3CJ8A

Crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
AMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransfe
publication title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
total genus 55
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3cj8A03
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3cj8A02
4.10.180.10 Few Secondary Structures Irregular Black beetle virus capsid protein Black beetle virus capsid protein 3cj8A01
1KGTA 3MQHA 3TWDA 5DEMA 2QKXA 2OEFA 3KWDA 1V67A 2OI5A 5AFUU 4R36A 1HM0A 1KHRA 4N6AA 3ECTA 5DG3A 3CJ8A 4IHHA 4EABA 3R3IA 4KPZA 1FWYA 1HM9A 2CUYA 2G2YA 2JFDA 4KQLA 2VD4A 2G1HA 4N6BA 2IUAA 4M99A 2WLEA 3PMOA 1QREA 3C8VA 2WLFA 3HJJA 4EGGA 2FKOA 3IGJA 2Q4JA 3I3AA 3IXCA 2JF3A 1SSTA 4ISXA 1MR9A 4N27A 5AFUV 5DEPA 3VBPA 3EZOA 2WLDA 3QATA 2W0WA 4RL1A 3TZXA 3VBKA 4G87A 2XATA 5E3PA 1G95A 1MR7A 4E75A 3D8VA 2G2ZA 3OUPA 3TQEA 3OTMA 2OEGA 2ICXA 2ICYA 2WLGA 1T3DA 3F1XA 3FSXA 4M2BA 3SRTA 3VBLA 3FSCA 4E1KA 1MLAA 3TZYA 2H1YA 3R5DA 3TZZA 2QIAA 1SSMA 2GGQA 2V0KA 2JFKA 1KK6A 1XATA 3R1WA 4E79A 3R97A 2I5KA 3P1BA 4HURA 5ADXU 3FSYA 3OW5A 2GGOA 3P47A 4QBUA 4IHFA 4KNXA 4M28A 3I3XA 3TDTA 3DK5A 3KWCA 5DZ7A 2RIJA 2WLCA 3HSQA 3R5CA 3VBIA 3VNPA 1KK5A 3TIOA 4G3QA 4E6UA 2V0JA 2QJ3A 4M98A 3R0SA 4MFGA 4MZUA 3T57A 3TV0A 1Z90A 4FCEA 1V3WA 4R7PA 3TK8A 3ST8A 1YP3A 2V0LA 3EEVA 4HCQA 5F42A 1OCXA 3R5AA 5ADXV 4KPXA 5L6SA 1YP4A 1QRFA 3FOQA 4R37A 1KRRA 4EQYA 1G97A 1NM2A 3VBMA 3MC4A 3GOSA 1XHDA 2NPOA 1MRLA 2OI7A 4J09A 2C2NA 3MQGA 3V4EA 2IU9A 2V0HA 4N69A 3FS8A 1LXAA 1HV9A 2AQ9A 3EH0A 2QC3A 3Q1XA 4EAAA 4IHGA 1KRUA 1QRGA 2OI6A 2TDTA 3BRKX 3BSYA 4K6RA 2VHEA 5L6VA 4HZCA 3TZWA 3K89A 1S80A 1KK4A 4MYOA 4AA7A 4H7OA 3NZ2A 2IU8A 3R8YA 3DHOA 1TDTA 3SPTA 3GVDA 1J2ZA 5DZ6A 2IC7A 1QQ0A 2W0VA 3OU9A 3VBJA 4AC3A 3IM9A 2P5ZX 1QRMA 1SSQA 4HZDA 3TISA 3BSWA 3BXYA 3JQYA 3VBNA 3GUEA 2G2OA 3PTWA 4EA9A 3OTZA 3EG4A 3DJ4A 4AAWA 3D98A 4E6TA 1FXJA 3G87A 2JF2A 2V0IA 4M2AA 3IM8A 1KGQA 4EA7A 3R3RA 3BSSA 3KWEA 3FTTA 4M9CA 3H0PA 1KRVA 3FSBA 4RR5A 4HUSA 5E3QA 3FWWA 2QIVX 3RGIA 3HJVA 1QRLA 3HHDA 1KQAA 1THJA 5U2KA 5E3RA 2P2OA 3R2WA 4EA8A 4G3SA 3R5BA 4KNRA 4DCLA 4G3PA 3BFPA 3SBMA 1YP2A 3BV8A 1HM8A 4J18A
chains in the Genus database with same CATH superfamily
3UI3A 1SKWA 2R2TA 1G2EA 1X31C 1RTDA 2IDLA 4ED2A 4I2QA 2HHTA 2IAJB 2OTLS 1D8YA 2J9DE 4Q5VA 5C25A 5HO4A 2XNQA 4DR5J 1KNZA 2ZBQA 4RW7A 1YITS 5G0RA 4CI0B 4ECXA 5GMKa 3PEJA 4BC9A 5KFHA 2MJUA 3PW5A 2BDPA 2OAUA 2Q1LA 2HGMA 2XY7A 2H5IB 3W2VA 3GQ7A 4N8NA 2DRDA 4C8YA 1NHKL 2O01C 3C16A 3ZZZA 2NS1B 5JVHQ 4WZQA 3SSQA 4C3LA 2D9OA 2W9BA 2CQ2A 3NG8A 4LF1A 4O23A 2FQQB 3TR5A 4LR9A 4HACB 2RDIA 2HRYA 1HMVB 1U2CA 1U4BA 5IM0B 1U8SA 1QSSA 3TA0A 2ZZMA 3FTTA 3ZZYA 4DFPA 5F8MA 4HR2A 2Y1JA 1X4AA 2KZMA 2AEFA 4IH5A 2DH9A 4CH1A 3AOAA 4IRCA 4ICLA 2EFOA 1KONA 1B3TA 2H65B 4J9OA 3ILIA 1PO6A 3MEGB 4L76A 3DRPA 1CBKA 4RW4A 1FKAF 3WIVA 1N48A 3PX0A 3GV5B 1MR7A 4PKDB 3PFOA 2ICXA 2QA1A 4TKTA 3TZYA 3MMBA 4F4YA 2MZQA 5HI7A 3WX8A 4OIXA 4DCJB 4RX6A 4RZRA 1VISA 2RILA 2DRBA 2KXFA 3GJRB 2KRRA 5D0HA 4ZVPB 1Q16B 4ZIVA 1S1XA 1Y3JA 1JJ4A 2COLA 2X1AA 4CIOA 1NU4A 3ILLA 5JVGQ 2ZDPA 3M2VA 1LXNA 4ZVTB 5I4MA 3BSYA 2QA4S 1IR1A 1MMDA 5D3GB 2N4DA 3DRSA 3M8YA 1HWKA 4Q45A 2OLWA 5DLGA 3R7BB 4TQSA 4ZPVR 4F4KA 4HH0A 5ETQA 1IKXA 2QIVX 5L38A 5IXUA 3IGNA 2QX0A 1YJNS 4CNZA 3N9UC 1TKZB 3K5LA 2I1RA 4F0MA 4KSEB 3EDQB 2AGQA 2BOAA 3L9ZA 5DEPA 4OYXA 4JI4J 2M7SA 3OJUA 5CZXA 2RF2A 2C2KB 2B0GA 2ZH3A 5F8LA 2YQ1A 2XQCA 3IR7B 3D0HE 2GGOA 1FDNA 4KNXA 4F0KA 4JI6J 1YWXA 3VNPA 2R42A 2LFVA 2KG1A 1VDHA 2HVZA 3CJ0A 4L3NA 4M5HA 2E1CA 4P7VA 4EO6A 4QOTA 3OUYA 1KRRA 4A8OA 5LM7E 5IZHA 1IBLJ 1MRLA 3J81j 4FYWB 3DRRB 3GILA 2Y0BB 4URSA 2NLWA 4MMOA 2QO3A 1NJZA 1CC8A 4RW9B 4C8MA 2Z56B 3C2PA 4JYAJ 4DL7A 4NLOA 2E1MC 2OKQA 3IXQA 4QW8A 2V0IA 4LSNB 4NLDA 4I4BA 4I6WA 3VF0B 3RAMA 3BFPA 2ACYA 1JQGA 4Q44A 3AH6A 3NBPB 1QE1A 2J0SD 2GA7A 4MJKA 1N5QA 2IM1A 2NXJA 2X3DA 1FRJA 2F4VF 2G0JA 3E01B 5AT1B 1NDKA 2VJUA 1DFDA 3J80Y 4TXSA 1GXUA 5EWGA 4M5JA 4W92B 4A8XA 4QYZJ 4DL4A 4LFCJ 5AXNA 2C2ZB 4JI4F 1ZAWA 1Y5LB 2NXUA 5A76A 1S4FA 4K50A 3D0IE 1REVA 3UD4P 4FF3A 1DLOA 2VDIA 2Y8YA 1LWEA 2MB0B 2HZVA 2UUBJ 3MMCA 4JI6F 1S80A 3OH1A 3BH7B 4E98A 3DGPB 3OHAA 2YNGA 3JTPA 2WVFA 2XY6A 2M2BA 4R8UA 4CT8A 4WFYA 2PT0A 3NCRA 1RHUB 4GC7A 3W61A 3D6MB 4CLSA 2YPYA 4OYIA 3UQSA 4FN5A 2OPQA 4CTAB 2ILZA 4JYAF 4ATNA 1RAGB 1JLBB 3HM9A 2XHCA 2YWWA 2DBBA 2BJEA 3HVWA 5DETA 1YZ7A 4ENOA 2VIHA 4C8ZA 4PWDB 3TVZA 3TQEA 2V6AA 2V0KA 2K3KA 4DHVA 2HWIA 4FF2A 2XSJB 1WWHA 3ZFVA 2AJ2A 2OUGA 2UUCJ 4R25A 3BB5A 2I5JB 3KG4A 1Y10A 4YMEA 4U8VA 3G86A 3I5CA 2PDAA 1DZ5A 2AKWB 4P74A 5J2NA 3P49B 4E8UA 1VBYA 2IU8A 1IR2A 4LFCF 4G1QB 1FVSA 1RWWB 3EG4A 5HAOA 2P9GA 2RD5C 4OV6A 1S6QB 2VU5A 2ZHOA 1S77D 4F04B 2PE8A 5D77A 3G82B 3SBMA 5F8NA 3I0SA 5KG2A 2LEAA 4L75A 1TUGB 4QIGA 1M5OC 4RW8B 1UWAA 5CABA 4IFVA 2B7BB 5HL7Q 4M2BA 1ZA2B 3ZZOA 4CWBA 1FE4A 2LU2A 4HURA 1RT4B 2RHQB 4K4VA 4QIFA 3MPWA 5MLCV 4HT5A 1M90T 1TMMA 3VGUA 4ZP7A 4ECYA 5F41A 1TUVA 4QW9A 2NPIA 4ZLLA 2R8JA 3UE2A 2POKA 2AZ1A 5CCMA 2E9ZA 1UFWA 3BGRB 5CYMA 2PD1A 2VOPA 2DY9A 2XLJA 3V6HA 4ZP8A 3RRGA 2DXEA 2FHMA 4NA2A 3CCES 3SEOA 2UUCF 1NMEB 4N47A 1WTFA 2PA3A 3H0PA 3KWEA 3FSBA 1WD6A 3CDBA 5ETSA 1HBNB 4A8WA 4Z2XA 3D3BJ 2V63A 1TV6A 3ETMA 2NSBA 3RZAA 1S10A 4URGA 2YNIB 5DQHA 1S9FA 5B0GA 4U9RA 4GVBA 1CS4B 3S1TA 1WC5A 1NBEB 4DR4J 4RL1A 3K0JA 3ULHA 2BEFA 3HT0A 5AE3A 2FY1A 1U6FA 2WBMA 3DGPA 4UF4A 3K8VA 1S7HA 2C3OA 1AFJA 4XO0A 2OD6A 1PAUB 3MD3A 3GB0A 3PJ9A 3OTBA 3C3LA 2DR9A 4K4YA 2UV8G 2XO7A 2HFNA 3VBJA 1WHXA 3CCVS 1ZZFA 2P8IA 2E7WA 3GG1A 4A8MP 1UFLA 3TUPA 4RR5A 2HMIB 1HNVA 2Q79A 1P1TA 2LVWA 5U2KA 6AT1B 2WSEC 1JLQA 3D54A 2FZGB 1D1UA 3GPAA 4ELUA 3BR8A 1YJ9S 1VQNS 7FDRA 3V5RA 3CMES 2QEXS 2D9PA 4TU7A 2CQCA 3KWDA 3LO3A 2ZH5A 5KFVA 1BQMB 3LTOA 2Z0GA 2V69A 1HR0J 1U0HB 3SSSA 3RAQA 2HG4A 3VGVA 2XATA 4KGXB 1RAIB 1S72S 1LWFA 5L1LA 2A3JA 2IMOA 1SJ3P 4ZIWA 3T5JA 2KL8A 4AQYJ 1XNQJ 2RVJA 4LUBA 3VZHA 5CA5A 2EWHA 2DNOA 3KJQB 3RB0A 4DR4F 5C7PA 1S97A 3GV8B 5GVQA 3BYRA 4Z37A 3BO3A 1B0TA 1BD6A 5D4LA 1O0PA 4OYZA 3FS8A 5L9NA 1L5UA 3AOCA 1T05A 3HFVA 1U1LA 4RKUC 4DPWA 4X84A 3FDSA 1VMBA 3SV4A 2VFRA 3LWLA 5B0EA 4WBFA 4DI6A 1RT6B 3MM7A 5J2QA 1JLGA 2OTJS 4RUCA 4USWA 4ZITA 2KVIA 1UJ5A 2BVZA 2FGOA 4LQ3A 3M9NB 2C42A 5KG0A 3KG1A 4B08A 2DJWA 2R2RA 3KHLA 2DGSA 2PSZA 3D1OA 1NXIA 1UEVA 4LRDA 1W25A 2BKNA 1VCTA 4M5DA 1S0OA 2V8HA 1NK8A 4ID8A 3QT6A 3OQ2A 3TW0A 2OMOA 2HSEB 4DS4A 1GMWA 1XATA 1NK6A 4NZ7A 4DBQA 1CJTB 1BGXT 3HSGA 2DITA 4FF1A 5C24A 3N4WA 1HQEA 1YRUA 4U95A 3BDEA 3ZNJ1 1UVIA 3J80U 5HVGA 1S0NA 1PC4A 5A0YB 3PYDA 4I64A 1YJ7A 4X62J 3D28A 2YNFA 3FVYA 1Q95G 1VHIA 2LP4A 4K0KJ 2B7CB 4B3SJ 2WVCA 4C7QA 1Q86T 1G7CB 2KXNB 2M3DA 4JI2J 3AOBA 3QYYA 4KBIA 3LF0A 2WOMB 4GKJJ 2QA2A 3M6WA 1YG0A 3RB6A 1IBMJ 5F9NA 1RB0A 1QSLA 1OSDA 1WI6A 1V3SA 3QIDA 4JB8B 2HS3A 5J2PB 4OI4A 1XC9A 5LJ3Y 2YKPA 3UO0A 3Q8PB 1TL4A 3M2UB 3MUTP 3GYGA 5GAHI 3W9IA 2HW3A 4PG8A 3QNWB 2XO6A 3Q23A 2V2KA 4EUVA 3VTIA 3L95X 2C3YA 4URQU 1S1WA 4KR0B 4KT0C 1IKWA 2HKEA 3T5LA 4DU8A 1GMWD 4YHHJ 5M2PA 1M0SA 4DV7J 4DQIA 4I0WA 1WHWA 4MYOA 2PMZD 2V9WA 3ZTPA 4A46A 2PI4A 2AYGA 3D7SB 4DQPA 4AL5A 2XG8A 1QRLA 1WI8A 1MMNA 2E1RA 3LP0A 1DJ0A 3HVTA 2UVRA 3O5TB 5KG1A 2B5JB 2YPZA 2HLTA 2HAIA 4X62F 2W9CA 2CVEA 2QZ8A 3OH0A 4K0KF 3WQPA 1JLEA 1T9VA 3DLGA 4B3SF 4FXVA 3TAMB 4QIVA 3A3PB 4JI2F 1GNKA 3HMJG 4GKJF 3PJXA 2MHNA 4MFBA 1J2VA 4ZK7M 1IBMF 3MI7X 3MAAA 5T41A 1RLCL 1S6PB 5JJBA 2D3OR 3MUMP 3EUNA 1Y0HA 3G6ES 5F0UA 3IMQJ 5DJBA 1RWNB 3LOUA 3M9OB 2H4YB 3D9BA 3OLBA 3SQGB 4GKKJ 4KRWA 3LPYA 3I31A 4RPFA 2B43A 5HSPA 4ZA1A 1SC6A 3FNNA 3VALA 4MAKA 2CQ3A 4YHHF 4DV7F 4H4MA 1T03B 3BPSP 4KO0B 4OZ0A 1V67A 2XZWA 4IRKA 3RR7A 1IM6A 2FVPA 3M8WA 3EX7B 4PZVA 2HHSA 4DUZF 2W0WA 3ET6B 4O4RA 2AU0A 1RCOB 2B4VA 4J37A 5CQGA 1RT5B 4I7FB 2HHUA 3HSJA 4DV6F 2RJZA 3TDTA 3KWCA 3PCOB 3GCXP 2KB2A 9ATCB 3KG0A 4USUA 1NK7A 2BV3A 4K2JA 2O1PA 1RK8A 4F67A 2AYBA 3IWLA 1F9HA 4EZ9A 3BSAA 1KC8T 1K9MT 2M88A 3OXLA 5E5NA 4O3RA 3LH2S 2GQQA 3K58A 4ZVQB 5AXMA 2BKPA 1XMQF 3HK2A 3DOKA 1HNWJ 3A8EA 4FPIA 4DPOA 2NSCA 1C0TB 1N32J 1WF2A 4J91A 2VBXA 2IVFB 1RWKB 1H72C 4B3MJ 3TVYA 2YKMA 4GKKF 5B0BA 3M32B 4G3PA 3DHXA 1RTIA 4EU0A 1HM0A 3BEGB 1ZYQA 1FESA 2VA2A 4F0HA 5D4OA 4FYDA 3BGLA 2XS5A 2GNKA 2VKRA 5B09A 2ZC3A 1F3FA 1TKDA 2QLWA 1RT2A 3QO9A 2HNZA 2M9KA 5J2MB 3OHBA 2VICA 1TFWA 4B3RJ 3DOMB 1TTHB 3BBFA 3K8WA 1UEUA 1AZSA 4YDDB 2XC9A 4B9NA 1KTQA 4LRBA 1NKEA 3ILJA 5DG9A 3THPA 1S1TB 2HZAA 3Q8SB 2H5EA 1QTMA 4LT6A 1N5TA 1ULRA 4A8KA 1FX4A 1W2BR 1NM2A 3RYLA 2DGXA 5IS2A 3BQ0A 1MWQA 1EIYB 5J1PA 4NCAA 4DV3J 3W2WB 3WC2A 1QQ0A 4NA3A 4LF2A 3RU0A 4DX7A 4B3TJ 5D8HB 3KLEA 1DARA 4DPUA 4DV1J 4XTTA 3NWRA 1KQKA 3ZZUA 3MAHA 3RRHA 1MROA 1MG7A 3PW4A 3GG0A 2J6UA 3A4TA 1SC1B 1CEZA 3U1NA 3A8KA 3OPKA 4R0EA 1PJ5A 1HNWF 1N32F 1RWUA 1VI7A 1B7FA 4U96A 1X4BA 4IH7A 2Z58B 1I3OB 3Q0AA 5HQLA 3QRPA 4TNOA 2OEKA 3KMQA 1I5OB 2P6TA 3V81B 2ZZTA 3NKYA 2HK3A 4A47A 2U1AA 4Y2AA 3CXCR 2ABYA 2DHAA 2LDIA 2KZZA 1FVQA 3D68A 1TVRA 3KMSA 1WHYA 1YDLA 3BO4A 4B3RF 1S76D 2EG2A 2A18A 4NLQA 5IT9Y 1IBKJ 1XQIA 1X5SA 2R7OA 1QRGA 3KLFA 4P2XA 2FJVA 1C1BB 1N33J 3KHGA 1XR7A 4NLSA 5AXLA 1CQNA 1Q7LB 3FMWA 2W7PA 2CPXA 3MECB 7AT1B 1NZAA 2H3EB 1U0SA 4LSZB 1HBMB 2IFXA 4CRJA 3MM9B 1S0VA 3EICA 3JXOA 3KLHB 4DL2A 4LFAJ 4IG3A 3HVRA 4DV3F 2HGNA 5KOWA 4RUHA 3HD1A 3NEKA 3NMRA 1HYSB 1SB6A 3BKUA 4B3TF 2GGPB 2RMLA 5EWFA 2JLFA 3CD0A 1NSPA 5I3UA 3EGVA 2KKHA 4DEZA 3ADAC 2L9DA 1VGYA 1HD0A 2GIRA 3RW6A 3G6VA 1T02A 1ZM2A 1KK6A 5KFFA 4ZP9A 4DU7A 3X3UA 3M9MB 4NLGA 4NCBA 2CQ0A 1RYRA 1KK5A 4Q8FA 5K20B 3CC2S 8ATCB 4I56A 3RTVA 2DH8A 2EEYA 5A2QY 4HCQA 2DO0A 4I69A 3MC4A 2XMMA 1NJWA 5HROA 3MUVP 5KFMA 4P6QA 1KQFB 3CCUS 4B9TA 4AA7A 3GFYA 4X66J 1SUQB 3OR1B 2IC7A 2X51A 3BF4A 1S6UA 4EO8A 4I1TA 4RUBA 3BPDA 1LNQA 1XEZA 3NNHA 1WEYA 3UN2A 2R8KA 4UUXA 1PBAA 1HBOA 2AX0A 1FDBA 3NMAA 4KNRA 1S79A 3IG1B 1N33F 1BXNA 1F9FA 4B3OB 3ENQA 2Z2ZA 1N5VA 2GFFA 2ADBA 2GVDA 2KHCA 3I3AA 1KRPA 1TL3A 5ETTA 4PG6A 1DBDA 2G2ZA 1H2TZ 1WNEA 4LFAF 1RABB 3FSCA 5F8IA 3ZTRA 3MTKA 1S1VA 4EK2A 2W2NP 2CQGA 5KFCA 1VIXA 3CCJS 1AYEA 3UDCA 1VK3A 2DR7A 1FX2A 5KFJA 3SV3A 3M8QB 3FC9A 2ZH1A 1F5BA 4DV5J 1QVFR 2ZC4A 2CPYA 1X4DA 1FRMA 3AXMA 2CQIA 4ED7A 3QZ7A 3DGVA 1JWWA 3R8YA 2APOA 4P52A 2UXCJ 4ECZA 4M63A 5LSLA 2W1BA 4BCAA 1EB0A 4Q0BB 3OTZA 3OVSA 3ILOA 3PM9A 5KFIA 1J27A 3MPUB 2CQPA 3D67A 3LQVA 2ATLA 3FQLA 3O6QA 3H5SA 2JVOA 3W9JA 4ALZA 5BR8J 3MQHA 4QWEA 1UWBB 4KFBA 4X66F 2OD4A 1CPZA 2QYGA 1NB2A 5T14A 1X4EA 2CUYA 4C0OC 2VOOA 3EYZA 4EYIB 1RU2A 4F4WA 2WRMA 3FEXB 4HYKA 1TKXA 2DY1A 3J7ZT 2ICYA 3V4IA 4WFAQ 3C15A 3QJJA 2F9JA 2HIQA 3R97A 3DLKA 4KYZA 3OTDA 4YB5A 3HXMA 3TIOA 4Y28C 2Z8QA 1SXLA 2BKOA 2OH2A 3PZPA 4N77A 1H0HB 2CPFA 1B0PA 2HHXA 