5DEPA

Structure of pseudomonas aeruginosa lpxa in complex with udp-glcnac
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
MSLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain pa7)
total genus 107
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5depA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5depA01
4N27A 2P2OA 3BSYA 4R36A 4KPZA 4N6BA 2WLFA 1KK6A 2VHEA 1HM9A 1QRMA 1MR7A 3SRTA 2ICYA 3BSSA 3R1WA 4G3SA 3TIOA 2Q4JA 5E3QA 4EA8A 5L6VA 1KRUA 3T57A 4E6UA 3VBNA 3TISA 3VBIA 3TV0A 3I3AA 1HM0A 1HM8A 4KQLA 3BXYA 3DK5A 1QRLA 3FSCA 2XATA 2JF2A 3IGJA 3PMOA 5F42A 3DHOA 3R3IA 2VD4A 3EH0A 4FCEA 1KRVA 4HZCA 5E3PA 2RIJA 1SSMA 4R7PA 3R5AA 3TWDA 1QREA 3R5BA 5U2KA 4M2BA 4MYOA 5ADXU 3MC4A 3MQGA 3FSYA 2W0VA 4AC3A 3OTMA 4AAWA 3EEVA 3F1XA 1KGTA 4HZDA 1V3WA 4AA7A 2JF3A 2OEGA 3OW5A 3VBKA 4IHHA 3R3RA 2FKOA 2OI5A 3VNPA 4J18A 3HSQA 3VBMA 3BSWA 4HCQA 2GGQA 3GUEA 4M9CA 4MFGA 4G3PA 4MZUA 4M2AA 2WLGA 1OCXA 1QQ0A 2V0KA 1MRLA 2IU8A 2V0HA 3HJJA 3IXCA 4EGGA 1KHRA 2V0LA 2OEFA 1KQAA 3V4EA 3KWEA 2GGOA 3ST8A 4EAAA 3NZ2A 1LXAA 1TDTA 2OI6A 3FS8A 2IC7A 1THJA 1V67A 4DCLA 2QIAA 1FXJA 1QRGA 1FWYA 1QRFA 3D8VA 3FSBA 3R2WA 4E79A 2IU9A 4IHFA 3VBPA 4ISXA 1MR9A 3BFPA 3R5CA 1SSTA 3DJ4A 3OTZA 1G97A 4R37A 2QKXA 2AQ9A 3KWCA 3OUPA 2I5KA 4IHGA 2WLEA 2W0WA 3BRKX 3JQYA 4HUSA 4EA9A 4HURA 3FOQA 5DEPA 1J2ZA 4M99A 3FSXA 1XATA 4KNXA 3D98A 2QIVX 3MQHA 2NPOA 4EA7A 3TDTA 2TDTA 3TK8A 1KK4A 1YP4A 2V0IA 1KGQA 3GVDA 1KK5A 5AFUV 4N6AA 5DG3A 4M98A 5L6SA 4G3QA 1XHDA 2OI7A 2WLDA 1YP2A 1G95A 3FTTA 1KRRA 4H7OA 3R0SA 2WLCA 4KNRA 4E75A 3P47A 3FWWA 4N69A 1Z90A 3Q1XA 5E3RA 2IUAA 4J09A 1YP3A 4K6RA 1HV9A 4E6TA 1T3DA 1SSQA 3I3XA 3R5DA 4G87A 4EQYA 4KPXA 3R8YA 3C8VA 3CJ8A 5DEMA 3SPTA 2V0JA 3GOSA 4EABA 3OU9A 3EG4A 3KWDA 3P1BA 4M28A 3VBLA 5AFUU 4E1KA 1S80A 3VBJA 5ADXV 3ECTA 2ICXA
chains in the Genus database with same CATH superfamily
