5L6V A;  3R2W A;  4R36 A;  1Z90 A;  3KWC A;  2FKO A;  4FCE A;  2JF2 A;  1QRG A;  3R5D A;  4MYO A;  3C8V A;  1OCX A;  1T3D A;  1THJ A;  3DJ4 A;  3I3X A;  4E6U A;  2WLE A;  3OU9 A;  3HJJ A;  3DK5 A;  3KWD A;  3D98 A;  5DEP A;  4N6A A;  2OI6 A;  3FSB A;  4J09 A;  3HSQ A;  3V4E A;  4K6R A;  4EGG A;  2AQ9 A;  3EEV A;  3EH0 A;  4EA9 A;  4IHH A;  4AAW A;  1SSM A;  2TDT A;  1HM0 A;  4G3Q A;  2V0I A;  3KWE A;  1YP4 A;  2XAT A;  4AC3 A;  2QKX A;  1J2Z A;  4HZD A;  5E3R A;  1KHR A;  1G97 A;  2V0J A;  2WLF A;  3ST8 A;  4MZU A;  3BSY A;  4HZC A;  2IU9 A;  3JQY A;  3TK8 A;  3VBM A;  3FOQ A;  1MR9 A;  5L6S A;  1KGT A;  4HCQ A;  3MC4 A;  5U2K A;  1KK4 A;  1QQ0 A;  3R1W A;  3SRT A;  1YP3 A;  3PMO A;  2OEF A;  4KQL A;  4M99 A;  1KK6 A;  2IU8 A;  5E3Q A;  3TDT A;  1FWY A;  3OUP A;  3VNP A;  2W0V A;  3OW5 A;  3R8Y A;  2WLD A;  1QRE A;  4ISX A;  3R3R A;  3BSS A;  4M9C A;  3GUE A;  1XHD A;  4R37 A;  4EAB A;  2OEG A;  3FSX A;  3ECT A;  3BFP A;  3R5C A;  5DG3 A;  1SSQ A;  3FS8 A;  4N69 A;  5AFU V;  4H7O A;  3VBP A;  3P47 A;  1QRL A;  1YP2 A;  4M2B A;  4DCL A;  3VBI A;  3OTM A;  4N27 A;  4EQY A;  2P2O A;  2NPO A;  4G3P A;  2IC7 A;  3VBL A;  3R0S A;  2QIA A;  5F42 A;  3VBK A;  3FTT A;  1LXA A;  1KRV A;  4HUS A;  2QIV X;  3BRK X;  4IHF A;  4E75 A;  1MR7 A;  3P1B A;  4AA7 A;  5AFU U;  2OI7 A;  4KNR A;  4KPZ A;  1HV9 A;  2JF3 A;  4M28 A;  1KRR A;  2V0H A;  3FSC A;  1V3W A;  4IHG A;  1KQA A;  5DEM A;  2ICX A;  1HM9 A;  2IUA A;  3FWW A;  4J18 A;  4R7P A;  1V67 A;  3MQG A;  4EA7 A; 
#chains in the Genus database with same CATH topology
 2OI5 A;  5E3P A;  4EAA A;  3GOS A;  2V0K A;  4KPX A;  3IGJ A;  2GGO A;  1MRL A;  3BXY A;  3OTZ A;  3TWD A;  2ICY A;  4E6T A;  3FSY A;  3SPT A;  1HM8 A;  1G95 A;  1SST A;  3OH3 A;  3NZ2 A;  3EG4 A;  2VD4 A;  3BSW A;  4MFG A;  1TDT A;  3VBN A;  3TV0 A;  1QRF A;  1QRM A;  5ADX V;  4G87 A;  1XAT A;  2WLG A;  3GVD A;  4HUR A;  3I3A A;  4M98 A;  3R5A A;  4G3S A;  4KNX A;  1KRU A;  3OH4 A;  4E79 A;  4EA8 A;  4N6B A;  1KK5 A;  3DHO A;  3F1X A;  3MQH A;  4E1K A;  2RIJ A;  2I5K A;  