3C6UA 4BS2A 1R8BA 5ETVA 1E6VB 4KKOB 1PC5A 5M2UA 3CCWA 2BANB 1RT1A 4CYUA 2Q6CA 3IA0A 4ELVA 1OY9A 1S9GA 3VVTA 4DV5F 1NLKL 3AQPA 2HBYB 3KK3B 4X4VA 1C0UB 2BJ8A 4JBCA 3TWDA 1R8CA 3RR8A 2QKXA 2UXCF 1TKTB 1K44A 3GTYX 3OVBA 1RHRB 2ZUGA 2KYZA 3Q2SC 3J7YU 1DQ9A 2RUSA 2JF3A 2FJBB 3PYEA 2WLDA 2IIHA 2JLEA 3M8PB 2ZE2A 5BR8F 3VBLA 4J7CA 4O44A 1RAAB 5HP1B 1SSMA 2OSRA 3AT1B 2DNHA 2MQNA 3MEDB 4JP8A 5A8WB 2JZ5A 4J5OA 1PG5B 2ZNYA 1S59A 4A8SA 1C1CA 4M5NA 1K0VA 1JXLA 3JTOA 4NX9A 4O3OA 4R7PA 1QD1A 1TU0B 1OQ3A 4I2PA 4XDDA 1FFWB 3MMJA 1BQXA 2N7YA 3HFZB 3NZ2A 3DHOA 4AXJA 1U1MA 2FIUA 1N5YB 4LF4J 1Q5YA 3RB4A 2RU9A 1FI4A 1ROFA 4EBCA 3EGZA 4RW6B 1S57A 2RS2A 1TR0A 1M5PC 3LP1B 3HHDA 4GMKA 4Y0FA 5KFLA 5F3TA 3QRQA 3AHPA 2LECA 2WONA 3QWPA 3VQSA 2PC6A 3VHQA 2MJNA 5MAOA 5FD1A 1H2UX 2VD4A 2WLEA 4DR2J 3I56S 4Z7YA 3H98A 3VBKA 1KDNA 4WKYA 2DYAA 3DRYA 3PRDA 2VDHA 4CP5A 2HNYB 3GZ7A 3GP9A 2CJ9A 4H4KC 2RKIB 3DXBA 5EX0A 2CWXA 2NXCA 2IBOA 4OYPA 2UUTA 4E6UA 2LKZA 2E5HA 5CD4H 1HFEL 3TX8A 3JYTA 2NPOA 4HLBA 3CDEA 1JLFB 3TNVA 3TANA 1RTJB 4USKA 1HQUA 2V2QA 4ZP6A 2FHKA 1Q1KA 3PO5A 3MM6B 1DTQB 2KJWA 3M2RA 3MM8B 3HJFA 4FS2A 1DAXA 1EQ0A 3BBBA 3FEYB 3DN9A 5IT9U 3RGIA 2DPJA 4WFNQ 4ZPCA 1BQNB 2NUHA 4PAAA 4Q43A 2YX7A 3S01A 3MPDA 1KQSR 1YLXA 1NDLA 4LF4F 5HVHA 2LXUA 5DQGA 2DNLA 1DTTB 4PQAA 3UDEA 3GFXA 2WHOA 2K8GA 4F2RA 4BWMA 4U67Q 3TZZA 1AFIA 2MY8A 1NO8A 1GK8A 1E6YA 2D74B 2BX6A 3AFGA 1UEKA 2ALZA 2VFSA 3VGTA 4JI8J 3FBBA 3B54A 4XAKA 3E2EA 3UVJA 2HRTA 3R6GB 4C11B 2H48B 1S0MA 2NQPA 2PIIA 2A6MA 3NWGA 2GHVC 2GW8A 1URNA 1KWMA 3D1HA 3PRVA 4E2FB 2F4FA 1KLMA 5KFDA 1K47A 1UPMB 1PYSB 4DL0C 3G4SS 5DZ6A 4ZVUB 4LVNP 5A2QU 5K9FA 3NGDA 3NY0A 1U8WA 3LPEA 1RUSA 4ZJOA 4RBTA 2GQ2A 2IJRA 3GMGA 1Q0NA 3O44A 3JS9A 3R9LA 2JEFA 2AJQA 2CWKA 5IT0A 3DYAA 1FKPB 4NLUA 4YOEA 3DOLA 3V6DB 4UZBA 2IY5B 4JI7F 5HATA 3DLLQ 4IDKB 4KAIA 1JB0C 3QIPA 4NI2B 4NLPA 3UCGA 2JL9A 3PKMA 1GX6A 1FT8A 3MTJA 1X5PA 4OYWA 3LP2A 1OY6A 1CJUA 1RTHA 3M1VA 4B02A 3R0SA 5A8RB 5KG6A 1SV5A 4ETZA 3MMAB 1FJCA 4ID5B 1G3OA 1KVKA 4ZVRB 3CJTA 2VZ9A 3KYLA 2W7OA 3CJ2A 5LT5A 1TFYA 2XZDB 1YKWA 3HSZA 5KFPA 2EBGA 5AXKA 3IRXA 5B7WA 1JNRB 1LWXA 1FJEB 1M5VC 3R1HA 5E7OB 2ZBPA 4OV1A 4ECQA 2HK2A 4CLTA 2MGZA 2XMJA 2WCXA 5HVFA 2A6OA 4X4OA 3NOGA 1FRXA 4QQBA 3MAQA 4DX5A 3PX6A 4MK9A 1HM9A 1RHMB 2E9TA 1N5SA 2K3IA 4OHYA 3HHLB 1U26A 4FZVA 4OZ1A 1SJFA 2J9EA 2W8LA 3JSMA 1UCNA 3EM1A 3QATA 2CPIA 1QAJA 5I42A 2JC1A 3CCRS 3OTMA 2UU9J 1ZA1B 3BKFA 1RTJA 2AQ4A 3LAKA 3WDOA 1TAUA 4NLXA 2FB0A 2AP6A 4A8FA 1X5OA 3HSDA 1UW4A 4PUOB 1FEEA 3B4DA 4F26A 3K57A 2IVYA 2ZJRQ 2VH7A 5KT6A 2LYVA 3O3LA 1L3UA 1EP4B 1UVKA 4K6RA 3KHRA 3ETOA 1C4AA 2OPSA 3DLJA 2P5ZX 3OFFA 2X3GA 3GQCA 1N54B 2VF3A 3IBWA 3CCLS 4IQXA 2QLXA 1KQAA 3LANA 2PO4A 4OZLA 2BOPA 2KH9A 2IU9A 1FXRA 3VV2B 4EAAA 1YJWS 3RBEA 3TP2A 5ETOA 5GADI 1HWJA 3CB4A 1RT7A 3QFHA 4Q8EA 3PO4A 5EUHA 4CM0A 5A8KB 2FJEB 5H9FK 1GX5A 2GX8A 3FCWA 1W7WA 2W8KA 5GAGI 2KYXA 4AL6A 1HBUA 2RB7A 2Y9HA 2MLYA 1JNZB 4K4UA 1NHUA 1VQLS 1UW9A 1VQ5S 2ZHBA 1H6KX 2IDEA 3CMQA 1UMJA 2F7VA 3V6JA 1M5HA 2VKZG 4DV0F 3CGIA 4GO7X 2F63A 4WU3A 5KT5A 1R31A 3P96A 1D9DA 2B9WA 4A8YA 2ZFHA 1BWEA 4DR1J 3MR5A 4YB6A 1VS3A 1FE0A 3IAS9 2VG7B 1D09B 2R4FA 1RA6A 4MK7A 3MCNA 1UP1A 1FCAA 3SPTA 1HL6A 1QJHA 1DQAA 2QMWA 2XWYA 2V8DA 2DNPA 3IM8A 4M9CA 4W98A 4YR0A 4USIA 1Y7PA 3M8ZA 3QBCA 3DLEA 2DNNA 3SYZA 3D0GE 2EKNA 5CYQA 4QWDA 5D0RA 5ETMA 1F5CA 2FY8A 4K5RA 1OY8A 2KVQE 3J7YI 2YKQA 3NCPA 1S1UB 5KFUA 2DGQA 3BYPA 2MQ8A 4MIAA 2BQRA 5DLFA 5I3PA 3C6TA 3DM2A 1UA1A 2E5GA 3TA1A 1GH8A 2WK4A 3PKYA 2FZCB 1PIEA 2A10A 5BYRA 4TQRA 2QJ3A 4ZCIA 1WSVA 4X65J 3G96A 2MDAA 1R7IA 3R5AA 2ZD1B 1YX2A 3QAUA 1B0VA 3AA9A 1U1NA 3IS9A 2V0HA 2NR0A 3CCSS 1K1SA 3QLHA 5C42B 1N0VC 2FD2A 1NJYA 1JJ2R 1XERA 1U1QA 3IO1A 2UUWA 3TWZA 4ES2A 2LXFA 3EGNA 2F9DA 3CJKA 4CO3A 1WG5A 4WZMA 2G0CA 2X1FA 1NDPA 1QUVA 3LW5C 4O3QA 1THJA 3OR2B 4OYBA 3DC2A 4OX7A 4RJVA 2VV5A 2DEJA 1NSKL 1L3TA 1RT3B 4IHHA 3MEEB 4KPZA 3B4MA 4OI0A 1CJVA 2QSFA 1M5KC 2GAHC 3OFHA 4J9MA 2OP5A 1FK9A 1RTDB 4LMZA 1UZHA 4M5LA 4I2QB 2EFNA 2ZH8A 2KHDA 4L74A 2H1YA 2E7XA 1GQEA 2ALYB 4I67A 5C25B 2BJ3A 4K59A 2K2PA 4DFKA 4RW7B 2RIJA 5G0RB 3OV7A 5FDLA 2WVDA 3K5OA 2KM8C 2HWHA 4G3IA 1XK8A 2JVRA 1KHWA 3T41A 3QJPA 3W2VB 3HD2A 3HHEA 3FFIA 2VONA 3T5HA 3OJSA 4OHXA 1BHNA 3C16B 1NK5A 5DQIA 4X65F 3DMJA 4NASA 4LIWA 2W9BB 4EA7A 1RU1A 1CJKA 4X4TA 3TARA 1F9EB 5E3QA 2OGUA 3L4BC 4M5IA 2HHHJ 3QZ8A 3IBCB 2J6SA 3D6TB 3EXCX 1UL3A 4DUYJ 3AB4B 4DF8A 2CJKA 4N6BA 1TL5A 3I55S 3ZXWA 1J5OA 4ICLB 3SI8A 2BE7D 1I1GA 3D8VA 3CC4S 4DLGA 4BDPA 3DRPB 4KY3A 4RW4B 4KPYA 3KJFB 4IG0A 1VJQA 3UW1A 4WYWA 5DG8A 3MMBB 2IYGA 3KXDA 3JSBA 2YH1A 4KC5A 4DZ6A 4O3SA 3CT9A 1S1XB 1EJ7L 4HTJA 2Z2MA 4WWSA 4WP9A 4QR2A 2XWXA 4MT1A 4F25A 1SSQA 3B78A 3M2VB 4DQRA 2R9LA 4CQ1A 1F0XA 1OPZA 2Q66A 3DRSB 2CPJA 3O2IA 1EAYC 5BYQA 2ZHAA 4LF9J 1HM8A 5E3AA 1KN6A 1R0AA 1IKXB 5K8NA 3AA8A 3T6JA 4OX9J 2R7QA 5T7LA 1FJGF 1F2GA 1TZ0A 4ZPWR 4LRCA 2VD3A 5DM6Q 4C8NA 5HJYA 1CULA 1U48A 1QREA 2CQ4A 2V8GA 3ZZ0A 3KJVA 2BW7A 2OHDA 1H73A 2XYPB 2HHHF 2MKHA 4FNIA 2FTRA 1FRKA 1VBXA 4DUYF 4PYDA 3G9CA 3F0NA 2GO8A 2RF2B 2HHVA 4U8YA 7FD1A 2MMYA 2BE2A 2IM0A 4OI1A 4J9RA 1A6LA 2J0QD 3D5MA 2C3PA 1YJUA 4JV0A 3Q8VA 4DSJA 2LA4A 3OUYB 2VG6A 4H54A 2DIUA 3AY0A 1UVNA 5D4PA 3JQYA 1X0PA 1S9EA 5LMNJ 2HLUA 3AQOA 1TK0A 3KK1A 1ZM4A 3DI6A 2LQBA 2MKKA 4NYOA 2FVQA 1A9NB 3EGWB 4KV8A 3SDEA 2XMKA 3CO0P 3C8VA 3JTNA 3V4MA 2LEPA 1QE1B 1Q4RA 2VFUA 4DN0A 2L48A 3MXHP 1IUJA 1CVJA 4LF9F 4J9UE 3OL7A 3VAHA 2CNNB 2D1CA 3HKWA 4OX9F 1T95A 4ZOSA 1LW2A 3T1AA 4F7VA 2YKNA 5DO2A 1R43A 1S5ZA 2D3ZA 3T5KA 1OCXA 3GOSA 4NLWA 3U1LA 4LF7J 1NPRA 1WC6A 2NPFA 2YBVA 2K1RA 2IM2A 8RUCA 2XTJP 4F4ZA 1REVB 2VHGA 1DLOB 2IA6A 4DJBA 1BUXA 4X4RA 4AT1B 5A6PA 2XYGB 1LWEB 5DGAA 3MMCB 3D98A 2DKOB 2ROGA 2EI5A 2JEJA 2J0WA 2R8HA 2YNGB 3G8SA 1T8EA 1Q79A 2J0XA 4ECVA 2JDJA 4R8UB 1FRIA 2U2FA 1YK9A 1NJIT 1JLCA 2GHPA 1JX4A 1LKZA 2UVVA 2X1BA 2OPQB 1Y3KA 3DRXA 5LMNF 3HKZD 5I3QA 1IXKA 4NRUA 1BMQB 3M30A 4YY3J 5E3PA 4LR8A 4OZ2A 2OEGA 2GIQA 1FD8A 3T9NA 3R5DA 3CIZA 3TEGA 1AA1B 3X1LB 4L73A 5KFWA 3KLIA 4DX8H 3R1LA 2R7UA 1Q78A 3C14A 2CPHA 2V0NA 1EKRA 2DNKA 1N34J 3FSIA 1DHMA 2A2CA 5HN0A 1EETA 2G13A 3CJ4A 2EW9A 4NE9C 3VAFA 2F4VJ 2RNEA 3VZIA 3H59A 3OU9A 2K7JA 4ZN3A 2K06A 1D0EA 5J2NB 3NP5A 1TK5A 3BSSA 4LF7F 3TOQA 2UP1A 5GAEI 3POTA 2QGFB 4DR3J 5L8RC 3K5MA 2IC3A 2NUUG 1RKJA 1VLYA 1JKHA 2YY3A 4EFAC 1PYOB 3TI0A 5KG5A 4LR7A 2MKCA 3QGHA 1PBUA 3I0SB 2DO4A 5L9XA 1SVDA 2HFOA 2HVDA 2CPDA 3D2WA 4C9DA 4NRTA 4IFVB 2VBWA 2ZOFA 3BGOP 2VFVA 1A7GE 4ES1A 2R8GA 4IR1A 4YY3F 1QRFA 4HKQA 2CJBA 2VFTA 3ISNC 2C2NA 3MQGA 2HBRB 4OJGA 2JWNA 2HS0A 3PRBA 3H5UA 2CKWA 2HQCA 1S99A 1XNRJ 3TRGA 4NZ6A 2FC9A 5CYMB 4QIWD 1G1XA 1RSCA 2JSXA 4FXDA 1V5VA 3IFEA 4HDGA 1VQYA 1N34F 2CZVC 4ZHRA 1SCJB 4C8LA 5KFXA 2DH7A 2B56A 5GAHU 2DNGA 1IJEB 1TV6B 3F56A 4JV5J 3FGVA 4J9LA 2XYHB 3W3SA 4ZCKA 3N5FA 3B8HA 4Y34A 3T1YJ 1RWOB 1LFWA 3W60A 4DR3F 4GVBB 4UOFA 2XLKA 2CZ4A 2Q6BA 3VWSA 2KFZA 2PEHA 3KK2A 1URRA 4LVOP 3LGMA 1OS5A 4HHHA 1R0CB 3NAHA 2GJIA 2FZKB 1V3ZA 2AMCB 2GVZA 4MH8A 4HI1A 2OI7A 3QMQA 2V94A 2W2QP 3LGNA 4HEA9 4M5GA 4QWCA 3OH4A 1TUWA 1NPKA 4O0IA 4P72A 1IBCB 5FJ4A 1WOPA 3PEHA 4DG1A 1I51B 4PG4A 1RHKB 2DCUB 4I6AA 2ZH9A 3UWTA 4ZLPA 2BJ1A 4LIRA 4LBHA 5J1EA 5AFUU 4USVA 2XGQA 1HNVB 2QG9B 1XNRF 1JLQB 4HHUA 5C2GA 1HKAA 4ZVEA 3PMOA 4F02A 1H98A 1OQ6A 5BJRA 5DDPC 2IRUA 3BH6B 2CFXA 1QY7A 2D3UA 5HANA 5JXSA 2XMUA 2JNJA 5E33A 1PKUA 4NMXA 2J7KA 2NCKL 5KT2A 2B9XA 5C2CA 5DZ7A 1LWFB 4JV5F 1VRUA 4DL5A 4OX8A 4IFYA 3HZGA 2H4WB 3OSPA 4WE1A 1ACMB 1G6BA 3TK8A 3T1YF 2ASLA 1YP3A 2YNHA 5KFSA 5F3ZA 1JLAA 4TU9A 1FWKA 3M4XA 2VODA 1LXJA 1RAFB 4FYYB 1KRUA 2VBYA 5IC6B 4H7OA 2F8EX 4M5KA 2HS4A 2MSTA 3BQ2A 1T05B 2EG1A 2QMXA 1KBRA 1SL1A 3P5BP 2P5VA 2RDJA 2C2RA 2KN4A 2IMWP 4Y6IA 3MM7B 5J2QB 1JLGB 1PAEX 2M0GB 1Y4ZB 2ROPA 3NXZA 4Y00A 2ERRA 2HBQB 4PXCA 1WDTA 1VQPS 1QDUB 3WZ0A 4LRAA 2LQ8A 2CXEA 1T3OA 2D3O1 3CEDA 2DK2A 4ZJQA 3C46A 4RNHA 4J9QA 3RAXA 4JI3J 4UY85 3PNIA 2JFKA 3Q8RB 4M5DB 3Q8UA 3P1BA 4QCLA 2YX1A 2R7TA 4TY8A 3W5XA 1T9UA 3DDKA 3VBIA 3BGFA 4FXWA 3F73A 2PFDA 4CO1A 1WKLA 2OFGX 3GYXB 4YR3A 1IWAA 3W65A 5C24B 1HQEB 3TEHB 4ZMMA 3AB2B 1YHQS 1NKCA 1KK4A 1GMVA 3N28A 3I9ZA 2KDOA 1EKSA 5ETKA 3THTA 1IWGA 3MR3A 1TL7A 4A48A 1KRVA 4ERDA 1C4CA 1LW0A 1LWCA 2YNFB 4FKYA 4PQUA 2YQ3A 4K4WA 3HPOA 1Y5NB 3ZTOA 4O0NA 3VCDA 5HLFA 4P2SA 3CJRA 4YFUA 3OL6A 1VQ9S 3EJMA 4CCHA 2AT1B 2BJDA 1Z2FA 2OPRA 4LF6F 3LAMA 4HHJA 4PXBA 2W7AA 1U49A 2VUGA 3G71S 5U47A 2I2YA 3C8YA 3T57A 4JI0J 4RNNA 2BYCA 2WW8A 4JI3F 1SJ4P 4TU8A 3S7RA 4J09A 4RBUA 4USHA 2O66A 1S1WB 2HBZB 2MQOA 2DPIA 1IKWB 2VHEA 2LLZA 2HQIA 5HK4A 4MIWA 2HVEA 1SC3B 4P9SA 1HWLA 4NXMJ 3NNCA 1KGQA 3RG6A 2MZJA 2VB6A 4HUSA 5HMXA 2MXYA 2UUAJ 1UJ4A 4EA8A 2OSQA 1GFWB 2ZWPA 2HGLA 2WZ1A 3AXKA 2E5JA 1CG2A 5DGBA 2OPPA 2Y0SD 2XHWA 4ETXA 4KB7A 3LP0B 3HVTB 2ZJQQ 3THVA 2FKOA 1RBLA 2W9CB 5EGYA 2BRKA 1FXLA 4HVZA 1JLEB 4ILRA 2R7XA 2BRLA 4S0MA 3DLGB 1N88A 4OJHA 4Y2MA 2E9RX 1QUPA 1AXQA 4F3QA 1TL1A 4DCPB 2WW4A 3HT3A 4OMFG 1KLNA 3L09A 1XMOF 3OFEA 3DK5A 2FLNA 1MU2A 4K7QA 4LSLA 1L3SA 4DPTA 4MFBB 4R5PA 2BR0A 3MAAB 5DDQC 4FCEA 3BSCA 4O3NA 5C5JA 4J90A 4CLPA 5KFAA 3FZBA 1GMUA 3Q1XA 1J5EF 2GIFA 3H4DA 4O4GA 2CJQA 1MWYA 3QGIA 1CSJA 5LJ5Y 2IRXA 4JI0F 3SZ2A 2P6SA 4Z7CA 5ETLA 1WACA 2AJ1A 5J1NA 1BWVA 2OELA 3BN4A 4PPDA 4PG7A 2DHXA 4OZ3A 1WELA 4F50A 5CH7B 4ECSA 2XY5A 3L3CA 4JI1F 2EPIA 2AGPA 1T7PA 2IVMA 3D4JA 1GXTA 3PACA 4H4MB 2CVIA 4NXMF 3W1YC 1OYEA 3U02A 2FJDB 2FDNA 2UUAF 2VQEF 4C8KA 1Z4UA 3KWMA 4X4SA 3CTRA 4U7CA 2AJFE 3GIMA 1YIJS 4PYAA 5K14A 4XDCA 4IOCQ 3W63A 4NLVA 1M8NA 4G65A 3I4HX 1Q7YT 2KRBA 1Q8BA 1U7LA 1VRTA 2FJXA 3TV0A 1D9FA 4K4SA 3VAJA 4PWUA 1RWVB 3QQCD 3CDWA 2HNDA 4HI2A 8AT1B 2YWGA 4XPEA 4DSKA 1GT8A 2TDTA 3K89A 4OYOA 4ZVFA 4AC3A 4CZCA 3FJ2A 2W25A 5DM7Q 4FKXA 1EQMA 4N7TA 1FXJA 4TN2A 2KO1A 3DOKB 4R0JA 3CJSA 1WC0A 1RWXB 2HYIB 1NK4A 4OX6A 1YTYA 2OEFA 2YKMB 2OI5A 3SCKE 4QPTA 1WC3A 4AFFA 1FWYA 2AX1A 5KG4A 2ASDA 1XR5A 4H4KA 2QLJB 2IUAA 1RTIB 4ILMA 4CLZA 5D0EA 2C2EA 4RU9A 2IBKA 2VASA 4G1IA 4TVAB 1REGX 2GGQA 1RT2B 4DSLA 3QO9B 2HNZB 1MNEA 4GVLA 3CD5A 4YB1P 2QT7A 4KPCA 3AJ1A 2O3DA 1QVGR 1T11A 2N82B 1AZSB 4J9PA 4KPXA 4LFBJ 4WIQA 3NLCA 2R7RA 1HNIA 2MYFA 4RWXA 4LQ9A 4DUZJ 5KFQA 1P6TA 4G1PA 3SQOP 3UN3A 1RDRA 1UPPA 3H20A 1S7IA 2PGCA 3IM9A 3RJMB 2ASYA 1EHWA 5GMEA 3B82A 2GQCA 3IAM9 2R7SA 4DV6J 2HIYA 3ZZTA 4B17A 3JSYA 1V9OA 2F8HA 3B6BA 3I9V9 3KLEB 4OZ5A 1X4CA 2A2DA 1I6JA 1MROB 4N6AA 2ZBIA 4QR1A 2B4UA 2LQ9A 3EMTA 1XN9A 3CPWR 4LBPA 4QU6A 4PWWA 2G1HA 5KTQA 2MKIA 1XMQJ 1X5TA 1I94J 3A8IA 4EGLA 3ITHA 4C48A 4AL7A 2CA9A 3HLUA 3VAMA 2WLGA 3F1XA 4P2FA 5LSOA 2I9SA 2O67A 3JQKA 3NGKA 1IN0A 4H4OA 4NCGA 3MPYA 3CWJA 2J9CA 1IKYA 3FEZA 5HBMA 4E6TA 4OYAA 3EZUA 3VBMA 3MCSA 