4N27A 2P2OA 3BSYA 4R36A 4KPZA 4N6BA 2WLFA 1KK6A 2VHEA 1HM9A 1QRMA 1MR7A 3SRTA 2ICYA 3BSSA 3R1WA 4G3SA 3SUCA 2Q4JA 5E3QA 3TIOA 4EA8A 5L6VA 1KRUA 3T57A 3GQ9A 4E6UA 3VBNA 3TISA 3VBIA 3TV0A 3I3AA 1HM0A 1HM8A 4KQLA 3BXYA 3DK5A 1QRLA 3FSCA 2XATA 2JF2A 3IGJA 3PMOA 5F42A 3DHOA 3R3IA 2VD4A 3EH0A 4FCEA 1KRVA 4HZCA 5E3PA 2RIJA 1SSMA 4R7PA 3R5AA 3TWDA 1Z2FA 1QREA 3R5BA 5U2KA 4M2BA 4MYOA 5ADXU 3MC4A 3MQGA 3FSYA 2W0VA 4AC3A 3OTMA 4AAWA 3EEVA 3F1XA 1KGTA 4HZDA 1V3WA 4AA7A 2JF3A 2OEGA 3OW5A 3VBKA 4IHHA 3R3RA 2FKOA 2OI5A 3VNPA 4J18A 3HSQA 3VBMA 3BSWA 3OH2A 4HCQA 2GGQA 1N4IA 3GUEA 3OH4A 4M9CA 4MFGA 4G3PA 4MZUA 4M2AA 2WLGA 1OCXA 1QQ0A 2V0KA 1MRLA 2IU8A 2V0HA 3GQ7A 3HJJA 3IXCA 4EGGA 1KHRA 2V0LA 2OEFA 1KQAA 3V4EA 3KWEA 2GGOA 3ST8A 4EAAA 3NZ2A 3OH3A 1LXAA 1TDTA 2OI6A 3FS8A 2IC7A 1THJA 1V67A 4DCLA 2QIAA 1FXJA 1QRGA 1FWYA 1QRFA 3D8VA 3FSBA 3R2WA 4E79A 2IU9A 4IHFA 3GQAA 3VBPA 4ISXA 1MR9A 3BFPA 3R5CA 1SSTA 3DJ4A 3OTZA 1G97A 1EWWA 4R37A 2QKXA 2AQ9A 3KWCA 3OUPA 2I5KA 4IHGA 2WLEA 2W0WA 3BRKX 3JQYA 4HUSA 4EA9A 4HURA 3FOQA 5DEPA 1J2ZA 4M99A 3FSXA 1XATA 4KNXA 3OH0A 3D98A 2QIVX 3MQHA 2NPOA 4EA7A 3TDTA 2TDTA 3TK8A 1KK4A 1YP4A 2V0IA 1KGQA 3GVDA 1KK5A 5AFUV 4N6AA 5DG3A 3GQ8A 4M98A 5L6SA 4G3QA 1XHDA 2OI7A 2WLDA 1YP2A 1G95A 3FTTA 1KRRA 4H7OA 3R0SA 2WLCA 4KNRA 4E75A 3P47A 3FWWA 4N69A 1Z90A 3Q1XA 5E3RA 2IUAA 4J09A 1YP3A 4K6RA 1HV9A 4E6TA 1T3DA 1SSQA 3I3XA 3R5DA 1L0SA 4EQYA 4G87A 4KPXA 3OH1A 3R8YA 3C8VA 3CJ8A 3OGZA 5DEMA 3SPTA 2V0JA 1M8NA 3GOSA 4EABA 3OU9A 3EG4A 3KWDA 3P1BA 4M28A 3VBLA 5AFUU 4E1KA 1S80A 3VBJA 5ADXV 3ECTA 2ICXA
chains in the Genus database with same CATH topology
4N27A 2P2OA 3BSYA 4R36A 4KPZA 4N6BA 2WLFA 1KK6A 2VHEA 1HM9A 1QRMA 1MR7A 3SRTA 2ICYA 3BSSA 3R1WA 4G3SA 3TIOA 2Q4JA 5E3QA 4EA8A 5L6VA 1KRUA 3T57A 4E6UA 3VBNA 3TISA 3VBIA 3TV0A 3I3AA 1HM0A 1HM8A 4KQLA 3BXYA 3DK5A 1QRLA 3FSCA 2XATA 2JF2A 3IGJA 3PMOA 5F42A 3DHOA 3R3IA 2VD4A 3EH0A 4FCEA 1KRVA 4HZCA 5E3PA 2RIJA 1SSMA 4R7PA 3R5AA 3TWDA 1QREA 3R5BA 5U2KA 4M2BA 4MYOA 5ADXU 3MC4A 3MQGA 3FSYA 2W0VA 4AC3A 3OTMA 4AAWA 3EEVA 3F1XA 1KGTA 4HZDA 1V3WA 4AA7A 2JF3A 2OEGA 3OW5A 3VBKA 