1FXJ A;  2GGQ A;  3VBJ A;  3CJ8 A;  3T57 A;  3Q1X A;  3R3I A;  4M2A A;  2WLC A;  3OH2 A;  1KGQ A;  5ADX U;  3D8V A;  1N4I A;  2V0L A;  3IXC A;  2W0W A;  1S80 A;  2VHE A;  3R5B A;  3TIS A;  3OGZ A;  2Q4J A;  3TIO A;  5L6V A;  3R2W A;  4R36 A;  1Z90 A;  3KWC A;  2FKO A;  4FCE A;  1L0S A;  2JF2 A;  1QRG A;  3R5D A;  4MYO A;  3C8V A;  1OCX A;  1T3D A;  1THJ A;  3DJ4 A;  3I3X A;  4E6U A;  2WLE A;  3OU9 A;  1M8N A;  3HJJ A;  3DK5 A;  3GQA A;  3KWD A;  3D98 A;  5DEP A;  4N6A A;  2OI6 A;  3FSB A;  4J09 A;  3HSQ A;  3V4E A;  4K6R A;  4EGG A;  2AQ9 A;  3EEV A;  3EH0 A;  4EA9 A;  3OH1 A;  4IHH A;  4AAW A;  1SSM A;  2TDT A;  1HM0 A;  4G3Q A;  2V0I A;  3KWE A;  1YP4 A;  2XAT A;  4AC3 A;  2QKX A;  1J2Z A;  4HZD A;  5E3R A;  1KHR A;  3SUC A;  1G97 A;  2V0J A;  2WLF A;  3ST8 A;  4MZU A;  3BSY A;  4HZC A;  2IU9 A;  3JQY A;  3TK8 A;  3VBM A;  3FOQ A;  1MR9 A;  5L6S A;  1KGT A;  4HCQ A;  3MC4 A;  5U2K A;  1KK4 A;  1QQ0 A;  3R1W A;  3SRT A;  1Z2F A;  1YP3 A;  3PMO A;  2OEF A;  4KQL A;  4M99 A;  1KK6 A;  2IU8 A;  5E3Q A;  3TDT A;  1FWY A;  3OUP A;  3VNP A;  2W0V A;  3OW5 A;  3R8Y A;  2WLD A;  1QRE A;  4ISX A;  3R3R A;  3BSS A;  4M9C A;  3GUE A;  1XHD A;  4R37 A;  4EAB A;  2OEG A;  3FSX A;  3ECT A;  3GQ7 A;  3BFP A;  3R5C A;  5DG3 A;  1SSQ A;  3FS8 A;  4N69 A;  5AFU V;  1EWW A;  4H7O A;  3VBP A;  3P47 A;  3GQ8 A;  1QRL A;  1YP2 A;  3OH0 A;  4M2B A;  4DCL A;  3VBI A;  3OTM A;  4N27 A;  4EQY A;  2P2O A;  2NPO A;  4G3P A;  2IC7 A;  3VBL A;  3R0S A;  2QIA A;  5F42 A;  3VBK A;  3FTT A;  1LXA A;  1KRV A;  4HUS A;  2QIV X;  3BRK X;  4IHF A;  4E75 A;  1MR7 A;  3P1B A;  4AA7 A;  5AFU U;  2OI7 A;  4KNR A;  4KPZ A;  1HV9 A;  2JF3 A;  3GQ9 A;  1KRR A;  4M28 A;  2V0H A;  3FSC A;  1V3W A;  4IHG A;  1KQA A;  5DEM A;  2ICX A;  1HM9 A;  2IUA A;  3FWW A;  4J18 A;  4R7P A;  1V67 A;  3MQG A;  4EA7 A; 
#chains in the Genus database with same CATH homology