4CLWA 3LALA 2D69A 2DEIA 1TVRB 2VPWB 3KNGA 3I0RA 1SIWB 1U6BA 2W4PA 1Q8IA 2W4DA 5K8OA 4K4ZA 1FNMA 1IKVA 4D3HA 4C2MA 3KLGA 2LDYA 4F8RA 4K2XA 4DR6F 3KLFB 4LFBF 3R3RA 4UZCA 3A1YG 4K4TA 1HPZA 3N01A 4U7UD 3VAIA 1N6QA 5LXYA 1X9SA 3QGGA 4P7TA 3NL0A 3PR5B 3ONQA 4UT4A 3G6XA 1RJJA 5IT4A 3R2DJ 3H8YA 4YEAA 1Q8LA 4IG3B 4CLUA 4U7UK 3P3DA 3IP0A 3P4UB 1FKOA 3ZZPA 1T3DA 4CLYA 2R7VA 4YUDA 1O5JA 2NREA 4ED5A 2QIAA 4RNFA 4Q7AA 1IJFB 5I3UB 2VPYB 5ADXU 1SQGA 3T6BA 3TAQA 2YX4A 3RBZA 1U1OA 1RZMA 3SIPB 4HT7A 5M2RA 1I94F 1D9AA 3WIUA 2F3JA 4NA1A 3R27A 1IR0A 5KFTA 4X4UA 4P75A 1RQ0A 3M6VA 2KT2A 3NCQA 3BDPA 3UPFA 4KHMA 4BLGA 4CLKA 2KG0A 2AF6A 3BSWA 4OLOA 5HROB 4DR5F 2DHHA 1K1QA 1RAJA 2Q3PA 2C3MA 4UTGA 3M7VA 5AE1A 3EVOA 3MM5A 2HQGA 4DCLA 1H3DA 1PYTA 3CCQS 1QSYA 1NZ8A 1APSA 5HMYA 4F4AA 3BSNA 4PEOA 1HBOB 4B9LA 2LQ5A 3CE8A 1SH0A 1DURA 1FDDA 2YVSA 3DDNA 4K4XA 3CMAS 3TZXA 2PEBA 4EYHB 2V4JA 3CVKA 2GVDB 3NGRA 1WHVA 1TL3B 2XULA 3QT5A 2OIHA 2DISA 2VC1A 5THWA 4QWBA 4ZN1A 5FLXY 3H5XA 1RGVA 1S1VB 4QJVA 1YP4A 4R37A 5KFRA 3L7OA 3D66A 3R7SB 5LOQA 1MW7A 3S6EA 2W2OP 2KM8B 4RWWA 1PCAA 1QAYA 2WB1D 1QRMA 4HZDA 3TJAA 4DXLA 3HHKA 1UFKA 1YSJA 5E41A 2G9OA 2X7IA 3HHNB 2BQUA 4X64J 1T0TV 3Q86A 2YKAA 3H7HB 2IAJA 3H90A 1Q5VA 1MN7A 4G6VB 4KFBB 4OLPA 3UNYA 1SJRA 1L3VA 1XIQA 1MLAA 2Y1RI 3P8BB 2EK6A 4IOAQ 3ISZA 1TKXB 3R1WA 4A8QA 1HWUA 3IC1A 4WXWA 1VC5A 3O8WA 5CAAA 3V4IB 3IN5A 3C15B 2O5DA 1OO0B 2DXDA 3DLKB 1V3WA 4DOZA 1G97A 2VG5B 3CDUA 1JJHA 4HACA 4KGVB 1HMVA 2VA3A 4FYXB 4Y2KA 2XNRA 5IM0A 4DQSA 2EK1A 2XMWA 2ZITA 2OEMA 5B0AA 1B64A 3C6UB 4WF9Q 1SI9A 1NK9A 2RH3A 2GZOA 1RT1B 3IWNC 4CYUB 1KQGB 3QT8A 3R5BA 1S9GB 3MEGA 1KGTA 1R0BG 3OGZA 1ITPA 1R27B 1BLUA 2J7UA 4ED8A 3H5YA 1IBLF 1FNOA 2L9NA 3DU5A 1DQ8A 4MKVA 1HHQA 4OZNA 4X64F 1DRZA 3RUBL 2HAFA 2XZTB 2C3UA 2XEXA 4ITSA 2QV6A 1UAWA 2ZE2B 1OSCA 1FO1A 3SXLA 1KFSA 4O44B 2XMAA 4K5SA 2HFSA 2WBRA 2HEKA 3SFUA 1U45A 2GJFA 1Z1ZA 3UCUP 5D3GA 2L08A 1YQHA 1C1CB 4M94A 2DCLA 2AQ9A 1A0OB 4GC6A 1ZM3A 3UD5A 3N6MA 3UNGC 2HHPA 2AEJA 5LSRA 2EFVA 2IRYA 1RHQB 2CQDA 4I2PB 2QN6B 4FP9A 4HDHA 4QYZK 4JV2A 3TAPA 3G87A 4B9VA 2JF2A 2DIVA 2L41A 1TKZA 2RDDA 5K5MA 1ZPWX 4KTQA 2I8EA 2ZBCA 2QLBB 1FEHA 1YBTA 2L9WA 1JXVA 3GQ8A 4FDFA 4NZ0A 1RTZA 3Q8QB 2WONB 2Q4JA 1B70B 5BXIA 2UUBF 4IH6A 2ILYA 1O8BA 2C2MB 2LXIA 1OJ4A 4PABA 1FNXH 4C3KA 1SJ1A 2UXDJ 1FTCA 2Z2YB 3DRRA 3MR2A 5KFZA 3OL9A 3H2LA 1BE4A 4RW9A 3JQMA 4CNYA 4KHPJ 1NJXA 3P45B 2RS8A 4Y3CA 4CT9A 3ENAA 1KTVA 1F6TA 3BM7A 2RSQA 3BRKX 3ZTQA 4LSNA 3A3NB 3OBIA 1UVJA 1FTRA 5GADU 3JYTB 3W9HA 2PMHA 3PYFA 2M4MA 1U25A 4CM2A 3PG9A 1HQUB 4ED0A 5DDRC 1H7XA 5IQQA 1JXEA 5GAGU 3FWWA 4LJMA 3IR6B 3NBPA 4QPXA 2R3VA 1UVMA 2W01A 3M2RB 2MHEA 3VGSA 4P2MA 1TELA 3A12A 4V19J 3U1MA 5IQ6A 3ZC4A 3PY8A 4DF4A 5LL6d 1U2FA 3EVWA 3E01A 1Q81T 3CJ3A 4ZS6A 2VG5A 4ANDA 2KJVA 3KJNB 3CF5Q 3JQJA 3MPVA 3TUJC 3HHLC 3AJ2A 3FSXA 3M05A 1JK9B 1JJCB 1IQTA 4DPXA 4YN3B 5HJXA 3GLJA 5KG7A 4F2SA 2BABA 1VQ7S 2VPZB 1NH8A 3M6XA 1E6YB 4ANCA 1X9WA 5L6SA 3H25A 4IO9Q 1SQFA 2SXLA 2HRUA 3UVJB 5H1SV 2UXDF 3UR0A 1FHTA 1RI7A 2JJ4D 3TISA 1KLMB 1RAHB 1Y5IB 3FRZA 4CTAA 1KVJA 4KHPF 2HVIA 2B3TB 1JLBA 1QAXA 4KGZB 3R6LB 5B08A 1K8AT 2ZVIA 1GXLA 1UVLA 4U6PA 1RCXB 4ECRA 2GHWA 3ZO7A 4PWDA 4PG5A 3SMZA 1X4GA 3PVXA 2DNYA 5IV4A 3PHEA 2FLLA 4MKAA 2DRAA 3DYAB 1SL0A 4DV4J 1R8AA 1X4FA 3C66A 4W4MA 1RP5A 4FBTA 2XSJA 4WXOA 3DOLB 2MKJA 4KE5A 1HARA 1HA1A 1AUSL 3K17A 2I5JA 1N4IA 3QIPB 2CAJA 4M98A 2H9ZA 2DGOA 4MFGA 2OJ3A 3Q89A 4J9VA 5KT4A 1UJ6A 1HI1A 1VQKS 3CJ5A 3LP2B 3DXSX 1CLFA 1VFJA 2AWZA 4G1QA 1CJUB 1RTHB 3M1VB 3MWBA 2V34A 1SV5B 3TX0A 2LA6A 1S6QA 3L7UA 2OI2A 4J9NA 5FLXU 5H9EJ 4TLQA 3EE3A 3IRXB 4DMZA 3G82A 2DNQA 3TUZC 2HQFA 3CD6S 4CH0S 4NLYA 3AD7C 3P5TL 4RW8A 3BBCA 5DS7A 4UOCA 2MGZB 3ECTA 1KKHA 5IOLA 4RO0A 2XMVA 2OMLA 2BJ7A 4O3PA 3HZEA 4ISXA 4NXNJ 1RT4A 2CJAA 3DDIA 5B0DA 1HW8A 3SUCA 5E2QA 2HZCA 3JSMB 4DZDA 1LOUA 2WSFC 4ZLJA 5I42B 4CO4A 1QTNB 2KT5A 1VOMA 3I3XA 2ZUAA 2MKYA 3L7PA 1C2PA 3NGSA 5RUBA 4Y65A 3A8JA 1U1RA 1FWPA 3Q83A 3FCHA 4DV4F 5SZTA 4X2BA 3EEVA 5DG7A 3BGRA 2V5HG 3GYNA 4WTYA 4WP3A 1VQMS 4QU7A 1P9QC 3CD7A 1Z2LA 4N69A 2JOQA 4JI7J 3KOAA 4IOBA 3RW7A 1N0UA 2KT3A 3MZIA 1HR0F 1OYDA 1HBNA 2MQLA 3VBNA 3PTWA 1FF2A 3RBXA 4CLFA 2FPHX 3FBCA 5A6WA 2OPSB 2D41A 1NSAA 4KJIA 2QA4G 5LMUJ 4AQYF 1XNQF 2YNIA 4F3MA 3WBZA 3M8RA 1T9TA 1CS4A 2XS7A 3N79A 3LA0A 4ZCMA 1KHRA 3FZ2A 2V67A 4DPYA 1UETA 4ED4A 3ZZRA 3OW2R 5AFUV 1RISA 2PMWA 1RT7B 2J7WA 5ETNA 4DR7J 2G4BA 3BREA 1TAQA 2Y1LB 1HBUB 3GJQB 3BZQA 4OQJA 9RUBA 4WFZA 3C19A 2M5YA 2IHR1 2ZNZA 5E3CA 3ZTSA 4NXNF 3OL8A 4V1Ak 2V9KA 4RNMA 3TA2A 1VR6A 1FXDA 1U09A 1V6HA 4ER8A 2FVRA 1MSWD 4OI2A 1WF1A 1M1HA 4Q2MA 2V4QA 4UOGA 4OL8A 2CPEA 2HMIA 1P9YA 3QFWA 4JOUA 2CZ9A 5AJ3J 2EVZA 2H5JB 1KOHA 3UFCX 4M2AA 2H54B 1YZ6A 1YRXA 1FRHA 2MLZA 1HI0P 1BQMA 1HWIA 2UZAA 5CYJA 5AE2A 1F2HA 4FS1A 1U0HA 3CCTA 5GMDA 4EABA 4C3MA 2HURA 3CO9A 2MZSA 3GFZA 3DLEB 4WFXA 5LMUF 1MR9A 1VHFA 5CYQB 3MDFA 2RQKA 1VQOS 4BHQA 3D6HB 3R7NB 2MTLA 3DFEA 3UR3C 4JV1A 3NNAA 3W5YA 3V2UC 3SFGA 2AIRB 5ADZA 2FGCA 3KTQA 4M28A 2MQQA 3H42A 4ZVSB 5KFOA 3C6TB 1FD2A 3T3FA 3DM2B 1Z90A 3AD8C 2E66A 4DR7F 2PA8D 4ECWA 4EEYA 1F5AA 2ZWOA 4DS5A 4PR6A 4RLEA 3OT9A 4DFMA 2M52A 5KAKA 1VQ8S 4HZCA 2E7VA 1RT6A 4K8RA 6FD1A 2F65A 3IS9B 2YQ0A 1YBUA 2B9EA 4P71A 3FRYA 3EVMA 5H9FJ 3QLHB 4DV0J 3GUEA 1ZM9A 4EA9A 3TJ8A 2BM1A 4X4NA 1UKUA 3OH2A 4KQZA 1FWLA 3A3OB 2N3OA 3CJKB 1OPIA 4XIUA 2YWHA 1NB7A 2KTQA 1QAIA 4HTIA 3T19A 5AJ3F 2G1DA 1WF0A 1WC1A 2XB2D 3BJYA 5CHCB 3QGPA 2DR8A 2WLFA 3IXCA 1DY3A 2M8DB 1SJQA 2YWFA 1L0SA 2CG8A 4V19X 1R8PA 3GE9A 2RAQA 1CJTA 1CJVB 3I5AA 2CADA 4ECTA 1RYSA 3N0VA 1FK9B 3NGUA 3KNAA 1KHVA 2FVSA 3CW2C 5E0OA 2MSSA 3W66A 2EKYA 1MN9A 1P27B 1VC0A 1HIYA 5A0YA 1NEEA 4RUAA 3ISND 1XHDA 1U24A 3FK4A 4NEZA 5FIIA 3DNCA 5FDLB 1NHVA 2F5GA 3CNQP 1SH2A 4YP3A 2JRSA 4LREA 3JB9k 1SL2A 3DU6A 1OIAA 2ROEA 2QL9B 4USMA 3FFIB 1YJRA 2WOMA 1FJ7A 4KIAA 1VJWA 3EZ5A 2EFPA 3KDOA 3DMJB 1JIHA 3G8TA 5IFMA 3SCLE 1CJKB 2E5IA 1XR6A 1ZZNA 2FJWA 3OSNA 1F3VA 4C0BA 1OMSA 5J2PA 3KUHA 5LXRA 4OYMA 1EWWA 5F8HA 2ZEJA 2CJXB 3OH3A 1NNDA 3U7JA 3M2UA 4DL6A 1N8RT 4G87A 1FRLA 2DGUA 2M70A 2RT3A 1J5OB 4QYRA 4XK8C 3PDNA 1B99A 1S6OA 2C2OB 2L3MA 5JUMA 2B6AB 2DHSA 4ZVGA 1R6VA 4IG0B 4AE5A 1K73T 2W4CA 5GAEU 4UY8T 5JMNA 3Q22A 2J5AA 4HL9A 3R5GA 1RA7A 3J7AN 2AEMA 2YKOA 2I38A 1GEHA 2XBPA 3F41A 2Q43A 1NPPA 2B5JA 2Z2LA 3NAIA 4DFJA 4J18A 2XCAA 3IBFB 3TAMA 5DG3A 5K8PA 1H38A 1LFPA 4N76A 4NYPA 1ZOTA 4CO2A 2QFIA 4KQLA 3Q2TC 1R0AB 3H2UB 5T7LB 1HHSA 3IRWP 1ZAVA 3S8SA 3IGVA 1CULB 4E1KA 1S6PA 3KJVB 3WC0A 2VPXB 2R8IA 2RRNA 2E5LJ 4B3MF 3A13A 3PR4A 2MY7A 4B9MA 3SQGA 4F4XA 1R89A 2ZH7A 1T9XA 4FF4A 2B8PA 2C22A 4C98A 3DHWC 1MMLA 3HO1A 3MFIA 4UOHA 4E0DA 3G8QA 2W2PP 2H51B 4CH7A 2OEJA 2BE2B 4ZKAA 2QYCA 4ILLA 1SC4B 5B0CA 4LBIA 2FHOB 3KFWX 5D4NA 1ICEB 4RU2A 2FJAB 1ZH5A 2CDRB 1EZZB 1T03A 4KO0A 2EC2A 1IVZA 4EBDA 2VG6B 5L1IA 4BWJA 2PN6A 1N4LA 1S9EB 4G3SA 2OO4A 4YS2A 2ZOGA 4N5SA 1VQ6S 2MEWA 2ADCA 3CCMS 3KK1B 3ET6A 1PJ6A 2DB1A 3DI6B 3I96A 4M5MA 4NLTA 3O1LA 1RT5A 4I7FA 1CC7A 2BE9B 5L1JA 3EDRB 4NMLA 4KV8B 3SDEB 2CNKB 1XBWA 3SRTA 4WU2A 1KFDA 1P1LA 3MOJB 1T3NA 1NRKA 2Y8WA 4DV1F 2JEIA 1X60A 2K7KA 1D8ZA 1FFGB 2CDQA 3ST8A 1FJGJ 3MEKA 4AYBD 1LW2B 2GV1A 1Q8KA 2YKNB 2ACMA 1O51A 3HDSA 1C0TA 3LWMA 2XGPA 5D15A 2BM0A 2E5LF 4F36A 5KG3A 1WJ9A 3N5BA 3CC7S 1RACB 2K1RB 3M32A 4MIBA 3LUYA 1IM4A 1W2IA 4M95A 2PFFB 2DNRA 2VL1A 1B7YB 1VIOA 4USTA 2IA0A 5CCLA 4L6V3 1RHJB 4PPZA 1X8DA 2XCPA 2BACA 3PXGa 4ZPDA 3W7BA 1VQ4S 1T94A 2B6AA 2DD8S 3D3CJ 2AJ0A 5J2MA 2JFDA 3DOMA 2CNOB 1IBKF 1F60B 1XWLA 2RQ4A 4EMDA 1W26A 5G4DA 2DNZA 1JLCB 2MZRA 3D6FB 2GAGC 2AJ4A 1N36J 4FBUA 2DR6A 2YTCA 4WKRA 1S1TA 1WKJA 3M30B 4DQQA 4IQMA 2ASJA 4QBUA 2JLGA 1S12A 3I87A 2CJYB 4WP8A 3OTCA 3UN5A 3JAMY 2DTJA 2W2MP 3FOQA 4TLRA 3W2WA 3KLIB 2NYHA 4PXEA 1WKKA 4L72B 1KSPA 3GIJA 3PJWA 1WDDA 3C14B 1YGYA 3AODA 5L6VA 4QWAA 4YB7A 5K8MA 3MGJA 5DDOC 1EETB 4MKYA 3OLAA 3NS6A 2CQHA 2QFJA 4EBEA 2WTFA 3HJVA 2ZM6J 2E1PA 5E3RA 3QWUA 4PRFA 4KHRA 2CPZA 4Y2CA 2C1EB 4DCOB 3WHIA 3POTB 1LV5A 2EBEA 1UTAA 3HFKA 4EI2A 1TQLA 2JHEA 3F44A 2IC3B 3V81A 1KP6A 4PCQA 2HFUA 1JKHB 4OI3A 3TQ1A 4B9UA 1ZAXA 2GS8A 2EC0A 1HNXJ 5KT7A 1WG4A 2C2DA 1SKSA 2MQPA 1RWPB 2B8QA 4UQGA 3HULA 4NL5A 4UW2A 3QJLA 2WLCA 1Y11A 4DSFA 5CZVA 5ADXV 2B4OA 1C1BA 1N36F 1H2VZ 2QLFB 3V4EA 1VBKA 2RQCA 2N3LA 3MECA 5KFEA 5KFBA 2HPUA 2QC3A 1HBMA 3QAEA 3WX4A 1RADB 1XTZA 2ZH4A 2GJ2A 1G4CA 3MM9A 1NK0A 3RRKA 3HI9A 4CO5A 1UA0A 2QL5B 3KLHA 1GAOA 4FPRA 2V8VA 3KDNA 2QE5A 4B9SA 2AV5A 3SCIE 3CJQA 1Z2ZA 1U6ZA 3HP6A 1OWXA 1SQEA 2P2OA 1HYSA 1NUEA 2GGPA 4J9SA 1ZS6A 3OD2A 4J9KA 1D3WA 2QTWA 4ZHRB 4ED1A 2CNLB 2PI5A 4M99A 4IUFA 2Z57B 4WPAA 2KFYA 1PGZA 3EZOA 2J9DA 3BN7A 5SUHA 2ZM6F 3UDVA 1VK8A 2BUNA 3EWGA 2KI2A 4WTOB 4MKBA 1F1BB 3OVAA 3EXYA 1XMBA 3EPIA 2FHJA 2V4RA 3MURP 3PW0A 4QZVB 2VBZA 3KK2B 1BC6A 5F42A 4ZPAA 4FVMA 4GO5X 2B51A 1HNXF 2XS2A 1SUQA 3OR1A 5EX3A 4WIIA 3ENWA 2XLIA 2GVZB 4ELTA 2MQMA 1ZTTA 2JEGA 1K0TA 3IG1A 1EARA 3GWCA 3QSYB 1HD1A 4X4PA 3J81Y 4B3OA 3BSOA 4FYVB 3KUEA 1YI2S 3QT7A 5L1KA 3HVAA 4DG1B 1X4HA 3AJDA 1HHTP 4DDFA 5IC4B 1YVFA 3D1QA 1NDCA 3OXGA 2G2YA 4WYLA 1X9MA 1AROP 2CQ1A 1KD1T 1Q53A 5J1EB 4I68A 3QPIA 3GFHA 3FCVA 4LF8J 4CDIA 5CXTA 3OFGA 4NEYA 1U1KA 1PSDA 3SCJE 1RXOB 3M8QA 3V6KA 3HCXA 1VLOA 1WG1A 4MK8A 2V0JA 4ZJLA 2RRBA 1JMTA 3Q24A 1VRUB 2WAQD 4DLEA 4IFYB 1RLDA 2V2ZA 5CD4A 4WE1B 4Q0BA 2HQDA 2YNHB 3TZWA 2GC8A 2FHJD 3VVUA 1XJWB 4ZDNA 4CO0A 1JLAB 4RNOA 4ES3A 4DV2J 4L3KA 3AAWB 3JSRA 3DJ4A 2DHGA 1H74A 3KHHA 1UWBA 3OXFA 3VR1A 4EWTA 3PYGA 1FERA 2BMBA 5B0FA 2IJFA 4N56A 4R36A 4IKAA 4QR0A 1U2RA 3R3TA 3K59A 4OJ1A 2V50A 1H7WA 3DLBA 3M6UA 2Y1IA 3I32A 3FBFA 3H40A 4OZJA 3DCAA 1YJTA 4KH1B 4BC7A 1G95A 1WSRA 2M8HA 3VQTA 4KGKA 3BO2A 3DKDA 5KFYA 3BS9A 2J6TA 1LK7A 5H9EK 1SIZA 1KEKA 4WCEQ 4YR2A 1S48A 1Q82T 4DX6A 3N6NA 4ZPBA 2JH3A 5EHHA 2I6WA 2V0LA 4GRSA 4LF8F 4TY8B 1E6VA 5HQMA 4KKOA 2DT9A 2UVUA 2BANA 2MPUA 3UDLA 1PILA 2F1FA 2FLPA 1X0FA 1KOOA 2DGVA 2OI6A 4DR2F 3GVDA 3KK3A 3G6YA 4M8LA 3ZNUA 1C0UA 2CYYA 2R2UA 3BGUA 1TKTA 4KH0B 2E1AA 1R3NA 4UQTA 3I6PA 3GIKA 1TL7B 1WOOA 3GSDA 1BY9A 3ELHA 4DV2F 1LW0B 1LWCB 2E44A 5L39A 3PHTA 3I5BA 3M8PA 2RE1A 2HWTA 1AW0A 3T1HJ 4PQUB 5HP1A 2FUG9 3MEDA 1SSTA 5A8WA 2P9EA 5F8GA 3MR7A 3H2VE 5HLFB 4IRDA 2FLOA 2JX2A 4DL3A 2DGWA 3CULA 3GIIA 2OPRB 4TY9A 4Y2IA 2HFVA 1S4EA 2V8PA 4C6AA 4W90B 1AB8A 2ZKTA 3P47A 2EFQA 2BA9A 1PJ7A 5HMWA 4OJ3A 2BQ3A 1ZTWA 1N56A 1KR4A 1ELOA 4Q2LA 2V2VA 2D7SA 1M1GA 2XSFA 1N5YA 3MD1A 5DRKA 1VQSA 1FFSB 4RW6A 1HW9A 5D0GA 2ZDOA 3LP1A 2W0VA 4NPOA 2OFHX 3NOCA 1V3RA 3BXYA 3JAMU 2YH0A 2DVIA 2WB4A 3PIOQ 1TMJA 1RE1B 1YJVA 3TJ9A 4HH1A 5ITHA 4JI8F 2N4CA 3W8GA 2UV8A 4OI6A 2CIMA 3GIRA 2AYEA 3R5JB 4EGGA 2OPPB 3GCWP 2HNYA 2A0FB 5EDWA 2RKIA 4E75A 1WEXA 2E29A 2ZOMA 1P8GA 4EZ6A 1VC6A 4AD6A 3US5A 3PW2A 2UVWA 4DN9A 2B9YA 3VAKA 2YXLA 4E79A 5ETRA 2ZH2A 1T9WA 3T1HF 3OTOJ 4ZLNA 1TL1B 4F3OA 3NS7B 1JLFA 4JI5J 3U27A 1NCLA 5ETPA 1RAOA 4ZCLA 4EQYA 2DNMA 1MU2B 4BBYA 2BJ9A 4DSEA 4LSLB 3CIMA 4R5PB 3MM6A 1DTQA 1SKUB 2WVBA 1ZETA 3MCOA 4LF6J 1RBOB 4WK1A 2IM3A 3MM8A 1CQMA 5KFNA 2DR5A 5KFKA 3W8PA 2A1BA 4ZPTR 2F8MA 3W62A 1WEZA 2CRLA 3KUGA 4IO1A 1X7VA 1QM9A 4AAWA 1BQNA 4X4QA 4O4GB 1GTHA 3MOZA 2J8SA 2MKSA 3K7RA 2HVHA 4DWIA 5IWAJ 1DTTA 4NOHA 3R3IA 3TUIC 4OHZA 1FA0A 3FQKA 2QMUB 3CSKA 1LK5A 2GMHA 3N6LA 1IQZA 4DUTA 2QIFA 2EFGA 2LQJA 2RHSB 1ZPVA 1WOSA 2CG4A 4N8OA 2IPOB 3OW5A 1TK8A 1M5SA 4C11A 2LCWA 2P2CB 2RRAA 4AXIA 1R6YA 3GU0A 3GSIA 5K14B 3BQ1A 3MR6A 1FDAA 3NS5A 3Q8YA 2NZ4A 3UD3P 2FYXA 4N41A 3E8OA 1U47A 1VRTB 2MLXA 1HV9A 2LMIA 2J8AA 3M8SA 2B4PA 1UZDA 1SKRA 4LF5J 3OTOF 4D3GA 2HNDB 2ATCB 4OFZA 4M1KA 4NYZA 3GQ9A 1GTEA 3CDAA 5HMZA 2LEBA 5D6GA 2G2OA 2UU9F 4JI5F 1XMOJ 3ICLA 1HNZJ 2GO9A 5KFGA 3UCZP 4MTPA 3TVKA 2XM3A 1FKPA 1U1PA 1Y00A 5F0WA 2DGTA 2ZZNA 3IWXA 2NXNA 5DEMA 3V6DA 4DSIA 3CJ8A 3LGHA 2HHWA 3RBDA 1WC4A 4KGMA 1J5EJ 1LQ9A 3VAGA 1ZBTA 4IDKA 1TP7A 3J81U 4NI2A 4N27A 4I6YA 3W5ZA 3OUPA 1KS2A 5IWAF 5A8RA 2ZBRA 3MMAA 4ID5A 2BBEA 3HSQA 1RBAA 2AGOA 1V5IB 2GCFA 2V68A 3J7A1 3FKBA 4FVCA 4JI1J 1VYAA 4CLLA 4NWBA 6FDRA 3FBEA 2VC0A 1LXAA 4LRFA 4OHVA 2VQEJ 2KFNA 2I0XA 2XMTA 3K2YA 4JUZA 1HNIB 3PX4A 3GJTB 2KU7A 4WFBQ 2P9CA 1LEOA 2ZKUA 2C28A 1SH3A 3NGTA 1VRQC 1NKBA 3GONA 2HFZA 4ED3A 4ZVOB 2J76E 5EN1A 3MFHA 5F8JA 3R2WA 4AUKA 3W64A 3K5NA 1YP2A 3BV8A 3P6YC 4LF5F 2QRRA 3HHLA 3H4BA 2AZ3A 2R2SA 4DR1F 3KKFA 4QIEA 2IYIA 1HNZF 4C8OA 2AYMA 1WTBA 5D78A 3TO8A 3KLVA 3GR1A 2N7CA 2NXEA 2XI3A 1HI8A 2YWKA 4PUOA 4XPCA 2Z4PA 3ITHB 4C0HA 2I5KA 3E51A 4IHFA 5F9LA 3R5CA 2ZJPQ 3QSIA 3E3XA 4ECUA 3PV8A 1AUDA 1NH7A 1B4SA 2R7WA 1EP4A 2VQFJ 2VJVA 1L3KA 4H4OB 4NCGB 2Z30B 5KOXA 2DXFA 3EPGA 1IKYB 3GJSB 5HBMB 1T9YA 2FC8A 4PXDA 1J2ZA 3G2XA 2RUGA 1S49A 3OTEA 2AW0A 3ENVA 3GV7B 3PFEA 3I0RB 1O6XA 4MYTA 3SSRA 2HHQA 5L46A 1SPBP 1IKVB 3KLGB 3BR9A 5A8KA 1RKIA 1YRTA 4NLRA 2RU3A 1KVIA 1HPZB 3MCMA 4ED6A 2MZ1A 3HX9A 1U02A 1N6QB 1QLNA 1Y9OA 2Y3YA 3VBPA 2GMLA 3HHLD 2LU1A 3GQAA 1FKOB 1MWZA 2QSWA 2VG7A 3CUNA 2WVEA 4MZUA 3IR5B 4ZVHA 3MF5A 4IR9A 3PW7A 2UXBJ 3TYTA 2W9AA 5IV3A 2YWEA 5HQ8A 3EH0A 4ANEA 2BZ2A 2FVCA 2AD9A 1TDTA 2QL7B 3GR0A 4MYUA 5BYSA 2VQFF 1M1KT 4WK3A 3BKTA 1N52B 3DLHA 3I4PA 3QRRA 4C97A 3J7Z5 2HQ3A 4UUWA 1VBZA 2F40A 2G0IA 3PIPQ 3FMBA 1AT1B 3FUYA 3MM5B 4IYQA 3T9ZA 1S1UA 2ZVSA 1HQ2A 4OHWA 4TYBA 4P10A 4RBVA 3HJJA 3IGJA 4USJC 4FNHA 3MHYA 1HLWA 1SBRA 2RQMA 2MZTA 5KT3A 1RAEB 4DR6J 1NSQA 2X1GA 2EXUA 3NRBA 3RB3A 4YQWA 2CQBA 3FSYA 4P73A 2ZD1A 3AD9C 2V4JB 2KXHA 2W24A 2JC0A 4G3QA 3HF5A 2NYIA 4YDXA 5C42A 2BW2A 2ZH6A 2GMJA 3K5PA 1WUUA 2XI2A 4TYAA 1RWMB 4IHGA 1WORA 2NZCA 2WSCC 1NAQA 2IJNA 5EWEA 4C4WA 3OR2A 2BXJA 3R2CJ 2AHOB 2UXBF 3I82A 1R8HA 4WJBA 1RT3A 1YBAA 3CCZA 3MEEA 4A4JA 1EX8A
chains in the Genus database with same CATH topology
1KGTA 3MQHA 3TWDA 5DEMA 2QKXA 2OEFA 3KWDA 1V67A 2OI5A 5AFUU 4R36A 1HM0A 1KHRA 4N6AA 3ECTA 5DG3A 3CJ8A 4IHHA 4EABA 3R3IA 4KPZA 1FWYA 1HM9A 2CUYA 2G2YA 2JFDA 4KQLA 2VD4A 2G1HA 4N6BA 2IUAA 4M99A 2WLEA 3PMOA 1QREA 3C8VA 2WLFA 3HJJA 4EGGA 2FKOA 3IGJA 2Q4JA 3I3AA 3IXCA 2JF3A 1SSTA 4ISXA 1MR9A 4N27A 5AFUV 5DEPA 3VBPA 3EZOA 2WLDA 3QATA 2W0WA 4RL1A 3TZXA 3VBKA 4G87A 2XATA 5E3PA 1G95A 1MR7A 4E75A 3D8VA 2G2ZA 3OUPA 3TQEA 3OTMA 2OEGA 2ICXA 2ICYA 2WLGA 1T3DA 3F1XA 3FSXA 4M2BA 3SRTA 3VBLA 3FSCA 4E1KA 1MLAA 3TZYA 2H1YA 3R5DA 3TZZA 2QIAA 1SSMA 2GGQA 2V0KA 2JFKA 1KK6A 1XATA 3R1WA 4E79A 3R97A 2I5KA 3P1BA 4HURA 5ADXU 3FSYA 3OW5A 2GGOA 3P47A 4QBUA 4IHFA 4KNXA 4M28A 3I3XA 3TDTA 3DK5A 3KWCA 5DZ7A 2RIJA 2WLCA 3HSQA 3R5CA 3VBIA 3VNPA 1KK5A 3TIOA 4G3QA 4E6UA 2V0JA 2QJ3A 4M98A 3R0SA 4MFGA 4MZUA 3T57A 3TV0A 1Z90A 4FCEA 1V3WA 4R7PA 3TK8A 3ST8A 1YP3A 2V0LA 3EEVA 4HCQA 5F42A 1OCXA 3R5AA 5ADXV 4KPXA 5L6SA 1YP4A 1QRFA 3FOQA 4R37A 1KRRA 4EQYA 1G97A 1NM2A 3VBMA 3MC4A 3GOSA 1XHDA 2NPOA 1MRLA 2OI7A 4J09A 2C2NA 3MQGA 3V4EA 2IU9A 2V0HA 4N69A 3FS8A 1LXAA 1HV9A 2AQ9A 3EH0A 2QC3A 3Q1XA 4EAAA 4IHGA 1KRUA 1QRGA 2OI6A 2TDTA 3BRKX 3BSYA 4K6RA 2VHEA 5L6VA 4HZCA 3TZWA 3K89A 1S80A 1KK4A 4MYOA 4AA7A 4H7OA 3NZ2A 2IU8A 3R8YA 3DHOA 1TDTA 3SPTA 3GVDA 1J2ZA 5DZ6A 2IC7A 1QQ0A 2W0VA 3OU9A 3VBJA 4AC3A 3IM9A 2P5ZX 1QRMA 1SSQA 4HZDA 3TISA 3BSWA 3BXYA 3JQYA 3VBNA 3GUEA 2G2OA 3PTWA 4EA9A 3OTZA 3EG4A 3DJ4A 4AAWA 3D98A 4E6TA 1FXJA 3G87A 2JF2A 2V0IA 4M2AA 3IM8A 1KGQA 4EA7A 3R3RA 3BSSA 3KWEA 3FTTA 4M9CA 3H0PA 1KRVA 3FSBA 4RR5A 4HUSA 5E3QA 3FWWA 2QIVX 3RGIA 3HJVA 1QRLA 3HHDA 1KQAA 1THJA 5U2KA 5E3RA 2P2OA 3R2WA 4EA8A 4G3SA 3R5BA 4KNRA 4DCLA 4G3PA 3BFPA 3SBMA 1YP2A 3BV8A 1HM8A 4J18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGT A;  3MQH A;  3TWD A;  5DEM A;  2QKX A;  2OEF A;  3KWD A;  1V67 A;  2OI5 A;  5AFU U;  4R36 A;  1HM0 A;  1KHR A;  4N6A A;  3ECT A;  5DG3 A;  3CJ8 A;  4IHH A;  4EAB A;  3R3I A;  4KPZ A;  1FWY A;  1HM9 A;  2CUY A;  2G2Y A;  2JFD A;  4KQL A;  2VD4 A;  2G1H A;  4N6B A;  2IUA A;  4M99 A;  2WLE A;  3PMO A;  1QRE A;  3C8V A;  2WLF A;  3HJJ A;  4EGG A;  2FKO A;  3IGJ A;  2Q4J A;  3I3A A;  3IXC A;  2JF3 A;  1SST A;  4ISX A;  1MR9 A;  4N27 A;  5AFU V;  5DEP A;  3VBP A;  3EZO A;  2WLD A;  3QAT A;  2W0W A;  4RL1 A;  3TZX A;  3VBK A;  4G87 A;  2XAT A;  5E3P A;  1G95 A;  1MR7 A;  4E75 A;  3D8V A;  2G2Z A;  3OUP A;  3TQE A;  3OTM A;  2OEG A;  2ICX A;  2ICY A;  2WLG A;  1T3D A;  3F1X A;  3FSX A;  4M2B A;  3SRT A;  3VBL A;  3FSC A;  4E1K A;  1MLA A;  3TZY A;  2H1Y A;  3R5D A;  3TZZ A;  2QIA A;  1SSM A;  2GGQ A;  2V0K A;  2JFK A;  1KK6 A;  1XAT A;  3R1W A;  4E79 A;  3R97 A;  2I5K A;  3P1B A;  4HUR A;  5ADX U;  3FSY A;  3OW5 A;  2GGO A;  3P47 A;  4QBU A;  4IHF A;  4KNX A;  4M28 A;  3I3X A;  3TDT A;  3DK5 A;  3KWC A;  5DZ7 A;  2RIJ A;  2WLC A;  3HSQ A;  3R5C A;  3VBI A;  3VNP A;  1KK5 A;  3TIO A;  4G3Q A;  4E6U A;  2V0J A;  2QJ3 A;  4M98 A;  3R0S A;  4MFG A;  4MZU A;  3T57 A;  3TV0 A;  1Z90 A;  4FCE A;  1V3W A;  4R7P A;  3TK8 A;  3ST8 A;  1YP3 A;  2V0L A;  3EEV A;  4HCQ A;  5F42 A;  1OCX A;  3R5A A;  5ADX V;  4KPX A;  5L6S A;  1YP4 A;  1QRF A;  3FOQ A;  4R37 A;  1KRR A;  4EQY A;  1G97 A;  1NM2 A;  3VBM A;  3MC4 A;  3GOS A;  1XHD A;  2NPO A;  1MRL A;  2OI7 A;  4J09 A;  2C2N A;  3MQG A;  3V4E A;  2IU9 A;  2V0H A;  4N69 A;  3FS8 A;  1LXA A;  1HV9 A;  2AQ9 A;  3EH0 A;  2QC3 A;  3Q1X A;  4EAA A;  4IHG A;  1KRU A;  1QRG A;  2OI6 A;  2TDT A;  3BRK X;  3BSY A;  4K6R A;  2VHE A;  5L6V A;  4HZC A;  3TZW A;  3K89 A;  1S80 A;  1KK4 A;  4MYO A;  4AA7 A;  4H7O A;  3NZ2 A;  2IU8 A;  3R8Y A;  3DHO A;  1TDT A;  3SPT A;  3GVD A;  1J2Z A;  5DZ6 A;  2IC7 A;  1QQ0 A;  2W0V A;  3OU9 A;  3VBJ A;  4AC3 A;  3IM9 A;  2P5Z X;  1QRM A;  1SSQ A;  4HZD A;  3TIS A;  3BSW A;  3BXY A;  3JQY A;  3VBN A;  3GUE A;  2G2O A;  3PTW A;  4EA9 A;  3OTZ A;  3EG4 A;  3DJ4 A;  4AAW A;  3D98 A;  4E6T A;  1FXJ A;  3G87 A;  2JF2 A;  2V0I A;  4M2A A;  3IM8 A;  1KGQ A;  4EA7 A;  3R3R A;  3BSS A;  3KWE A;  3FTT A;  4M9C A;  3H0P A;  1KRV A;  3FSB A;  4RR5 A;  4HUS A;  5E3Q A;  3FWW A;  2QIV X;  3RGI A;  3HJV A;  1QRL A;  3HHD A;  1KQA A;  1THJ A;  5U2K A;  5E3R A;  2P2O A;  3R2W A;  4EA8 A;  4G3S A;  3R5B A;  4KNR A;  4DCL A;  4G3P A;  3BFP A;  3SBM A;  1YP2 A;  3BV8 A;  1HM8 A;  4J18 A; 
#chains in the Genus database with same CATH topology
 3UI3 A;  1SKW A;  2R2T A;  1G2E A;  1X31 C;  1RTD A;  2IDL A;  4ED2 A;  4I2Q A;  2HHT A;  2IAJ B;  2OTL S;  1D8Y A;  2J9D E;  4Q5V A;  5C25 A;  5HO4 A;  2XNQ A;  4DR5 J;  1KNZ A;  2ZBQ A;  4RW7 A;  1YIT S;  5G0R A;  4CI0 B;  4ECX A;  5GMK a;  3PEJ A;  4BC9 A;  5KFH A;  2MJU A;  3PW5 A;  2BDP A;  2OAU A;  2Q1L A;  2HGM A;  2XY7 A;  2H5I B;  3W2V A;  3GQ7 A;  4N8N A;  2DRD A;  4C8Y A;  1NHK L;  2O01 C;  3C16 A;  3ZZZ A;  2NS1 B;  5JVH Q;  4WZQ A;  3SSQ A;  4C3L A;  2D9O A;  2W9B A;  2CQ2 A;  3NG8 A;  4LF1 A;  4O23 A;  2FQQ B;  3TR5 A;  4LR9 A;  4HAC B;  2RDI A;  2HRY A;  1HMV B;  1U2C A;  1U4B A;  5IM0 B;  1U8S A;  1QSS A;  3TA0 A;  2ZZM A;  3FTT A;  3ZZY A;  4DFP A;  5F8M A;  4HR2 A;  2Y1J A;  1X4A A;  2KZM A;  2AEF A;  4IH5 A;  2DH9 A;  4CH1 A;  3AOA A;  4IRC A;  4ICL A;  2EFO A;  1KON A;  1B3T A;  2H65 B;  4J9O A;  3ILI A;  1PO6 A;  3MEG B;  4L76 A;  3DRP A;  1CBK A;  4RW4 A;  1FKA F;  3WIV A;  1N48 A;  3PX0 A;  3GV5 B;  1MR7 A;  4PKD B;  3PFO A;  2ICX A;  2QA1 A;  4TKT A;  3TZY A;  3MMB A;  4F4Y A;  2MZQ A;  5HI7 A;  3WX8 A;  4OIX A;  4DCJ B;  4RX6 A;  4RZR A;  1VIS A;  2RIL A;  2DRB A;  2KXF A;  3GJR B;  2KRR A;  5D0H A;  4ZVP B;  1Q16 B;  4ZIV A;  1S1X A;  1Y3J A;  1JJ4 A;  2COL A;  2X1A A;  4CIO A;  1NU4 A;  3ILL A;  5JVG Q;  2ZDP A;  3M2V A;  1LXN A;  4ZVT B;  5I4M A;  3BSY A;  2QA4 S;  1IR1 A;  1MMD A;  5D3G B;  2N4D A;  3DRS A;  3M8Y A;  1HWK A;  4Q45 A;  2OLW A;  5DLG A;  3R7B B;  4TQS A;  4ZPV R;  4F4K A;  4HH0 A;  5ETQ A;  1IKX A;  2QIV X;  5L38 A;  5IXU A;  3IGN A;  2QX0 A;  1YJN S;  4CNZ A;  3N9U C;  1TKZ B;  3K5L A;  2I1R A;  4F0M A;  4KSE B;  3EDQ B;  2AGQ A;  2BOA A;  3L9Z A;  5DEP A;  4OYX A;  4JI4 J;  2M7S A;  3OJU A;  5CZX A;  2RF2 A;  2C2K B;  2B0G A;  2ZH3 A;  5F8L A;  2YQ1 A;  2XQC A;  3IR7 B;  3D0H E;  2GGO A;  1FDN A;  4KNX A;  4F0K A;  4JI6 J;  1YWX A;  3VNP A;  2R42 A;  2LFV A;  2KG1 A;  1VDH A;  2HVZ A;  3CJ0 A;  4L3N A;  4M5H A;  2E1C A;  4P7V A;  4EO6 A;  4QOT A;  3OUY A;  1KRR A;  4A8O A;  5LM7 E;  5IZH A;  1IBL J;  1MRL A;  3J81 j;  4FYW B;  3DRR B;  3GIL A;  2Y0B B;  4URS A;  2NLW A;  4MMO A;  2QO3 A;  1NJZ A;  1CC8 A;  4RW9 B;  4C8M A;  2Z56 B;  3C2P A;  4JYA J;  4DL7 A;  4NLO A;  2E1M C;  2OKQ A;  3IXQ A;  4QW8 A;  2V0I A;  4LSN B;  4NLD A;  4I4B A;  4I6W A;  3VF0 B;  3RAM A;  3BFP A;  2ACY A;  1JQG A;  4Q44 A;  3AH6 A;  3NBP B;  1QE1 A;  2J0S D;  2GA7 A;  4MJK A;  1N5Q A;  2IM1 A;  2NXJ A;  2X3D A;  1FRJ A;  2F4V F;  2G0J A;  3E01 B;  5AT1 B;  1NDK A;  2VJU A;  1DFD A;  3J80 Y;  4TXS A;  1GXU A;  5EWG A;  4M5J A;  4W92 B;  4A8X A;  4QYZ J;  4DL4 A;  4LFC J;  5AXN A;  2C2Z B;  4JI4 F;  1ZAW A;  1Y5L B;  2NXU A;  5A76 A;  1S4F A;  4K50 A;  3D0I E;  1REV A;  3UD4 P;  4FF3 A;  1DLO A;  2VDI A;  2Y8Y A;  1LWE A;  2MB0 B;  2HZV A;  2UUB J;  3MMC A;  4JI6 F;  1S80 A;  3OH1 A;  3BH7 B;  4E98 A;  3DGP B;  3OHA A;  2YNG A;  3JTP A;  2WVF A;  2XY6 A;  2M2B A;  4R8U A;  4CT8 A;  4WFY A;  2PT0 A;  3NCR A;  1RHU B;  4GC7 A;  3W61 A;  3D6M B;  4CLS A;  2YPY A;  4OYI A;  3UQS A;  4FN5 A;  2OPQ A;  4CTA B;  2ILZ A;  4JYA F;  4ATN A;  1RAG B;  1JLB B;  3HM9 A;  2XHC A;  2YWW A;  2DBB A;  2BJE A;  3HVW A;  5DET A;  1YZ7 A;  4ENO A;  2VIH A;  