4IHHA 3R3RA 2FKOA 2OI5A 3VNPA 4J18A 3HSQA 3VBMA 3BSWA 4HCQA 2GGQA 3GUEA 4M9CA 4MFGA 4G3PA 4MZUA 4M2AA 2WLGA 1OCXA 1QQ0A 2V0KA 1MRLA 2IU8A 2V0HA 3HJJA 3IXCA 4EGGA 1KHRA 2V0LA 2OEFA 1KQAA 3V4EA 3KWEA 2GGOA 3ST8A 4EAAA 3NZ2A 1LXAA 1TDTA 2OI6A 3FS8A 2IC7A 1THJA 1V67A 4DCLA 2QIAA 1FXJA 1QRGA 1FWYA 1QRFA 3D8VA 3FSBA 3R2WA 4E79A 2IU9A 4IHFA 3VBPA 4ISXA 1MR9A 3BFPA 3R5CA 1SSTA 3DJ4A 3OTZA 1G97A 4R37A 2QKXA 2AQ9A 3KWCA 3OUPA 2I5KA 4IHGA 2WLEA 2W0WA 3BRKX 3JQYA 4HUSA 4EA9A 4HURA 3FOQA 5DEPA 1J2ZA 4M99A 3FSXA 1XATA 4KNXA 3D98A 2QIVX 3MQHA 2NPOA 4EA7A 3TDTA 2TDTA 3TK8A 1KK4A 1YP4A 2V0IA 1KGQA 3GVDA 1KK5A 5AFUV 4N6AA 5DG3A 4M98A 5L6SA 4G3QA 1XHDA 2OI7A 2WLDA 1YP2A 1G95A 3FTTA 1KRRA 4H7OA 3R0SA 2WLCA 4KNRA 4E75A 3P47A 3FWWA 4N69A 1Z90A 3Q1XA 5E3RA 2IUAA 4J09A 1YP3A 4K6RA 1HV9A 4E6TA 1T3DA 1SSQA 3I3XA 3R5DA 4G87A 4EQYA 4KPXA 3R8YA 3C8VA 3CJ8A 5DEMA 3SPTA 2V0JA 3GOSA 4EABA 3OU9A 3EG4A 3KWDA 3P1BA 4M28A 3VBLA 5AFUU 4E1KA 1S80A 3VBJA 5ADXV 3ECTA 2ICXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N27 A;  2P2O A;  3BSY A;  4R36 A;  4KPZ A;  4N6B A;  2WLF A;  1KK6 A;  2VHE A;  1HM9 A;  1QRM A;  1MR7 A;  3SRT A;  2ICY A;  3BSS A;  3R1W A;  4G3S A;  3TIO A;  2Q4J A;  5E3Q A;  4EA8 A;  5L6V A;  1KRU A;  3T57 A;  4E6U A;  3VBN A;  3TIS A;  3VBI A;  3TV0 A;  3I3A A;  1HM0 A;  1HM8 A;  4KQL A;  3BXY A;  3DK5 A;  1QRL A;  3FSC A;  2XAT A;  2JF2 A;  3IGJ A;  3PMO A;  5F42 A;  3DHO A;  3R3I A;  2VD4 A;  3EH0 A;  4FCE A;  1KRV A;  4HZC A;  5E3P A;  2RIJ A;  1SSM A;  4R7P A;  3R5A A;  3TWD A;  1QRE A;  3R5B A;  5U2K A;  4M2B A;  4MYO A;  5ADX U;  3MC4 A;  3MQG A;  3FSY A;  2W0V A;  4AC3 A;  3OTM A;  4AAW A;  3EEV A;  3F1X A;  1KGT A;  4HZD A;  1V3W A;  4AA7 A;  2JF3 A;  2OEG A;  3OW5 A;  3VBK A;  4IHH A;  3R3R A;  2FKO A;  2OI5 A;  3VNP A;  4J18 A;  3HSQ A;  3VBM A;  3BSW A;  4HCQ A;  2GGQ A;  3GUE A;  4M9C A;  4MFG A;  4G3P A;  4MZU A;  4M2A A;  2WLG A;  1OCX A;  1QQ0 A;  2V0K A;  1MRL A;  2IU8 A;  2V0H A;  3HJJ A;  3IXC A;  4EGG A;  1KHR A;  2V0L A;  2OEF A;  1KQA A;  3V4E A;  3KWE A;  2GGO A;  3ST8 A;  4EAA A;  3NZ2 A;  1LXA A;  1TDT A;  2OI6 A;  3FS8 A;  2IC7 A;  1THJ A;  1V67 A;  4DCL A;  2QIA A;  1FXJ A;  1QRG A;  1FWY A;  1QRF A;  3D8V A;  3FSB A;  3R2W A;  4E79 A;  2IU9 A;  4IHF A;  3VBP A;  4ISX A;  1MR9 A;  3BFP A;  3R5C A;  1SST A;  3DJ4 A;  3OTZ A;  1G97 A;  4R37 A;  2QKX A;  2AQ9 A;  3KWC A;  3OUP A;  2I5K A;  4IHG A;  2WLE A;  2W0W A;  3BRK X;  3JQY A;  4HUS A;  4EA9 A;  4HUR A;  3FOQ A;  5DEP A;  1J2Z A;  4M99 A;  3FSX A;  1XAT A;  4KNX A;  3D98 A;  2QIV X;  3MQH A;  2NPO A;  4EA7 A;  3TDT A;  2TDT A;  3TK8 A;  1KK4 A;  1YP4 A;  2V0I A;  1KGQ A;  3GVD A;  1KK5 A;  5AFU V;  4N6A A;  5DG3 A;  4M98 A;  5L6S A;  4G3Q A;  1XHD A;  2OI7 A;  2WLD A;  1YP2 A;  1G95 A;  3FTT A;  1KRR A;  4H7O A;  3R0S A;  2WLC A;  4KNR A;  4E75 A;  3P47 A;  3FWW A;  4N69 A;  1Z90 A;  3Q1X A;  5E3R A;  2IUA A;  4J09 A;  1YP3 A;  4K6R A;  1HV9 A;  4E6T A;  1T3D A;  1SSQ A;  3I3X A;  3R5D A;  4G87 A;  4EQY A;  4KPX A;  3R8Y A;  3C8V A;  3CJ8 A;  5DEM A;  3SPT A;  2V0J A;  3GOS A;  4EAB A;  3OU9 A;  3EG4 A;  3KWD A;  3P1B A;  4M28 A;  3VBL A;  5AFU U;  4E1K A;  1S80 A;  3VBJ A;  5ADX V;  3ECT A;  2ICX A; 
#chains in the Genus database with same CATH topology
 4N27 A;  2P2O A;  3BSY A;  4R36 A;  4KPZ A;  4N6B A;  2WLF A;  1KK6 A;  2VHE A;  1HM9 A;  1QRM A;  1MR7 A;  3SRT A;  2ICY A;  3BSS A;  3R1W A;  4G3S A;  3SUC A;  2Q4J A;  5E3Q A;  3TIO A;  4EA8 A;  5L6V A;  1KRU A;  3T57 A;  3GQ9 A;  4E6U A;  3VBN A;  3TIS A;  3VBI A;  3TV0 A;  3I3A A;  1HM0 A;  1HM8 A;  4KQL A;  3BXY A;  3DK5 A;  1QRL A;  3FSC A;  2XAT A;  2JF2 A;  3IGJ A;  3PMO A;  5F42 A;  3DHO A;  3R3I A;  2VD4 A;  3EH0 A;  4FCE A;  1KRV A;  4HZC A;  5E3P A;  2RIJ A;  1SSM A;  4R7P A;  3R5A A;  3TWD A;  1Z2F A;  1QRE A;  3R5B A;  5U2K A;  4M2B A;  4MYO A;  5ADX U;  3MC4 A;  3MQG A;  3FSY A;  2W0V A;  4AC3 A;  3OTM A;  4AAW A;  3EEV A;  3F1X A;  1KGT