 2OI5 A;  5E3P A;  4EAA A;  3GOS A;  2V0K A;  4KPX A;  3IGJ A;  2GGO A;  1MRL A;  3BXY A;  3OTZ A;  3TWD A;  2ICY A;  4E6T A;  3FSY A;  3SPT A;  1HM8 A;  1G95 A;  1SST A;  3NZ2 A;  3EG4 A;  2VD4 A;  3BSW A;  4MFG A;  1TDT A;  3VBN A;  3TV0 A;  1QRF A;  1QRM A;  5ADX V;  4G87 A;  1XAT A;  2WLG A;  3GVD A;  4HUR A;  3I3A A;  4M98 A;  3R5A A;  4G3S A;  4KNX A;  1KRU A;  4E79 A;  4EA8 A;  4N6B A;  1KK5 A;  3DHO A;  3F1X A;  3MQH A;  4E1K A;  2RIJ A;  2I5K A;  1FXJ A;  2GGQ A;  3VBJ A;  3CJ8 A;  3T57 A;  3Q1X A;  3R3I A;  4M2A A;  2WLC A;  5ADX U;  1KGQ A;  3D8V A;  2V0L A;  3IXC A;  2W0W A;  1S80 A;  2VHE A;  3R5B A;  3TIS A;  2Q4J A;  3TIO A;  5L6V A;  3R2W A;  4R36 A;  1Z90 A;  3KWC A;  2FKO A;  4FCE A;  2JF2 A;  1QRG A;  3R5D A;  4MYO A;  3C8V A;  1OCX A;  1T3D A;  1THJ A;  3DJ4 A;  3I3X A;  4E6U A;  2WLE A;  3OU9 A;  3HJJ A;  3DK5 A;  3KWD A;  3D98 A;  5DEP A;  4N6A A;  2OI6 A;  3FSB A;  4J09 A;  3HSQ A;  3V4E A;  4K6R A;  4EGG A;  2AQ9 A;  3EEV A;  3EH0 A;  4EA9 A;  4IHH A;  4AAW A;  1SSM A;  2TDT A;  1HM0 A;  4G3Q A;  2V0I A;  3KWE A;  1YP4 A;  2XAT A;  4AC3 A;  2QKX A;  1J2Z A;  4HZD A;  5E3R A;  1KHR A;  1G97 A;  2V0J A;  2WLF A;  3ST8 A;  4MZU A;  3BSY A;  4HZC A;  2IU9 A;  3JQY A;  3TK8 A;  3VBM A;  3FOQ A;  1MR9 A;  5L6S A;  1KGT A;  4HCQ A;  3MC4 A;  5U2K A;  1KK4 A;  1QQ0 A;  3R1W A;  3SRT A;  1YP3 A;  3PMO A;  2OEF A;  4KQL A;  4M99 A;  1KK6 A;  2IU8 A;  5E3Q A;  3TDT A;  1FWY A;  3OUP A;  3VNP A;  2W0V A;  3OW5 A;  3R8Y A;  2WLD A;  1QRE A;  4ISX A;  3R3R A;  3BSS A;  4M9C A;  3GUE A;  1XHD A;  4R37 A;  4EAB A;  2OEG A;  3FSX A;  3ECT A;  3BFP A;  3R5C A;  5DG3 A;  1SSQ A;  3FS8 A;  4N69 A;  5AFU V;  4H7O A;  3VBP A;  3P47 A;  1QRL A;  1YP2 A;  4M2B A;  4DCL A;  3VBI A;  3OTM A;  4N27 A;  4EQY A;  2P2O A;  2NPO A;  4G3P A;  2IC7 A;  3VBL A;  3R0S A;  2QIA A;  5F42 A;  3VBK A;  3FTT A;  1LXA A;  1KRV A;  4HUS A;  2QIV X;  3BRK X;  4IHF A;  4E75 A;  1MR7 A;  3P1B A;  4AA7 A;  5AFU U;  2OI7 A;  4KNR A;  4KPZ A;  1HV9 A;  2JF3 A;  4M28 A;  1KRR A;  2V0H A;  3FSC A;  1V3W A;  4IHG A;  1KQA A;  5DEM A;  2ICX A;  1HM9 A;  2IUA A;  3FWW A;  4J18 A;  4R7P A;  1V67 A;  3MQG A;  4EA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...