4C8Z A;  4PWD B;  3TVZ A;  3TQE A;  2V6A A;  2V0K A;  2K3K A;  4DHV A;  2HWI A;  4FF2 A;  2XSJ B;  1WWH A;  3ZFV A;  2AJ2 A;  2OUG A;  2UUC J;  4R25 A;  3BB5 A;  2I5J B;  3KG4 A;  1Y10 A;  4YME A;  4U8V A;  3G86 A;  3I5C A;  2PDA A;  1DZ5 A;  2AKW B;  4P74 A;  5J2N A;  3P49 B;  4E8U A;  1VBY A;  2IU8 A;  1IR2 A;  4LFC F;  4G1Q B;  1FVS A;  1RWW B;  3EG4 A;  5HAO A;  2P9G A;  2RD5 C;  4OV6 A;  1S6Q B;  2VU5 A;  2ZHO A;  1S77 D;  4F04 B;  2PE8 A;  5D77 A;  3G82 B;  3SBM A;  5F8N A;  3I0S A;  5KG2 A;  2LEA A;  4L75 A;  1TUG B;  4QIG A;  1M5O C;  4RW8 B;  1UWA A;  5CAB A;  4IFV A;  2B7B B;  5HL7 Q;  4M2B A;  1ZA2 B;  3ZZO A;  4CWB A;  1FE4 A;  2LU2 A;  4HUR A;  1RT4 B;  2RHQ B;  4K4V A;  4QIF A;  3MPW A;  5MLC V;  4HT5 A;  1M90 T;  1TMM A;  3VGU A;  4ZP7 A;  4ECY A;  5F41 A;  1TUV A;  4QW9 A;  2NPI A;  4ZLL A;  2R8J A;  3UE2 A;  2POK A;  2AZ1 A;  5CCM A;  2E9Z A;  1UFW A;  3BGR B;  5CYM A;  2PD1 A;  2VOP A;  2DY9 A;  2XLJ A;  3V6H A;  4ZP8 A;  3RRG A;  2DXE A;  2FHM A;  4NA2 A;  3CCE S;  3SEO A;  2UUC F;  1NME B;  4N47 A;  1WTF A;  2PA3 A;  3H0P A;  3KWE A;  3FSB A;  1WD6 A;  3CDB A;  5ETS A;  1HBN B;  4A8W A;  4Z2X A;  3D3B J;  2V63 A;  1TV6 A;  3ETM A;  2NSB A;  3RZA A;  1S10 A;  4URG A;  2YNI B;  5DQH A;  1S9F A;  5B0G A;  4U9R A;  4GVB A;  1CS4 B;  3S1T A;  1WC5 A;  1NBE B;  4DR4 J;  4RL1 A;  3K0J A;  3ULH A;  2BEF A;  3HT0 A;  5AE3 A;  2FY1 A;  1U6F A;  2WBM A;  3DGP A;  4UF4 A;  3K8V A;  1S7H A;  2C3O A;  1AFJ A;  4XO0 A;  2OD6 A;  1PAU B;  3MD3 A;  3GB0 A;  3PJ9 A;  3OTB A;  3C3L A;  2DR9 A;  4K4Y A;  2UV8 G;  2XO7 A;  2HFN A;  3VBJ A;  1WHX A;  3CCV S;  1ZZF A;  2P8I A;  2E7W A;  3GG1 A;  4A8M P;  1UFL A;  3TUP A;  4RR5 A;  2HMI B;  1HNV A;  2Q79 A;  1P1T A;  2LVW A;  5U2K A;  6AT1 B;  2WSE C;  1JLQ A;  3D54 A;  2FZG B;  1D1U A;  3GPA A;  4ELU A;  3BR8 A;  1YJ9 S;  1VQN S;  7FDR A;  3V5R A;  3CME S;  2QEX S;  2D9P A;  4TU7 A;  2CQC A;  3KWD A;  3LO3 A;  2ZH5 A;  5KFV A;  1BQM B;  3LTO A;  2Z0G A;  2V69 A;  1HR0 J;  1U0H B;  3SSS A;  3RAQ A;  2HG4 A;  3VGV A;  2XAT A;  4KGX B;  1RAI B;  1S72 S;  1LWF A;  5L1L A;  2A3J A;  2IMO A;  1SJ3 P;  4ZIW A;  3T5J A;  2KL8 A;  4AQY J;  1XNQ J;  2RVJ A;  4LUB A;  3VZH A;  5CA5 A;  2EWH A;  2DNO A;  3KJQ B;  3RB0 A;  4DR4 F;  5C7P A;  1S97 A;  3GV8 B;  5GVQ A;  3BYR A;  4Z37 A;  3BO3 A;  1B0T A;  1BD6 A;  5D4L A;  1O0P A;  4OYZ A;  3FS8 A;  5L9N A;  1L5U A;  3AOC A;  1T05 A;  3HFV A;  1U1L A;  4RKU C;  4DPW A;  4X84 A;  3FDS A;  1VMB A;  3SV4 A;  2VFR A;  3LWL A;  5B0E A;  4WBF A;  4DI6 A;  1RT6 B;  3MM7 A;  5J2Q A;  1JLG A;  2OTJ S;  4RUC A;  4USW A;  4ZIT A;  2KVI A;  1UJ5 A;  2BVZ A;  2FGO A;  4LQ3 A;  3M9N B;  2C42 A;  5KG0 A;  3KG1 A;  4B08 A;  2DJW A;  2R2R A;  3KHL A;  2DGS A;  2PSZ A;  3D1O A;  1NXI A;  1UEV A;  4LRD A;  1W25 A;  2BKN A;  1VCT A;  4M5D A;  1S0O A;  2V8H A;  1NK8 A;  4ID8 A;  3QT6 A;  3OQ2 A;  3TW0 A;  2OMO A;  2HSE B;  4DS4 A;  1GMW A;  1XAT A;  1NK6 A;  4NZ7 A;  4DBQ A;  1CJT B;  1BGX T;  3HSG A;  2DIT A;  4FF1 A;  5C24 A;  3N4W A;  1HQE A;  1YRU A;  4U95 A;  3BDE A;  3ZNJ 1;  1UVI A;  3J80 U;  5HVG A;  1S0N A;  1PC4 A;  5A0Y B;  3PYD A;  4I64 A;  1YJ7 A;  4X62 J;  3D28 A;  2YNF A;  3FVY A;  1Q95 G;  1VHI A;  2LP4 A;  4K0K J;  2B7C B;  4B3S J;  2WVC A;  4C7Q A;  1Q86 T;  1G7C B;  2KXN B;  2M3D A;  4JI2 J;  3AOB A;  3QYY A;  4KBI A;  3LF0 A;  2WOM B;  4GKJ J;  2QA2 A;  3M6W A;  1YG0 A;  3RB6 A;  1IBM J;  5F9N A;  1RB0 A;  1QSL A;  1OSD A;  1WI6 A;  1V3S A;  3QID A;  4JB8 B;  2HS3 A;  5J2P B;  4OI4 A;  1XC9 A;  5LJ3 Y;  2YKP A;  3UO0 A;  3Q8P B;  1TL4 A;  3M2U B;  3MUT P;  3GYG A;  5GAH I;  3W9I A;  2HW3 A;  4PG8 A;  3QNW B;  2XO6 A;  3Q23 A;  2V2K A;  4EUV A;  3VTI A;  3L95 X;  2C3Y A;  4URQ U;  1S1W A;  4KR0 B;  4KT0 C;  1IKW A;  2HKE A;  3T5L A;  4DU8 A;  1GMW D;  4YHH J;  5M2P A;  1M0S A;  4DV7 J;  4DQI A;  4I0W A;  1WHW A;  4MYO A;  2PMZ D;  2V9W A;  3ZTP A;  4A46 A;  2PI4 A;  2AYG A;  3D7S B;  4DQP A;  4AL5 A;  2XG8 A;  1QRL A;  1WI8 A;  1MMN A;  2E1R A;  3LP0 A;  1DJ0 A;  3HVT A;  2UVR A;  3O5T B;  5KG1 A;  2B5J B;  2YPZ A;  2HLT A;  2HAI A;  4X62 F;  2W9C A;  2CVE A;  2QZ8 A;  3OH0 A;  4K0K F;  3WQP A;  1JLE A;  1T9V A;  3DLG A;  4B3S F;  4FXV A;  3TAM B;  4QIV A;  3A3P B;  4JI2 F;  1GNK A;  3HMJ G;  4GKJ F;  3PJX A;  2MHN A;  4MFB A;  1J2V A;  4ZK7 M;  1IBM F;  3MI7 X;  3MAA A;  5T41 A;  1RLC L;  1S6P B;  5JJB A;  2D3O R;  3MUM P;  3EUN A;  1Y0H A;  3G6E S;  5F0U A;  3IMQ J;  5DJB A;  1RWN B;  3LOU A;  3M9O B;  2H4Y B;  3D9B A;  3OLB A;  3SQG B;  4GKK J;  4KRW A;  3LPY A;  3I31 A;  4RPF A;  2B43 A;  5HSP A;  4ZA1 A;  1SC6 A;  3FNN A;  3VAL A;  4MAK A;  2CQ3 A;  4YHH F;  4DV7 F;  4H4M A;  1T03 B;  3BPS P;  4KO0 B;  4OZ0 A;  1V67 A;  2XZW A;  4IRK A;  3RR7 A;  1IM6 A;  2FVP A;  3M8W A;  3EX7 B;  4PZV A;  2HHS A;  4DUZ F;  2W0W A;  3ET6 B;  4O4R A;  2AU0 A;  1RCO B;  2B4V A;  4J37 A;  5CQG A;  1RT5 B;  4I7F B;  2HHU A;  3HSJ A;  4DV6 F;  2RJZ A;  3TDT A;  3KWC A;  3PCO B;  3GCX P;  2KB2 A;  9ATC B;  3KG0 A;  4USU A;  1NK7 A;  2BV3 A;  4K2J A;  2O1P A;  1RK8 A;  4F67 A;  2AYB A;  3IWL A;  1F9H A;  4EZ9 A;  3BSA A;  1KC8 T;  1K9M T;  2M88 A;  3OXL A;  5E5N A;  4O3R A;  3LH2 S;  2GQQ A;  3K58 A;  4ZVQ B;  5AXM A;  2BKP A;  1XMQ F;  3HK2 A;  3DOK A;  1HNW J;  3A8E A;  4FPI A;  4DPO A;  2NSC A;  1C0T B;  1N32 J;  1WF2 A;  4J91 A;  2VBX A;  2IVF B;  1RWK B;  1H72 C;  4B3M J;  3TVY A;  2YKM A;  4GKK F;  5B0B A;  3M32 B;  4G3P A;  3DHX A;  1RTI A;  4EU0 A;  1HM0 A;  3BEG B;  1ZYQ A;  1FES A;  2VA2 A;  4F0H A;  5D4O A;  4FYD A;  3BGL A;  2XS5 A;  2GNK A;  2VKR A;  5B09 A;  2ZC3 A;  1F3F A;  1TKD A;  2QLW A;  1RT2 A;  3QO9 A;  2HNZ A;  2M9K A;  5J2M B;  3OHB A;  2VIC A;  1TFW A;  4B3R J;  3DOM B;  1TTH B;  3BBF A;  3K8W A;  1UEU A;  1AZS A;  4YDD B;  2XC9 A;  4B9N A;  1KTQ A;  4LRB A;  1NKE A;  3ILJ A;  5DG9 A;  3THP A;  1S1T B;  2HZA A;  3Q8S B;  2H5E A;  1QTM A;  4LT6 A;  1N5T A;  1ULR A;  4A8K A;  1FX4 A;  1W2B R;  1NM2 A;  3RYL A;  2DGX A;  5IS2 A;  3BQ0 A;  1MWQ A;  1EIY B;  5J1P A;  4NCA A;  4DV3 J;  3W2W B;  3WC2 A;  1QQ0 A;  4NA3 A;  4LF2 A;  3RU0 A;  4DX7 A;  4B3T J;  5D8H B;  3KLE A;  1DAR A;  4DPU A;  4DV1 J;  4XTT A;  3NWR A;  1KQK A;  3ZZU A;  3MAH A;  3RRH A;  1MRO A;  1MG7 A;  3PW4 A;  3GG0 A;  2J6U A;  3A4T A;  1SC1 B;  1CEZ A;  3U1N A;  3A8K A;  3OPK A;  4R0E A;  1PJ5 A;  1HNW F;  1N32 F;  1RWU A;  1VI7 A;  1B7F A;  4U96 A;  1X4B A;  4IH7 A;  2Z58 B;  1I3O B;  3Q0A A;  5HQL A;  3QRP A;  4TNO A;  2OEK A;  3KMQ A;  1I5O B;  2P6T A;  3V81 B;  2ZZT A;  3NKY A;  2HK3 A;  4A47 A;  2U1A A;  4Y2A A;  3CXC R;  2ABY A;  2DHA A;  2LDI A;  2KZZ A;  1FVQ A;  3D68 A;  1TVR A;  3KMS A;  1WHY A;  1YDL A;  3BO4 A;  4B3R F;  1S76 D;  2EG2 A;  2A18 A;  4NLQ A;  5IT9 Y;  1IBK J;  1XQI A;  1X5S A;  2R7O A;  1QRG A;  3KLF A;  4P2X A;  2FJV A;  1C1B B;  1N33 J;  3KHG A;  1XR7 A;  4NLS A;  5AXL A;  1CQN A;  1Q7L B;  3FMW A;  2W7P A;  2CPX A;  3MEC B;  7AT1 B;  1NZA A;  2H3E B;  1U0S A;  4LSZ B;  1HBM B;  2IFX A;  4CRJ A;  3MM9 B;  1S0V A;  3EIC A;  3JXO A;  3KLH B;  4DL2 A;  4LFA J;  4IG3 A;  3HVR A;  4DV3 F;  2HGN A;  5KOW A;  4RUH A;  3HD1 A;  3NEK A;  3NMR A;  1HYS B;  1SB6 A;  3BKU A;  4B3T F;  2GGP B;  2RML A;  5EWF A;  2JLF A;  3CD0 A;  1NSP A;  5I3U A;  3EGV A;  2KKH A;  4DEZ A;  3ADA C;  2L9D A;  1VGY A;  1HD0 A;  2GIR A;  3RW6 A;  3G6V A;  1T02 A;  1ZM2 A;  1KK6 A;  5KFF A;  4ZP9 A;  4DU7 A;  3X3U A;  3M9M B;  4NLG A;  4NCB A;  2CQ0 A;  1RYR A;  1KK5 A;  4Q8F A;  5K20 B;  3CC2 S;  8ATC B;  4I56 A;  3RTV A;  2DH8 A;  2EEY A;  5A2Q Y;  4HCQ A;  2DO0 A;  4I69 A;  3MC4 A;  2XMM A;  1NJW A;  5HRO A;  3MUV P;  5KFM A;  4P6Q A;  1KQF B;  3CCU S;  4B9T A;  4AA7 A;  3GFY A;  4X66 J;  1SUQ B;  3OR1 B;  2IC7 A;  2X51 A;  3BF4 A;  1S6U A;  4EO8 A;  4I1T A;  4RUB A;  3BPD A;  1LNQ A;  1XEZ A;  3NNH A;  1WEY A;  3UN2 A;  2R8K A;  4UUX A;  1PBA A;  1HBO A;  2AX0 A;  1FDB A;  3NMA A;  4KNR A;  1S79 A;  3IG1 B;  1N33 F;  1BXN A;  1F9F A;  4B3O B;  3ENQ A;  2Z2Z A;  1N5V A;  2GFF A;  2ADB A;  2GVD A;  2KHC A;  3I3A A;  1KRP A;  1TL3 A;  5ETT A;  4PG6 A;  1DBD A;  2G2Z A;  1H2T Z;  1WNE A;  4LFA F;  1RAB B;  3FSC A;  5F8I A;  3ZTR A;  3MTK A;  1S1V A;  4EK2 A;  2W2N P;  2CQG A;  5KFC A;  1VIX A;  3CCJ S;  1AYE A;  3UDC A;  1VK3 A;  2DR7 A;  1FX2 A;  5KFJ A;  3SV3 A;  3M8Q B;  3FC9 A;  2ZH1 A;  1F5B A;  4DV5 J;  1QVF R;  2ZC4 A;  2CPY A;  1X4D A;  1FRM A;  3AXM A;  2CQI A;  4ED7 A;  3QZ7 A;  3DGV A;  1JWW A;  3R8Y A;  2APO A;  4P52 A;  2UXC J;  4ECZ A;  4M63 A;  5LSL A;  2W1B A;  4BCA A;  1EB0 A;  4Q0B B;  3OTZ A;  3OVS A;  3ILO A;  3PM9 A;  5KFI A;  1J27 A;  3MPU B;  2CQP A;  3D67 A;  3LQV A;  2ATL A;  3FQL A;  3O6Q A;  3H5S A;  2JVO A;  3W9J A;  4ALZ A;  5BR8 J;  3MQH A;  4QWE A;  1UWB B;  4KFB A;  4X66 F;  2OD4 A;  1CPZ A;  2QYG A;  1NB2 A;  5T14 A;  1X4E A;  2CUY A;  4C0O C;  2VOO A;  3EYZ A;  4EYI B;  1RU2 A;  4F4W A;  2WRM A;  3FEX B;  4HYK A;  1TKX A;  2DY1 A;  3J7Z T;  2ICY A;  3V4I A;  4WFA Q;  3C15 A;  3QJJ A;  2F9J A;  2HIQ A;  3R97 A;  3DLK A;  4KYZ A;  3OTD A;  4YB5 A;  3HXM A;  3TIO A;  4Y28 C;  2Z8Q A;  1SXL A;  2BKO A;  2OH2 A;  3PZP A;  4N77 A;  1H0H B;  2CPF A;  1B0P A;  2HHX A;  3C6U A;  4BS2 A;  1R8B A;  5ETV A;  1E6V B;  4KKO B;  1PC5 A;  5M2U A;  3CCW A;  2BAN B;  1RT1 A;  4CYU A;  2Q6C A;  3IA0 A;  4ELV A;  1OY9 A;  1S9G A;  3VVT A;  4DV5 F;  1NLK L;  3AQP A;  2HBY B;  3KK3 B;  4X4V A;  1C0U B;  2BJ8 A;  4JBC A;  3TWD A;  1R8C A;  3RR8 A;  2QKX A;  2UXC F;  1TKT B;  1K44 A;  3GTY X;  3OVB A;  1RHR B;  2ZUG A;  2KYZ A;  3Q2S C;  3J7Y U;  1DQ9 A;  2RUS A;  2JF3 A;  2FJB B;  3PYE A;  2WLD A;  2IIH A;  2JLE A;  3M8P B;  2ZE2 A;  5BR8 F;  3VBL A;  4J7C A;  4O44 A;  1RAA B;  5HP1 B;  1SSM A;  2OSR A;  3AT1 B;  2DNH A;  2MQN A;  3MED B;  4JP8 A;  5A8W B;  2JZ5 A;  4J5O A;  1PG5 B;  2ZNY A;  1S59 A;  4A8S A;  1C1C A;  4M5N A;  1K0V A;  1JXL A;  3JTO A;  4NX9 A;  4O3O A;  4R7P A;  1QD1 A;  1TU0 B;  1OQ3 A;  4I2P A;  4XDD A;  1FFW B;  3MMJ A;  1BQX A;  2N7Y A;  3HFZ B;  3NZ2 A;  3DHO A;  4AXJ A;  1U1M A;  2FIU A;  1N5Y B;  4LF4 J;  1Q5Y A;  3RB4 A;  2RU9 A;  1FI4 A;  1ROF A;  4EBC A;  3EGZ A;  4RW6 B;  1S57 A;  2RS2 A;  1TR0 A;  1M5P C;  3LP1 B;  3HHD A;  4GMK A;  4Y0F A;  5KFL A;  5F3T A;  3QRQ A;  3AHP A;  2LEC A;  2WON A;  3QWP A;  3VQS A;  2PC6 A;  3VHQ A;  2MJN A;  5MAO A;  5FD1 A;  1H2U X;  2VD4 A;  2WLE A;  4DR2 J;  3I56 S;  4Z7Y A;  3H98 A;  3VBK A;  1KDN A;  4WKY A;  2DYA A;  3DRY A;  3PRD A;  2VDH A;  4CP5 A;  