A;  4HZD A;  1V3W A;  4AA7 A;  2JF3 A;  2OEG A;  3OW5 A;  3VBK A;  4IHH A;  3R3R A;  2FKO A;  2OI5 A;  3VNP A;  4J18 A;  3HSQ A;  3VBM A;  3BSW A;  3OH2 A;  4HCQ A;  2GGQ A;  1N4I A;  3GUE A;  3OH4 A;  4M9C A;  4MFG A;  4G3P A;  4MZU A;  4M2A A;  2WLG A;  1OCX A;  1QQ0 A;  2V0K A;  1MRL A;  2IU8 A;  2V0H A;  3GQ7 A;  3HJJ A;  3IXC A;  4EGG A;  1KHR A;  2V0L A;  2OEF A;  1KQA A;  3V4E A;  3KWE A;  2GGO A;  3ST8 A;  4EAA A;  3NZ2 A;  3OH3 A;  1LXA A;  1TDT A;  2OI6 A;  3FS8 A;  2IC7 A;  1THJ A;  1V67 A;  4DCL A;  2QIA A;  1FXJ A;  1QRG A;  1FWY A;  1QRF A;  3D8V A;  3FSB A;  3R2W A;  4E79 A;  2IU9 A;  4IHF A;  3GQA A;  3VBP A;  4ISX A;  1MR9 A;  3BFP A;  3R5C A;  1SST A;  3DJ4 A;  3OTZ A;  1G97 A;  1EWW A;  4R37 A;  2QKX A;  2AQ9 A;  3KWC A;  3OUP A;  2I5K A;  4IHG A;  2WLE A;  2W0W A;  3BRK X;  3JQY A;  4HUS A;  4EA9 A;  4HUR A;  3FOQ A;  5DEP A;  1J2Z A;  4M99 A;  3FSX A;  1XAT A;  4KNX A;  3OH0 A;  3D98 A;  2QIV X;  3MQH A;  2NPO A;  4EA7 A;  3TDT A;  2TDT A;  3TK8 A;  1KK4 A;  1YP4 A;  2V0I A;  1KGQ A;  3GVD A;  1KK5 A;  5AFU V;  4N6A A;  5DG3 A;  3GQ8 A;  4M98 A;  5L6S A;  4G3Q A;  1XHD A;  2OI7 A;  2WLD A;  1YP2 A;  1G95 A;  3FTT A;  1KRR A;  4H7O A;  3R0S A;  2WLC A;  4KNR A;  4E75 A;  3P47 A;  3FWW A;  4N69 A;  1Z90 A;  3Q1X A;  5E3R A;  2IUA A;  4J09 A;  1YP3 A;  4K6R A;  1HV9 A;  4E6T A;  1T3D A;  1SSQ A;  3I3X A;  3R5D A;  1L0S A;  4EQY A;  4G87 A;  4KPX A;  3OH1 A;  3R8Y A;  3C8V A;  3CJ8 A;  3OGZ A;  5DEM A;  3SPT A;  2V0J A;  1M8N A;  3GOS A;  4EAB A;  3OU9 A;  3EG4 A;  3KWD A;  3P1B A;  4M28 A;  3VBL A;  5AFU U;  4E1K A;  1S80 A;  3VBJ A;  5ADX V;  3ECT A;  2ICX A; 
#chains in the Genus database with same CATH homology