2HNY B;  3GZ7 A;  3GP9 A;  2CJ9 A;  4H4K C;  2RKI B;  3DXB A;  5EX0 A;  2CWX A;  2NXC A;  2IBO A;  4OYP A;  2UUT A;  4E6U A;  2LKZ A;  2E5H A;  5CD4 H;  1HFE L;  3TX8 A;  3JYT A;  2NPO A;  4HLB A;  3CDE A;  1JLF B;  3TNV A;  3TAN A;  1RTJ B;  4USK A;  1HQU A;  2V2Q A;  4ZP6 A;  2FHK A;  1Q1K A;  3PO5 A;  3MM6 B;  1DTQ B;  2KJW A;  3M2R A;  3MM8 B;  3HJF A;  4FS2 A;  1DAX A;  1EQ0 A;  3BBB A;  3FEY B;  3DN9 A;  5IT9 U;  3RGI A;  2DPJ A;  4WFN Q;  4ZPC A;  1BQN B;  2NUH A;  4PAA A;  4Q43 A;  2YX7 A;  3S01 A;  3MPD A;  1KQS R;  1YLX A;  1NDL A;  4LF4 F;  5HVH A;  2LXU A;  5DQG A;  2DNL A;  1DTT B;  4PQA A;  3UDE A;  3GFX A;  2WHO A;  2K8G A;  4F2R A;  4BWM A;  4U67 Q;  3TZZ A;  1AFI A;  2MY8 A;  1NO8 A;  1GK8 A;  1E6Y A;  2D74 B;  2BX6 A;  3AFG A;  1UEK A;  2ALZ A;  2VFS A;  3VGT A;  4JI8 J;  3FBB A;  3B54 A;  4XAK A;  3E2E A;  3UVJ A;  2HRT A;  3R6G B;  4C11 B;  2H48 B;  1S0M A;  2NQP A;  2PII A;  2A6M A;  3NWG A;  2GHV C;  2GW8 A;  1URN A;  1KWM A;  3D1H A;  3PRV A;  4E2F B;  2F4F A;  1KLM A;  5KFD A;  1K47 A;  1UPM B;  1PYS B;  4DL0 C;  3G4S S;  5DZ6 A;  4ZVU B;  4LVN P;  5A2Q U;  5K9F A;  3NGD A;  3NY0 A;  1U8W A;  3LPE A;  1RUS A;  4ZJO A;  4RBT A;  2GQ2 A;  2IJR A;  3GMG A;  1Q0N A;  3O44 A;  3JS9 A;  3R9L A;  2JEF A;  2AJQ A;  2CWK A;  5IT0 A;  3DYA A;  1FKP B;  4NLU A;  4YOE A;  3DOL A;  3V6D B;  4UZB A;  2IY5 B;  4JI7 F;  5HAT A;  3DLL Q;  4IDK B;  4KAI A;  1JB0 C;  3QIP A;  4NI2 B;  4NLP A;  3UCG A;  2JL9 A;  3PKM A;  1GX6 A;  1FT8 A;  3MTJ A;  1X5P A;  4OYW A;  3LP2 A;  1OY6 A;  1CJU A;  1RTH A;  3M1V A;  4B02 A;  3R0S A;  5A8R B;  5KG6 A;  1SV5 A;  4ETZ A;  3MMA B;  1FJC A;  4ID5 B;  1G3O A;  1KVK A;  4ZVR B;  3CJT A;  2VZ9 A;  3KYL A;  2W7O A;  3CJ2 A;  5LT5 A;  1TFY A;  2XZD B;  1YKW A;  3HSZ A;  5KFP A;  2EBG A;  5AXK A;  3IRX A;  5B7W A;  1JNR B;  1LWX A;  1FJE B;  1M5V C;  3R1H A;  5E7O B;  2ZBP A;  4OV1 A;  4ECQ A;  2HK2 A;  4CLT A;  2MGZ A;  2XMJ A;  2WCX A;  5HVF A;  2A6O A;  4X4O A;  3NOG A;  1FRX A;  4QQB A;  3MAQ A;  4DX5 A;  3PX6 A;  4MK9 A;  1HM9 A;  1RHM B;  2E9T A;  1N5S A;  2K3I A;  4OHY A;  3HHL B;  1U26 A;  4FZV A;  4OZ1 A;  1SJF A;  2J9E A;  2W8L A;  3JSM A;  1UCN A;  3EM1 A;  3QAT A;  2CPI A;  1QAJ A;  5I42 A;  2JC1 A;  3CCR S;  3OTM A;  2UU9 J;  1ZA1 B;  3BKF A;  1RTJ A;  2AQ4 A;  3LAK A;  3WDO A;  1TAU A;  4NLX A;  2FB0 A;  2AP6 A;  4A8F A;  1X5O A;  3HSD A;  1UW4 A;  4PUO B;  1FEE A;  3B4D A;  4F26 A;  3K57 A;  2IVY A;  2ZJR Q;  2VH7 A;  5KT6 A;  2LYV A;  3O3L A;  1L3U A;  1EP4 B;  1UVK A;  4K6R A;  3KHR A;  3ETO A;  1C4A A;  2OPS A;  3DLJ A;  2P5Z X;  3OFF A;  2X3G A;  3GQC A;  1N54 B;  2VF3 A;  3IBW A;  3CCL S;  4IQX A;  2QLX A;  1KQA A;  3LAN A;  2PO4 A;  4OZL A;  2BOP A;  2KH9 A;  2IU9 A;  1FXR A;  3VV2 B;  4EAA A;  1YJW S;  3RBE A;  3TP2 A;  5ETO A;  5GAD I;  1HWJ A;  3CB4 A;  1RT7 A;  3QFH A;  4Q8E A;  3PO4 A;  5EUH A;  4CM0 A;  5A8K B;  2FJE B;  5H9F K;  1GX5 A;  2GX8 A;  3FCW A;  1W7W A;  2W8K A;  5GAG I;  2KYX A;  4AL6 A;  1HBU A;  2RB7 A;  2Y9H A;  2MLY A;  1JNZ B;  4K4U A;  1NHU A;  1VQL S;  1UW9 A;  1VQ5 S;  2ZHB A;  1H6K X;  2IDE A;  3CMQ A;  1UMJ A;  2F7V A;  3V6J A;  1M5H A;  2VKZ G;  4DV0 F;  3CGI A;  4GO7 X;  2F63 A;  4WU3 A;  5KT5 A;  1R31 A;  3P96 A;  1D9D A;  2B9W A;  4A8Y A;  2ZFH A;  1BWE A;  4DR1 J;  3MR5 A;  4YB6 A;  1VS3 A;  1FE0 A;  3IAS 9;  2VG7 B;  1D09 B;  2R4F A;  1RA6 A;  4MK7 A;  3MCN A;  1UP1 A;  1FCA A;  3SPT A;  1HL6 A;  1QJH A;  1DQA A;  2QMW A;  2XWY A;  2V8D A;  2DNP A;  3IM8 A;  4M9C A;  4W98 A;  4YR0 A;  4USI A;  1Y7P A;  3M8Z A;  3QBC A;  3DLE A;  2DNN A;  3SYZ A;  3D0G E;  2EKN A;  5CYQ A;  4QWD A;  5D0R A;  5ETM A;  1F5C A;  2FY8 A;  4K5R A;  1OY8 A;  2KVQ E;  3J7Y I;  2YKQ A;  3NCP A;  1S1U B;  5KFU A;  2DGQ A;  3BYP A;  2MQ8 A;  4MIA A;  2BQR A;  5DLF A;  5I3P A;  3C6T A;  3DM2 A;  1UA1 A;  2E5G A;  3TA1 A;  1GH8 A;  2WK4 A;  3PKY A;  2FZC B;  1PIE A;  2A10 A;  5BYR A;  4TQR A;  2QJ3 A;  4ZCI A;  1WSV A;  4X65 J;  3G96 A;  2MDA A;  1R7I A;  3R5A A;  2ZD1 B;  1YX2 A;  3QAU A;  1B0V A;  3AA9 A;  1U1N A;  3IS9 A;  2V0H A;  2NR0 A;  3CCS S;  1K1S A;  3QLH A;  5C42 B;  1N0V C;  2FD2 A;  1NJY A;  1JJ2 R;  1XER A;  1U1Q A;  3IO1 A;  2UUW A;  3TWZ A;  4ES2 A;  2LXF A;  3EGN A;  2F9D A;  3CJK A;  4CO3 A;  1WG5 A;  4WZM A;  2G0C A;  2X1F A;  1NDP A;  1QUV A;  3LW5 C;  4O3Q A;  1THJ A;  3OR2 B;  4OYB A;  3DC2 A;  4OX7 A;  4RJV A;  2VV5 A;  2DEJ A;  1NSK L;  1L3T A;  1RT3 B;  4IHH A;  3MEE B;  4KPZ A;  3B4M A;  4OI0 A;  1CJV A;  2QSF A;  1M5K C;  2GAH C;  3OFH A;  4J9M A;  2OP5 A;  1FK9 A;  1RTD B;  4LMZ A;  1UZH A;  4M5L A;  4I2Q B;  2EFN A;  2ZH8 A;  2KHD A;  4L74 A;  2H1Y A;  2E7X A;  1GQE A;  2ALY B;  4I67 A;  5C25 B;  2BJ3 A;  4K59 A;  2K2P A;  4DFK A;  4RW7 B;  2RIJ A;  5G0R B;  3OV7 A;  5FDL A;  2WVD A;  3K5O A;  2KM8 C;  2HWH A;  4G3I A;  1XK8 A;  2JVR A;  1KHW A;  3T41 A;  3QJP A;  3W2V B;  3HD2 A;  3HHE A;  3FFI A;  2VON A;  3T5H A;  3OJS A;  4OHX A;  1BHN A;  3C16 B;  1NK5 A;  5DQI A;  4X65 F;  3DMJ A;  4NAS A;  4LIW A;  2W9B B;  4EA7 A;  1RU1 A;  1CJK A;  4X4T A;  3TAR A;  1F9E B;  5E3Q A;  2OGU A;  3L4B C;  4M5I A;  2HHH J;  3QZ8 A;  3IBC B;  2J6S A;  3D6T B;  3EXC X;  1UL3 A;  4DUY J;  3AB4 B;  4DF8 A;  2CJK A;  4N6B A;  1TL5 A;  3I55 S;  3ZXW A;  1J5O A;  4ICL B;  3SI8 A;  2BE7 D;  1I1G A;  3D8V A;  3CC4 S;  4DLG A;  4BDP A;  3DRP B;  4KY3 A;  4RW4 B;  4KPY A;  3KJF B;  4IG0 A;  1VJQ A;  3UW1 A;  4WYW A;  5DG8 A;  3MMB B;  2IYG A;  3KXD A;  3JSB A;  2YH1 A;  4KC5 A;  4DZ6 A;  4O3S A;  3CT9 A;  1S1X B;  1EJ7 L;  4HTJ A;  2Z2M A;  4WWS A;  4WP9 A;  4QR2 A;  2XWX A;  4MT1 A;  4F25 A;  1SSQ A;  3B78 A;  3M2V B;  4DQR A;  2R9L A;  4CQ1 A;  1F0X A;  1OPZ A;  2Q66 A;  3DRS B;  2CPJ A;  3O2I A;  1EAY C;  5BYQ A;  2ZHA A;  4LF9 J;  1HM8 A;  5E3A A;  1KN6 A;  1R0A A;  1IKX B;  5K8N A;  3AA8 A;  3T6J A;  4OX9 J;  2R7Q A;  5T7L A;  1FJG F;  1F2G A;  1TZ0 A;  4ZPW R;  4LRC A;  2VD3 A;  5DM6 Q;  4C8N A;  5HJY A;  1CUL A;  1U48 A;  1QRE A;  2CQ4 A;  2V8G A;  3ZZ0 A;  3KJV A;  2BW7 A;  2OHD A;  1H73 A;  2XYP B;  2HHH F;  2MKH A;  4FNI A;  2FTR A;  1FRK A;  1VBX A;  4DUY F;  4PYD A;  3G9C A;  3F0N A;  2GO8 A;  2RF2 B;  2HHV A;  4U8Y A;  7FD1 A;  2MMY A;  2BE2 A;  2IM0 A;  4OI1 A;  4J9R A;  1A6L A;  2J0Q D;  3D5M A;  2C3P A;  1YJU A;  4JV0 A;  3Q8V A;  4DSJ A;  2LA4 A;  3OUY B;  2VG6 A;  4H54 A;  2DIU A;  3AY0 A;  1UVN A;  5D4P A;  3JQY A;  1X0P A;  1S9E A;  5LMN J;  2HLU A;  3AQO A;  1TK0 A;  3KK1 A;  1ZM4 A;  3DI6 A;  2LQB A;  2MKK A;  4NYO A;  2FVQ A;  1A9N B;  3EGW B;  4KV8 A;  3SDE A;  2XMK A;  3CO0 P;  3C8V A;  3JTN A;  3V4M A;  2LEP A;  1QE1 B;  1Q4R A;  2VFU A;  4DN0 A;  2L48 A;  3MXH P;  1IUJ A;  1CVJ A;  4LF9 F;  4J9U E;  3OL7 A;  3VAH A;  2CNN B;  2D1C A;  3HKW A;  4OX9 F;  1T95 A;  4ZOS A;  1LW2 A;  3T1A A;  4F7V A;  2YKN A;  5DO2 A;  1R43 A;  1S5Z A;  2D3Z A;  3T5K A;  1OCX A;  3GOS A;  4NLW A;  3U1L A;  4LF7 J;  1NPR A;  1WC6 A;  2NPF A;  2YBV A;  2K1R A;  2IM2 A;  8RUC A;  2XTJ P;  4F4Z A;  1REV B;  2VHG A;  1DLO B;  2IA6 A;  4DJB A;  1BUX A;  4X4R A;  4AT1 B;  5A6P A;  2XYG B;  1LWE B;  5DGA A;  3MMC B;  3D98 A;  2DKO B;  2ROG A;  2EI5 A;  2JEJ A;  2J0W A;  2R8H A;  2YNG B;  3G8S A;  1T8E A;  1Q79 A;  2J0X A;  4ECV A;  2JDJ A;  4R8U B;  1FRI A;  2U2F A;  1YK9 A;  1NJI T;  1JLC A;  2GHP A;  1JX4 A;  1LKZ A;  2UVV A;  2X1B A;  2OPQ B;  1Y3K A;  3DRX A;  5LMN F;  3HKZ D;  5I3Q A;  1IXK A;  4NRU A;  1BMQ B;  3M30 A;  4YY3 J;  5E3P A;  4LR8 A;  4OZ2 A;  2OEG A;  2GIQ A;  1FD8 A;  3T9N A;  3R5D A;  3CIZ A;  3TEG A;  1AA1 B;  3X1L B;  4L73 A;  5KFW A;  3KLI A;  4DX8 H;  3R1L A;  2R7U A;  1Q78 A;  3C14 A;  2CPH A;  2V0N A;  1EKR A;  2DNK A;  1N34 J;  3FSI A;  1DHM A;  2A2C A;  5HN0 A;  1EET A;  2G13 A;  3CJ4 A;  2EW9 A;  4NE9 C;  3VAF A;  2F4V J;  2RNE A;  3VZI A;  3H59 A;  3OU9 A;  2K7J A;  4ZN3 A;  2K06 A;  1D0E A;  5J2N B;  3NP5 A;  1TK5 A;  3BSS A;  4LF7 F;  3TOQ A;  2UP1 A;  5GAE I;  3POT A;  2QGF B;  4DR3 J;  5L8R C;  3K5M A;  2IC3 A;  2NUU G;  1RKJ A;  1VLY A;  1JKH A;  2YY3 A;  4EFA C;  1PYO B;  3TI0 A;  5KG5 A;  4LR7 A;  2MKC A;  3QGH A;  1PBU A;  3I0S B;  2DO4 A;  5L9X A;  1SVD A;  2HFO A;  2HVD A;  2CPD A;  3D2W A;  4C9D A;  4NRT A;  4IFV B;  2VBW A;  2ZOF A;  3BGO P;  2VFV A;  1A7G E;  4ES1 A;  2R8G A;  4IR1 A;  4YY3 F;  1QRF A;  4HKQ A;  2CJB A;  2VFT A;  3ISN C;  2C2N A;  3MQG A;  2HBR B;  4OJG A;  2JWN A;  2HS0 A;  3PRB A;  3H5U A;  2CKW A;  2HQC A;  1S99 A;  1XNR J;  3TRG A;  4NZ6 A;  2FC9 A;  5CYM B;  4QIW D;  1G1X A;  1RSC A;  2JSX A;  4FXD A;  1V5V A;  3IFE A;  4HDG A;  1VQY A;  1N34 F;  2CZV C;  4ZHR A;  1SCJ B;  4C8L A;  5KFX A;  2DH7 A;  2B56 A;  5GAH U;  2DNG A;  1IJE B;  1TV6 B;  3F56 A;  4JV5 J;  3FGV A;  4J9L A;  2XYH B;  3W3S A;  4ZCK A;  3N5F A;  3B8H A;  4Y34 A;  3T1Y J;  1RWO B;  1LFW A;  3W60 A;  4DR3 F;  4GVB B;  4UOF A;  2XLK A;  2CZ4 A;  2Q6B A;  3VWS A;  2KFZ A;  2PEH A;  3KK2 A;  1URR A;  4LVO P;  3LGM A;  1OS5 A;  4HHH A;  1R0C B;  3NAH A;  2GJI A;  2FZK B;  1V3Z A;  2AMC B;  2GVZ A;  4MH8 A;  4HI1 A;  2OI7 A;  3QMQ A;  2V94 A;  2W2Q P;  3LGN A;  4HEA 9;  4M5G A;  4QWC A;  3OH4 A;  1TUW A;  1NPK A;  4O0I A;  4P72 A;  1IBC B;  5FJ4 A;  1WOP A;  3PEH A;  4DG1 A;  1I51 B;  4PG4 A;  1RHK B;  2DCU B;  4I6A A;  2ZH9 A;  3UWT A;  4ZLP A;  2BJ1 A;  4LIR A;  4LBH A;  5J1E A;  5AFU U;  4USV A;  2XGQ A;  1HNV B;  2QG9 B;  1XNR F;  1JLQ B;  4HHU A;  5C2G A;  1HKA A;  4ZVE A;  3PMO A;  4F02 A;  1H98 A;  1OQ6 A;  5BJR A;  5DDP C;  2IRU A;  3BH6 B;  2CFX A;  1QY7 A;  2D3U A;  5HAN A;  5JXS A;  2XMU A;  2JNJ A;  5E33 A;  1PKU A;  4NMX A;  2J7K A;  2NCK L;  5KT2 A;  2B9X A;  5C2C A;  5DZ7 A;  1LWF B;  4JV5 F;  1VRU A;  4DL5 A;  4OX8 A;  4IFY A;  3HZG A;  2H4W B;  3OSP A;  4WE1 A;  1ACM B;  1G6B A;  3TK8 A;  3T1Y F;  2ASL A;  1YP3 A;  2YNH A;  5KFS A;  5F3Z A;  1JLA A;  4TU9 A;  1FWK A;  3M4X A;  2VOD A;  1LXJ A;  1RAF B;  4FYY B;  1KRU A;  2VBY A;  5IC6 B;  4H7O A;  2F8E X;  4M5K A;  2HS4 A;  2MST A;  3BQ2 A;  1T05 B;  2EG1 A;  2QMX A;  1KBR A;  1SL1 A;  3P5B P;  2P5V A;  2RDJ A;  2C2R A;  2KN4 A;  2IMW P;  4Y6I A;  3MM7 B;  5J2Q B;  1JLG B;  1PAE X;  2M0G B;  1Y4Z B;  2ROP A;  3NXZ A;  4Y00 A;  2ERR A;  2HBQ B;  4PXC A;  1WDT A;  1VQP S;  1QDU B;  3WZ0 A;  4LRA A;  2LQ8 A;  2CXE A;  1T3O A;  2D3O 1;  3CED A;  2DK2 A;  4ZJQ A;  3C46 A;  4RNH A;  4J9Q A;  3RAX A;  4JI3 J;  4UY8 5;  3PNI A;  2JFK A;  3Q8R B;  4M5D B;  3Q8U A;  3P1B A;  4QCL A;  2YX1 A;  2R7T A;  4TY8 A;  3W5X A;  1T9U A;  