 4N27 A;  2P2O A;  3BSY A;  4R36 A;  4KPZ A;  4N6B A;  2WLF A;  1KK6 A;  2VHE A;  1HM9 A;  1QRM A;  1MR7 A;  3SRT A;  2ICY A;  3BSS A;  3R1W A;  4G3S A;  3TIO A;  2Q4J A;  5E3Q A;  4EA8 A;  5L6V A;  1KRU A;  3T57 A;  4E6U A;  3VBN A;  3TIS A;  3VBI A;  3TV0 A;  3I3A A;  1HM0 A;  1HM8 A;  4KQL A;  3BXY A;  3DK5 A;  1QRL A;  3FSC A;  2XAT A;  2JF2 A;  3IGJ A;  3PMO A;  5F42 A;  3DHO A;  3R3I A;  2VD4 A;  3EH0 A;  4FCE A;  1KRV A;  4HZC A;  5E3P A;  2RIJ A;  1SSM A;  4R7P A;  3R5A A;  3TWD A;  1QRE A;  3R5B A;  5U2K A;  4M2B A;  4MYO A;  5ADX U;  3MC4 A;  3MQG A;  3FSY A;  2W0V A;  4AC3 A;  3OTM A;  4AAW A;  3EEV A;  3F1X A;  1KGT A;  4HZD A;  1V3W A;  4AA7 A;  2JF3 A;  2OEG A;  3OW5 A;  3VBK A;  4IHH A;  3R3R A;  2FKO A;  2OI5 A;  3VNP A;  4J18 A;  3HSQ A;  3VBM A;  3BSW A;  4HCQ A;  2GGQ A;  3GUE A;  4M9C A;  4MFG A;  4G3P A;  4MZU A;  4M2A A;  2WLG A;  1OCX A;  1QQ0 A;  2V0K A;  1MRL A;  2IU8 A;  2V0H A;  3HJJ A;  3IXC A;  4EGG A;  1KHR A;  2V0L A;  2OEF A;  1KQA A;  3V4E A;  3KWE A;  2GGO A;  3ST8 A;  4EAA A;  3NZ2 A;  1LXA A;  1TDT A;  2OI6 A;  3FS8 A;  2IC7 A;  1THJ A;  1V67 A;  4DCL A;  2QIA A;  1FXJ A;  1QRG A;  1FWY A;  1QRF A;  3D8V A;  3FSB A;  3R2W A;  4E79 A;  2IU9 A;  4IHF A;  3VBP A;  4ISX A;  1MR9 A;  3BFP A;  3R5C A;  1SST A;  3DJ4 A;  3OTZ A;  1G97 A;  4R37 A;  2QKX A;  2AQ9 A;  3KWC A;  3OUP A;  2I5K A;  4IHG A;  2WLE A;  2W0W A;  3BRK X;  3JQY A;  4HUS A;  4EA9 A;  4HUR A;  3FOQ A;  5DEP A;  1J2Z A;  4M99 A;  3FSX A;  1XAT A;  4KNX A;  3D98 A;  2QIV X;  3MQH A;  2NPO A;  4EA7 A;  3TDT A;  2TDT A;  3TK8 A;  1KK4 A;  1YP4 A;  2V0I A;  1KGQ A;  3GVD A;  1KK5 A;  5AFU V;  4N6A A;  5DG3 A;  4M98 A;  5L6S A;  4G3Q A;  1XHD A;  2OI7 A;  2WLD A;  1YP2 A;  1G95 A;  3FTT A;  1KRR A;  4H7O A;  3R0S A;  2WLC A;  4KNR A;  4E75 A;  3P47 A;  3FWW A;  4N69 A;  1Z90 A;  3Q1X A;  5E3R A;  2IUA A;  4J09 A;  1YP3 A;  4K6R A;  1HV9 A;  4E6T A;  1T3D A;  1SSQ A;  3I3X A;  3R5D A;  4G87 A;  4EQY A;  4KPX A;  3R8Y A;  3C8V A;  3CJ8 A;  5DEM A;  3SPT A;  2V0J A;  3GOS A;  4EAB A;  3OU9 A;  3EG4 A;  3KWD A;  3P1B A;  4M28 A;  3VBL A;  5AFU U;  4E1K A;  1S80 A;  3VBJ A;  5ADX V;  3ECT A;  2ICX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...