3DDK A;  3VBI A;  3BGF A;  4FXW A;  3F73 A;  2PFD A;  4CO1 A;  1WKL A;  2OFG X;  3GYX B;  4YR3 A;  1IWA A;  3W65 A;  5C24 B;  1HQE B;  3TEH B;  4ZMM A;  3AB2 B;  1YHQ S;  1NKC A;  1KK4 A;  1GMV A;  3N28 A;  3I9Z A;  2KDO A;  1EKS A;  5ETK A;  3THT A;  1IWG A;  3MR3 A;  1TL7 A;  4A48 A;  1KRV A;  4ERD A;  1C4C A;  1LW0 A;  1LWC A;  2YNF B;  4FKY A;  4PQU A;  2YQ3 A;  4K4W A;  3HPO A;  1Y5N B;  3ZTO A;  4O0N A;  3VCD A;  5HLF A;  4P2S A;  3CJR A;  4YFU A;  3OL6 A;  1VQ9 S;  3EJM A;  4CCH A;  2AT1 B;  2BJD A;  1Z2F A;  2OPR A;  4LF6 F;  3LAM A;  4HHJ A;  4PXB A;  2W7A A;  1U49 A;  2VUG A;  3G71 S;  5U47 A;  2I2Y A;  3C8Y A;  3T57 A;  4JI0 J;  4RNN A;  2BYC A;  2WW8 A;  4JI3 F;  1SJ4 P;  4TU8 A;  3S7R A;  4J09 A;  4RBU A;  4USH A;  2O66 A;  1S1W B;  2HBZ B;  2MQO A;  2DPI A;  1IKW B;  2VHE A;  2LLZ A;  2HQI A;  5HK4 A;  4MIW A;  2HVE A;  1SC3 B;  4P9S A;  1HWL A;  4NXM J;  3NNC A;  1KGQ A;  3RG6 A;  2MZJ A;  2VB6 A;  4HUS A;  5HMX A;  2MXY A;  2UUA J;  1UJ4 A;  4EA8 A;  2OSQ A;  1GFW B;  2ZWP A;  2HGL A;  2WZ1 A;  3AXK A;  2E5J A;  1CG2 A;  5DGB A;  2OPP A;  2Y0S D;  2XHW A;  4ETX A;  4KB7 A;  3LP0 B;  3HVT B;  2ZJQ Q;  3THV A;  2FKO A;  1RBL A;  2W9C B;  5EGY A;  2BRK A;  1FXL A;  4HVZ A;  1JLE B;  4ILR A;  2R7X A;  2BRL A;  4S0M A;  3DLG B;  1N88 A;  4OJH A;  4Y2M A;  2E9R X;  1QUP A;  1AXQ A;  4F3Q A;  1TL1 A;  4DCP B;  2WW4 A;  3HT3 A;  4OMF G;  1KLN A;  3L09 A;  1XMO F;  3OFE A;  3DK5 A;  2FLN A;  1MU2 A;  4K7Q A;  4LSL A;  1L3S A;  4DPT A;  4MFB B;  4R5P A;  2BR0 A;  3MAA B;  5DDQ C;  4FCE A;  3BSC A;  4O3N A;  5C5J A;  4J90 A;  4CLP A;  5KFA A;  3FZB A;  1GMU A;  3Q1X A;  1J5E F;  2GIF A;  3H4D A;  4O4G A;  2CJQ A;  1MWY A;  3QGI A;  1CSJ A;  5LJ5 Y;  2IRX A;  4JI0 F;  3SZ2 A;  2P6S A;  4Z7C A;  5ETL A;  1WAC A;  2AJ1 A;  5J1N A;  1BWV A;  2OEL A;  3BN4 A;  4PPD A;  4PG7 A;  2DHX A;  4OZ3 A;  1WEL A;  4F50 A;  5CH7 B;  4ECS A;  2XY5 A;  3L3C A;  4JI1 F;  2EPI A;  2AGP A;  1T7P A;  2IVM A;  3D4J A;  1GXT A;  3PAC A;  4H4M B;  2CVI A;  4NXM F;  3W1Y C;  1OYE A;  3U02 A;  2FJD B;  2FDN A;  2UUA F;  2VQE F;  4C8K A;  1Z4U A;  3KWM A;  4X4S A;  3CTR A;  4U7C A;  2AJF E;  3GIM A;  1YIJ S;  4PYA A;  5K14 A;  4XDC A;  4IOC Q;  3W63 A;  4NLV A;  1M8N A;  4G65 A;  3I4H X;  1Q7Y T;  2KRB A;  1Q8B A;  1U7L A;  1VRT A;  2FJX A;  3TV0 A;  1D9F A;  4K4S A;  3VAJ A;  4PWU A;  1RWV B;  3QQC D;  3CDW A;  2HND A;  4HI2 A;  8AT1 B;  2YWG A;  4XPE A;  4DSK A;  1GT8 A;  2TDT A;  3K89 A;  4OYO A;  4ZVF A;  4AC3 A;  4CZC A;  3FJ2 A;  2W25 A;  5DM7 Q;  4FKX A;  1EQM A;  4N7T A;  1FXJ A;  4TN2 A;  2KO1 A;  3DOK B;  4R0J A;  3CJS A;  1WC0 A;  1RWX B;  2HYI B;  1NK4 A;  4OX6 A;  1YTY A;  2OEF A;  2YKM B;  2OI5 A;  3SCK E;  4QPT A;  1WC3 A;  4AFF A;  1FWY A;  2AX1 A;  5KG4 A;  2ASD A;  1XR5 A;  4H4K A;  2QLJ B;  2IUA A;  1RTI B;  4ILM A;  4CLZ A;  5D0E A;  2C2E A;  4RU9 A;  2IBK A;  2VAS A;  4G1I A;  4TVA B;  1REG X;  2GGQ A;  1RT2 B;  4DSL A;  3QO9 B;  2HNZ B;  1MNE A;  4GVL A;  3CD5 A;  4YB1 P;  2QT7 A;  4KPC A;  3AJ1 A;  2O3D A;  1QVG R;  1T11 A;  2N82 B;  1AZS B;  4J9P A;  4KPX A;  4LFB J;  4WIQ A;  3NLC A;  2R7R A;  1HNI A;  2MYF A;  4RWX A;  4LQ9 A;  4DUZ J;  5KFQ A;  1P6T A;  4G1P A;  3SQO P;  3UN3 A;  1RDR A;  1UPP A;  3H20 A;  1S7I A;  2PGC A;  3IM9 A;  3RJM B;  2ASY A;  1EHW A;  5GME A;  3B82 A;  2GQC A;  3IAM 9;  2R7S A;  4DV6 J;  2HIY A;  3ZZT A;  4B17 A;  3JSY A;  1V9O A;  2F8H A;  3B6B A;  3I9V 9;  3KLE B;  4OZ5 A;  1X4C A;  2A2D A;  1I6J A;  1MRO B;  4N6A A;  2ZBI A;  4QR1 A;  2B4U A;  2LQ9 A;  3EMT A;  1XN9 A;  3CPW R;  4LBP A;  4QU6 A;  4PWW A;  2G1H A;  5KTQ A;  2MKI A;  1XMQ J;  1X5T A;  1I94 J;  3A8I A;  4EGL A;  3ITH A;  4C48 A;  4AL7 A;  2CA9 A;  3HLU A;  3VAM A;  2WLG A;  3F1X A;  4P2F A;  5LSO A;  2I9S A;  2O67 A;  3JQK A;  3NGK A;  1IN0 A;  4H4O A;  4NCG A;  3MPY A;  3CWJ A;  2J9C A;  1IKY A;  3FEZ A;  5HBM A;  4E6T A;  4OYA A;  3EZU A;  3VBM A;  3MCS A;  4CLW A;  3LAL A;  2D69 A;  2DEI A;  1TVR B;  2VPW B;  3KNG A;  3I0R A;  1SIW B;  1U6B A;  2W4P A;  1Q8I A;  2W4D A;  5K8O A;  4K4Z A;  1FNM A;  1IKV A;  4D3H A;  4C2M A;  3KLG A;  2LDY A;  4F8R A;  4K2X A;  4DR6 F;  3KLF B;  4LFB F;  3R3R A;  4UZC A;  3A1Y G;  4K4T A;  1HPZ A;  3N01 A;  4U7U D;  3VAI A;  1N6Q A;  5LXY A;  1X9S A;  3QGG A;  4P7T A;  3NL0 A;  3PR5 B;  3ONQ A;  4UT4 A;  3G6X A;  1RJJ A;  5IT4 A;  3R2D J;  3H8Y A;  4YEA A;  1Q8L A;  4IG3 B;  4CLU A;  4U7U K;  3P3D A;  3IP0 A;  3P4U B;  1FKO A;  3ZZP A;  1T3D A;  4CLY A;  2R7V A;  4YUD A;  1O5J A;  2NRE A;  4ED5 A;  2QIA A;  4RNF A;  4Q7A A;  1IJF B;  5I3U B;  2VPY B;  5ADX U;  1SQG A;  3T6B A;  3TAQ A;  2YX4 A;  3RBZ A;  1U1O A;  1RZM A;  3SIP B;  4HT7 A;  5M2R A;  1I94 F;  1D9A A;  3WIU A;  2F3J A;  4NA1 A;  3R27 A;  1IR0 A;  5KFT A;  4X4U A;  4P75 A;  1RQ0 A;  3M6V A;  2KT2 A;  3NCQ A;  3BDP A;  3UPF A;  4KHM A;  4BLG A;  4CLK A;  2KG0 A;  2AF6 A;  3BSW A;  4OLO A;  5HRO B;  4DR5 F;  2DHH A;  1K1Q A;  1RAJ A;  2Q3P A;  2C3M A;  4UTG A;  3M7V A;  5AE1 A;  3EVO A;  3MM5 A;  2HQG A;  4DCL A;  1H3D A;  1PYT A;  3CCQ S;  1QSY A;  1NZ8 A;  1APS A;  5HMY A;  4F4A A;  3BSN A;  4PEO A;  1HBO B;  4B9L A;  2LQ5 A;  3CE8 A;  1SH0 A;  1DUR A;  1FDD A;  2YVS A;  3DDN A;  4K4X A;  3CMA S;  3TZX A;  2PEB A;  4EYH B;  2V4J A;  3CVK A;  2GVD B;  3NGR A;  1WHV A;  1TL3 B;  2XUL A;  3QT5 A;  2OIH A;  2DIS A;  2VC1 A;  5THW A;  4QWB A;  4ZN1 A;  5FLX Y;  3H5X A;  1RGV A;  1S1V B;  4QJV A;  1YP4 A;  4R37 A;  5KFR A;  3L7O A;  3D66 A;  3R7S B;  5LOQ A;  1MW7 A;  3S6E A;  2W2O P;  2KM8 B;  4RWW A;  1PCA A;  1QAY A;  2WB1 D;  1QRM A;  4HZD A;  3TJA A;  4DXL A;  3HHK A;  1UFK A;  1YSJ A;  5E41 A;  2G9O A;  2X7I A;  3HHN B;  2BQU A;  4X64 J;  1T0T V;  3Q86 A;  2YKA A;  3H7H B;  2IAJ A;  3H90 A;  1Q5V A;  1MN7 A;  4G6V B;  4KFB B;  4OLP A;  3UNY A;  1SJR A;  1L3V A;  1XIQ A;  1MLA A;  2Y1R I;  3P8B B;  2EK6 A;  4IOA Q;  3ISZ A;  1TKX B;  3R1W A;  4A8Q A;  1HWU A;  3IC1 A;  4WXW A;  1VC5 A;  3O8W A;  5CAA A;  3V4I B;  3IN5 A;  3C15 B;  2O5D A;  1OO0 B;  2DXD A;  3DLK B;  1V3W A;  4DOZ A;  1G97 A;  2VG5 B;  3CDU A;  1JJH A;  4HAC A;  4KGV B;  1HMV A;  2VA3 A;  4FYX B;  4Y2K A;  2XNR A;  5IM0 A;  4DQS A;  2EK1 A;  2XMW A;  2ZIT A;  2OEM A;  5B0A A;  1B64 A;  3C6U B;  4WF9 Q;  1SI9 A;  1NK9 A;  2RH3 A;  2GZO A;  1RT1 B;  3IWN C;  4CYU B;  1KQG B;  3QT8 A;  3R5B A;  1S9G B;  3MEG A;  1KGT A;  1R0B G;  3OGZ A;  1ITP A;  1R27 B;  1BLU A;  2J7U A;  4ED8 A;  3H5Y A;  1IBL F;  1FNO A;  2L9N A;  3DU5 A;  1DQ8 A;  4MKV A;  1HHQ A;  4OZN A;  4X64 F;  1DRZ A;  3RUB L;  2HAF A;  2XZT B;  2C3U A;  2XEX A;  4ITS A;  2QV6 A;  1UAW A;  2ZE2 B;  1OSC A;  1FO1 A;  3SXL A;  1KFS A;  4O44 B;  2XMA A;  4K5S A;  2HFS A;  2WBR A;  2HEK A;  3SFU A;  1U45 A;  2GJF A;  1Z1Z A;  3UCU P;  5D3G A;  2L08 A;  1YQH A;  1C1C B;  4M94 A;  2DCL A;  2AQ9 A;  1A0O B;  4GC6 A;  1ZM3 A;  3UD5 A;  3N6M A;  3UNG C;  2HHP A;  2AEJ A;  5LSR A;  2EFV A;  2IRY A;  1RHQ B;  2CQD A;  4I2P B;  2QN6 B;  4FP9 A;  4HDH A;  4QYZ K;  4JV2 A;  3TAP A;  3G87 A;  4B9V A;  2JF2 A;  2DIV A;  2L41 A;  1TKZ A;  2RDD A;  5K5M A;  1ZPW X;  4KTQ A;  2I8E A;  2ZBC A;  2QLB B;  1FEH A;  1YBT A;  2L9W A;  1JXV A;  3GQ8 A;  4FDF A;  4NZ0 A;  1RTZ A;  3Q8Q B;  2WON B;  2Q4J A;  1B70 B;  5BXI A;  2UUB F;  4IH6 A;  2ILY A;  1O8B A;  2C2M B;  2LXI A;  1OJ4 A;  4PAB A;  1FNX H;  4C3K A;  1SJ1 A;  2UXD J;  1FTC A;  2Z2Y B;  3DRR A;  3MR2 A;  5KFZ A;  3OL9 A;  3H2L A;  1BE4 A;  4RW9 A;  3JQM A;  4CNY A;  4KHP J;  1NJX A;  3P45 B;  2RS8 A;  4Y3C A;  4CT9 A;  3ENA A;  1KTV A;  1F6T A;  3BM7 A;  2RSQ A;  3BRK X;  3ZTQ A;  4LSN A;  3A3N B;  3OBI A;  1UVJ A;  1FTR A;  5GAD U;  3JYT B;  3W9H A;  2PMH A;  3PYF A;  2M4M A;  1U25 A;  4CM2 A;  3PG9 A;  1HQU B;  4ED0 A;  5DDR C;  1H7X A;  5IQQ A;  1JXE A;  5GAG U;  3FWW A;  4LJM A;  3IR6 B;  3NBP A;  4QPX A;  2R3V A;  1UVM A;  2W01 A;  3M2R B;  2MHE A;  3VGS A;  4P2M A;  1TEL A;  3A12 A;  4V19 J;  3U1M A;  5IQ6 A;  3ZC4 A;  3PY8 A;  4DF4 A;  5LL6 d;  1U2F A;  3EVW A;  3E01 A;  1Q81 T;  3CJ3 A;  4ZS6 A;  2VG5 A;  4AND A;  2KJV A;  3KJN B;  3CF5 Q;  3JQJ A;  3MPV A;  3TUJ C;  3HHL C;  3AJ2 A;  3FSX A;  3M05 A;  1JK9 B;  1JJC B;  1IQT A;  4DPX A;  4YN3 B;  5HJX A;  3GLJ A;  5KG7 A;  4F2S A;  2BAB A;  1VQ7 S;  2VPZ B;  1NH8 A;  3M6X A;  1E6Y B;  4ANC A;  1X9W A;  5L6S A;  3H25 A;  4IO9 Q;  1SQF A;  2SXL A;  2HRU A;  3UVJ B;  5H1S V;  2UXD F;  3UR0 A;  1FHT A;  1RI7 A;  2JJ4 D;  3TIS A;  1KLM B;  1RAH B;  1Y5I B;  3FRZ A;  4CTA A;  1KVJ A;  4KHP F;  2HVI A;  2B3T B;  1JLB A;  1QAX A;  4KGZ B;  3R6L B;  5B08 A;  1K8A T;  2ZVI A;  1GXL A;  1UVL A;  4U6P A;  1RCX B;  4ECR A;  2GHW A;  3ZO7 A;  4PWD A;  4PG5 A;  3SMZ A;  1X4G A;  3PVX A;  2DNY A;  5IV4 A;  3PHE A;  2FLL A;  4MKA A;  2DRA A;  3DYA B;  1SL0 A;  4DV4 J;  1R8A A;  1X4F A;  3C66 A;  4W4M A;  1RP5 A;  4FBT A;  2XSJ A;  4WXO A;  3DOL B;  2MKJ A;  4KE5 A;  1HAR A;  1HA1 A;  1AUS L;  3K17 A;  2I5J A;  1N4I A;  3QIP B;  2CAJ A;  4M98 A;  2H9Z A;  2DGO A;  4MFG A;  2OJ3 A;  3Q89 A;  4J9V A;  5KT4 A;  1UJ6 A;  1HI1 A;  1VQK S;  3CJ5 A;  3LP2 B;  3DXS X;  1CLF A;  1VFJ A;  2AWZ A;  4G1Q A;  1CJU B;  1RTH B;  3M1V B;  3MWB A;  2V34 A;  1SV5 B;  3TX0 A;  2LA6 A;  1S6Q A;  3L7U A;  2OI2 A;  4J9N A;  5FLX U;  5H9E J;  4TLQ A;  3EE3 A;  3IRX B;  4DMZ A;  3G82 A;  2DNQ A;  3TUZ C;  2HQF A;  3CD6 S;  4CH0 S;  4NLY A;  3AD7 C;  3P5T L;  4RW8 A;  3BBC A;  5DS7 A;  4UOC A;  2MGZ B;  3ECT A;  1KKH A;  5IOL A;  4RO0 A;  2XMV A;  2OML A;  2BJ7 A;  4O3P A;  3HZE A;  4ISX A;  4NXN J;  1RT4 A;  2CJA A;  3DDI A;  5B0D A;  1HW8 A;  3SUC A;  5E2Q A;  2HZC A;  3JSM B;  4DZD A;  1LOU A;  2WSF C;  4ZLJ A;  5I42 B;  4CO4 A;  1QTN B;  2KT5 A;  1VOM A;  3I3X A;  2ZUA A;  2MKY A;  3L7P A;  1C2P A;  3NGS A;  5RUB A;  4Y65 A;  3A8J A;  1U1R A;  1FWP A;  3Q83 A;  3FCH A;  4DV4 F;  5SZT A;  4X2B A;  3EEV A;  5DG7 A;  3BGR A;  2V5H G;  3GYN A;  4WTY A;  4WP3 A;  1VQM S;  4QU7 A;  1P9Q C;  3CD7 A;  1Z2L A;  4N69 A;  2JOQ A;  4JI7 J;  3KOA A;  4IOB A;  3RW7 A;  1N0U A;  2KT3 A;  3MZI A;  1HR0 F;  1OYD A;  1HBN A;  2MQL A;  3VBN A;  3PTW A;  1FF2 A;  3RBX A;  4CLF A;  2FPH X;  3FBC A;  5A6W A;  2OPS B;  2D41 A;  1NSA A;  4KJI A;  2QA4 G;  5LMU J;  4AQY F;  1XNQ F;  2YNI A;  4F3M A;  3WBZ A;  3M8R A;  1T9T A;  1CS4 A;  2XS7 A;  3N79 A;  3LA0 A;  4ZCM A;  1KHR A;  3FZ2 A;  2V67 A;  4DPY A;  1UET A;  4ED4 A;  3ZZR A;  3OW2 R;  5AFU V;  1RIS A;  2PMW A;  1RT7 B;  2J7W A;  5ETN A;  4DR7 J;  2G4B A;  3BRE A;  1TAQ A;  2Y1L B;  1HBU B;  3GJQ B;  3BZQ A;  4OQJ A;  9RUB A;  4WFZ A;  3C19 A;  2M5Y A;  2IHR 1;  2ZNZ A;  5E3C A;  3ZTS A;  4NXN F;  3OL8 A;  4V1A k;  2V9K A;  4RNM A;  3TA2 A;  1VR6 A;  1FXD A;  1U09 A;  1V6H A;  4ER8 A;  2FVR A;  1MSW D;  4OI2 A;  1WF1 A;  1M1H A;  4Q2M A;  2V4Q A;  4UOG A;  4OL8 A;  2CPE A;  2HMI A;  1P9Y A;  3QFW A;  4JOU A;  2CZ9 A;  5AJ3 J;  2EVZ A;  2H5J B;  1KOH A;  3UFC X;  4M2A A;  2H54 B;  1YZ6 A;  1YRX A;  1FRH A;  2MLZ A;  1HI0 P;  1BQM A;  1HWI A;  2UZA A;  5CYJ A;  5AE2 A;  1F2H A;  4FS1 A;  1U0H A;  3CCT A;  5GMD A;  4EAB A;  4C3M A;  2HUR A;  3CO9 A;  2MZS A;  3GFZ A;  3DLE B;  4WFX A;  5LMU F;  1MR9 A;  1VHF A;  5CYQ B;  3MDF A;  2RQK A;  1VQO S;  4BHQ A;  3D6H B;  3R7N B;  2MTL A;  3DFE A;  3UR3 C;  4JV1 A;  3NNA A;  3W5Y A;  3V2U C;  3SFG A;  2AIR B;  5ADZ A;  2FGC A;  3KTQ A;  4M28 A;  2MQQ A;  3H42 A;  4ZVS B;  5KFO A;  3C6T B;  1FD2 A;  3T3F A;  3DM2 B;  1Z90 A;  3AD8 C;  2E66 A;  4DR7 F;  2PA8 D;  4ECW A;  4EEY A;  1F5A A;  2ZWO A;  4DS5 A;  4PR6 A;  4RLE A;  3OT9 A;  4DFM A;  2M52 A;  5KAK A;  1VQ8 S;  4HZC A;  2E7V A;  1RT6 A;  4K8R A;  6FD1 A;  2F65 A;  3IS9 B;  2YQ0 A;  1YBU A;  2B9E A;  4P71 A;  3FRY A;  3EVM A;  5H9F J;  3QLH B;  4DV0 J;  3GUE A;  1ZM9 A;  4EA9 A;  3TJ8 A;  2BM1 A;  4X4N A;  1UKU A;  3OH2 A;  4KQZ A;  1FWL A;  3A3O B;  2N3O A;  3CJK B;  1OPI A;  4XIU A;  2YWH A;  1NB7 A;  2KTQ A;  1QAI A;  4HTI A;  3T19 A;  5AJ3 F;  2G1D A;  1WF0 A;  1WC1 A;  2XB2 D;  3BJY A;  5CHC B;  3QGP A;  2DR8 A;  2WLF A;  3IXC A;  1DY3 A;  2M8D B;  1SJQ A;  2YWF A;  1L0S A;  2CG8 A;  4V19 X;  1R8P A;  3GE9 A;  2RAQ A;  1CJT A;  1CJV B;  3I5A A;  2CAD A;  4ECT A;  1RYS A;  3N0V A;  1FK9 B;  3NGU A;  3KNA A;  1KHV A;  2FVS A;  3CW2 C;  5E0O A;  2MSS A;  3W66 A;  2EKY A;  1MN9 A;  1P27 B;  1VC0 A;  1HIY A;  5A0Y A;  1NEE A;  4RUA A;  3ISN D;  1XHD A;  1U24 A;  3FK4 A;  4NEZ A;  5FII A;  3DNC A;  5FDL B;  1NHV A;  2F5G A;  3CNQ P;  1SH2 A;  4YP3 A;  2JRS A;  4LRE A;  3JB9 k;  1SL2 A;  3DU6 A;  1OIA A;  2ROE A;  2QL9 B;  4USM A;  3FFI B;  1YJR A;  2WOM A;  1FJ7 A;  4KIA A;  1VJW A;  3EZ5 A;  2EFP A;  3KDO A;  3DMJ B;  1JIH A;  3G8T A;  5IFM A;  3SCL E;  1CJK B;  2E5I A;  1XR6 A;  1ZZN A;  2FJW A;  3OSN A;  1F3V A;  4C0B A;  1OMS A;  5J2P A;  3KUH A;  5LXR A;  4OYM A;  1EWW A;  5F8H A;  2ZEJ A;  2CJX B;  3OH3 A;  1NND A;  3U7J A;  3M2U A;  4DL6 A;  1N8R T;  4G87 A;  1FRL A;  2DGU A;  2M70 A;  2RT3 A;  1J5O B;  4QYR A;  4XK8 C;  3PDN A;  1B99 A;  1S6O A;  2C2O B;  2L3M A;  5JUM A;  2B6A B;  2DHS A;  4ZVG A;  1R6V A;  4IG0 B;  4AE5 A;  1K73 T;  2W4C A;  5GAE U;  4UY8 T;  5JMN A;  3Q22 A;  2J5A A;  4HL9 A;  3R5G A;  1RA7 A;  3J7A N;  2AEM A;  2YKO A;  2I38 A;  1GEH A;  2XBP A;  3F41 A;  2Q43 A;  1NPP A;  2B5J A;  2Z2L A;  3NAI A;  4DFJ A;  4J18 A;  2XCA A;  3IBF B;  3TAM A;  5DG3 A;  5K8P A;  1H38 A;  1LFP A;  4N76 A;  4NYP A;  1ZOT A;  4CO2 A;  2QFI A;  4KQL A;  3Q2T C;  1R0A B;  3H2U B;  5T7L B;  1HHS A;  3IRW P;  1ZAV A;  3S8S A;  3IGV A;  1CUL B;  4E1K A;  1S6P A;  3KJV B;  3WC0 A;  2VPX B;  2R8I A;  2RRN A;  2E5L J;  4B3M F;  3A13 A;  3PR4 A;  2MY7 A;  4B9M A;  3SQG A;  4F4X A;  1R89 A;  2ZH7 A;  1T9X A;  4FF4 A;  2B8P A;  2C22 A;  4C98 A;  3DHW C;  1MML A;  3HO1 A;  3MFI A;  4UOH A;  4E0D A;  3G8Q A;  2W2P P;  2H51 B;  4CH7 A;  2OEJ A;  2BE2 B;  4ZKA A;  2QYC A;  4ILL A;  1SC4 B;  5B0C A;  4LBI A;  2FHO B;  3KFW X;  5D4N A;  1ICE B;  4RU2 A;  2FJA B;  1ZH5 A;  2CDR B;  1EZZ B;  1T03 A;  4KO0 A;  2EC2 A;  1IVZ A;  4EBD A;  2VG6 B;  5L1I A;  4BWJ A;  2PN6 A;  1N4L A;  1S9E B;  4G3S A;  2OO4 A;  4YS2 A;  2ZOG A;  4N5S A;  1VQ6 S;  2MEW A;  2ADC A;  3CCM S;  3KK1 B;  3ET6 A;  1PJ6 A;  2DB1 A;  3DI6 B;  3I96 A;  4M5M A;  4NLT A;  3O1L A;  1RT5 A;  4I7F A;  1CC7 A;  2BE9 B;  5L1J A;  3EDR B;  4NML A;  4KV8 B;  3SDE B;  2CNK B;  1XBW A;  3SRT A;  4WU2 A;  1KFD A;  1P1L A;  3MOJ B;  1T3N A;  1NRK A;  2Y8W A;  4DV1 F;  2JEI A;  1X60 A;  2K7K A;  1D8Z A;  1FFG B;  2CDQ A;  3ST8 A;  1FJG J;  3MEK A;  4AYB D;  1LW2 B;  2GV1 A;  1Q8K A;  2YKN B;  2ACM A;  1O51 A;  3HDS A;  1C0T A;  3LWM A;  2XGP A;  5D15 A;  2BM0 A;  2E5L F;  4F36 A;  5KG3 A;  1WJ9 A;  3N5B A;  3CC7 S;  1RAC B;  2K1R B;  3M32 A;  4MIB A;  3LUY A;  1IM4 A;  1W2I A;  4M95 A;  2PFF B;  2DNR A;  2VL1 A;  1B7Y B;  1VIO A;  4UST A;  2IA0 A;  5CCL A;  4L6V 3;  1RHJ B;  4PPZ A;  1X8D A;  2XCP A;  2BAC A;  3PXG a;  4ZPD A;  3W7B A;  1VQ4 S;  1T94 A;  2B6A A;  2DD8 S;  3D3C J;  2AJ0 A;  5J2M A;  2JFD A;  3DOM A;  2CNO B;  1IBK F;  1F60 B;  1XWL A;  2RQ4 A;  4EMD A;  1W26 A;  5G4D A;  2DNZ A;  1JLC B;  2MZR A;  3D6F B;  2GAG C;  2AJ4 A;  1N36 J;  4FBU A;  2DR6 A;  2YTC A;  4WKR A;  1S1T A;  1WKJ A;  3M30 B;  4DQQ A;  4IQM A;  2ASJ A;  4QBU A;  2JLG A;  1S12 A;  3I87 A;  2CJY B;  4WP8 A;  3OTC A;  3UN5 A;  3JAM Y;  2DTJ A;  2W2M P;  3FOQ A;  4TLR A;  3W2W A;  3KLI B;  2NYH A;  4PXE A;  1WKK A;  4L72 B;  1KSP A;  3GIJ A;  3PJW A;  1WDD A;  3C14 B;  1YGY A;  3AOD A;  5L6V A;  4QWA A;  4YB7 A;  5K8M A;  3MGJ A;  5DDO C;  1EET B;  4MKY A;  3OLA A;  3NS6 A;  2CQH A;  2QFJ A;  4EBE A;  2WTF A;  3HJV A;  2ZM6 J;  2E1P A;  5E3R A;  3QWU A;  4PRF A;  4KHR A;  2CPZ A;  4Y2C A;  2C1E B;  4DCO B;  3WHI A;  3POT B;  1LV5 A;  2EBE A;  1UTA A;  3HFK A;  4EI2 A;  1TQL A;  2JHE A;  3F44 A;  2IC3 B;  3V81 A;  1KP6 A;  4PCQ A;  2HFU A;  1JKH B;  4OI3 A;  3TQ1 A;  4B9U A;  1ZAX A;  2GS8 A;  2EC0 A;  1HNX J;  5KT7 A;  1WG4 A;  2C2D A;  1SKS A;  2MQP A;  1RWP B;  2B8Q A;  4UQG A;  3HUL A;  4NL5 A;  4UW2 A;  3QJL A;  2WLC A;  1Y11 A;  4DSF A;  5CZV A;  5ADX V;  2B4O A;  1C1B A;  1N36 F;  1H2V Z;  2QLF B;  3V4E A;  1VBK A;  2RQC A;  2N3L A;  3MEC A;  5KFE A;  5KFB A;  2HPU A;  2QC3 A;  1HBM A;  3QAE A;  3WX4 A;  1RAD B;  1XTZ A;  2ZH4 A;  2GJ2 A;  1G4C A;  3MM9 A;  1NK0 A;  3RRK A;  3HI9 A;  4CO5 A;  1UA0 A;  2QL5 B;  3KLH A;  1GAO A;  4FPR A;  2V8V A;  3KDN A;  2QE5 A;  4B9S A;  2AV5 A;  3SCI E;  3CJQ A;  1Z2Z A;  1U6Z A;  3HP6 A;  1OWX A;  1SQE A;  2P2O A;  1HYS A;  1NUE A;  2GGP A;  4J9S A;  1ZS6 A;  3OD2 A;  4J9K A;  1D3W A;  2QTW A;  4ZHR B;  4ED1 A;  2CNL B;  2PI5 A;  4M99 A;  4IUF A;  2Z57 B;  4WPA A;  2KFY A;  1PGZ A;  3EZO A;  2J9D A;  3BN7 A;  5SUH A;  2ZM6 F;  3UDV A;  1VK8 A;  2BUN A;  3EWG A;  2KI2 A;  4WTO B;  4MKB A;  1F1B B;  3OVA A;  3EXY A;  1XMB A;  3EPI A;  2FHJ A;  2V4R A;  3MUR P;  3PW0 A;  4QZV B;  2VBZ A;  3KK2 B;  1BC6 A;  5F42 A;  4ZPA A;  4FVM A;  4GO5 X;  2B51 A;  1HNX F;  2XS2 A;  1SUQ A;  3OR1 A;  5EX3 A;  4WII A;  3ENW A;  2XLI A;  2GVZ B;  4ELT A;  2MQM A;  1ZTT A;  2JEG A;  1K0T A;  3IG1 A;  1EAR A;  3GWC A;  3QSY B;  1HD1 A;  4X4P A;  3J81 Y;  4B3O A;  3BSO A;  4FYV B;  3KUE A;  1YI2 S;  3QT7 A;  5L1K A;  3HVA A;  4DG1 B;  1X4H A;  3AJD A;  1HHT P;  4DDF A;  5IC4 B;  1YVF A;  3D1Q A;  1NDC A;  3OXG A;  2G2Y A;  4WYL A;  1X9M A;  1ARO P;  2CQ1 A;  1KD1 T;  1Q53 A;  5J1E B;  4I68 A;  3QPI A;  3GFH A;  3FCV A;  4LF8 J;  4CDI A;  5CXT A;  3OFG A;  4NEY A;  1U1K A;  1PSD A;  3SCJ E;  1RXO B;  3M8Q A;  3V6K A;  3HCX A;  1VLO A;  1WG1 A;  4MK8 A;  2V0J A;  4ZJL A;  2RRB A;  1JMT A;  3Q24 A;  1VRU B;  2WAQ D;  4DLE A;  4IFY B;  1RLD A;  2V2Z A;  5CD4 A;  4WE1 B;  4Q0B A;  2HQD A;  2YNH B;  3TZW A;  2GC8 A;  2FHJ D;  3VVU A;  1XJW B;  4ZDN A;  4CO0 A;  1JLA B;  4RNO A;  4ES3 A;  4DV2 J;  4L3K A;  3AAW B;  3JSR A;  3DJ4 A;  2DHG A;  1H74 A;  3KHH A;  1UWB A;  3OXF A;  3VR1 A;  4EWT A;  3PYG A;  1FER A;  2BMB A;  5B0F A;  2IJF A;  4N56 A;  4R36 A;  4IKA A;  4QR0 A;  1U2R A;  3R3T A;  3K59 A;  4OJ1 A;  2V50 A;  1H7W A;  3DLB A;  3M6U A;  2Y1I A;  3I32 A;  3FBF A;  3H40 A;  4OZJ A;  3DCA A;  1YJT A;  4KH1 B;  4BC7 A;  1G95 A;  1WSR A;  2M8H A;  3VQT A;  4KGK A;  3BO2 A;  3DKD A;  5KFY A;  3BS9 A;  2J6T A;  1LK7 A;  5H9E K;  1SIZ A;  1KEK A;  4WCE Q;  4YR2 A;  1S48 A;  1Q82 T;  4DX6 A;  3N6N A;  4ZPB A;  2JH3 A;  5EHH A;  2I6W A;  2V0L A;  4GRS A;  4LF8 F;  4TY8 B;  1E6V A;  5HQM A;  4KKO A;  2DT9 A;  2UVU A;  2BAN A;  2MPU A;  3UDL A;  1PIL A;  2F1F A;  2FLP A;  1X0F A;  1KOO A;  2DGV A;  2OI6 A;  4DR2 F;  3GVD A;  3KK3 A;  3G6Y A;  4M8L A;  3ZNU A;  1C0U A;  2CYY A;  2R2U A;  3BGU A;  1TKT A;  4KH0 B;  2E1A A;  1R3N A;  4UQT A;  3I6P A;  3GIK A;  1TL7 B;  1WOO A;  3GSD A;  1BY9 A;  3ELH A;  4DV2 F;  1LW0 B;  1LWC B;  2E44 A;  5L39 A;  3PHT A;  3I5B A;  3M8P A;  2RE1 A;  2HWT A;  1AW0 A;  3T1H J;  4PQU B;  5HP1 A;  2FUG 9;  3MED A;  1SST A;  5A8W A;  2P9E A;  5F8G A;  3MR7 A;  3H2V E;  5HLF B;  4IRD A;  2FLO A;  2JX2 A;  4DL3 A;  2DGW A;  3CUL A;  3GII A;  2OPR B;  4TY9 A;  4Y2I A;  2HFV A;  1S4E A;  2V8P A;  4C6A A;  4W90 B;  1AB8 A;  2ZKT A;  3P47 A;  2EFQ A;  2BA9 A;  1PJ7 A;  5HMW A;  4OJ3 A;  2BQ3 A;  1ZTW A;  1N56 A;  1KR4 A;  1ELO A;  4Q2L A;  2V2V A;  2D7S A;  1M1G A;  2XSF A;  1N5Y A;  3MD1 A;  5DRK A;  1VQS A;  1FFS B;  4RW6 A;  1HW9 A;  5D0G A;  2ZDO A;  3LP1 A;  2W0V A;  4NPO A;  2OFH X;  3NOC A;  1V3R A;  3BXY A;  3JAM U;  2YH0 A;  2DVI A;  2WB4 A;  3PIO Q;  1TMJ A;  1RE1 B;  1YJV A;  3TJ9 A;  4HH1 A;  5ITH A;  4JI8 F;  2N4C A;  3W8G A;  2UV8 A;  4OI6 A;  2CIM A;  3GIR A;  2AYE A;  3R5J B;  4EGG A;  2OPP B;  3GCW P;  2HNY A;  2A0F B;  5EDW A;  2RKI A;  4E75 A;  1WEX A;  2E29 A;  2ZOM A;  1P8G A;  4EZ6 A;  1VC6 A;  4AD6 A;  3US5 A;  3PW2 A;  2UVW A;  4DN9 A;  2B9Y A;  3VAK A;  2YXL A;  4E79 A;  5ETR A;  2ZH2 A;  1T9W A;  3T1H F;  3OTO J;  4ZLN A;  1TL1 B;  4F3O A;  3NS7 B;  1JLF A;  4JI5 J;  3U27 A;  1NCL A;  5ETP A;  1RAO A;  4ZCL A;  4EQY A;  2DNM A;  1MU2 B;  4BBY A;  2BJ9 A;  4DSE A;  4LSL B;  3CIM A;  4R5P B;  3MM6 A;  1DTQ A;  1SKU B;  2WVB A;  1ZET A;  3MCO A;  4LF6 J;  1RBO B;  4WK1 A;  2IM3 A;  3MM8 A;  1CQM A;  5KFN A;  2DR5 A;  5KFK A;  3W8P A;  2A1B A;  4ZPT R;  2F8M A;  3W62 A;  1WEZ A;  2CRL A;  3KUG A;  4IO1 A;  1X7V A;  1QM9 A;  4AAW A;  1BQN A;  4X4Q A;  4O4G B;  1GTH A;  3MOZ A;  2J8S A;  2MKS A;  3K7R A;  2HVH A;  4DWI A;  5IWA J;  1DTT A;  4NOH A;  3R3I A;  3TUI C;  4OHZ A;  1FA0 A;  3FQK A;  2QMU B;  3CSK A;  1LK5 A;  2GMH A;  3N6L A;  1IQZ A;  4DUT A;  2QIF A;  2EFG A;  2LQJ A;  2RHS B;  1ZPV A;  1WOS A;  2CG4 A;  4N8O A;  2IPO B;  3OW5 A;  1TK8 A;  1M5S A;  4C11 A;  2LCW A;  2P2C B;  2RRA A;  4AXI A;  1R6Y A;  3GU0 A;  3GSI A;  5K14 B;  3BQ1 A;  3MR6 A;  1FDA A;  3NS5 A;  3Q8Y A;  2NZ4 A;  3UD3 P;  2FYX A;  4N41 A;  3E8O A;  1U47 A;  1VRT B;  2MLX A;  1HV9 A;  2LMI A;  2J8A A;  3M8S A;  2B4P A;  1UZD A;  1SKR A;  4LF5 J;  3OTO F;  4D3G A;  2HND B;  2ATC B;  4OFZ A;  4M1K A;  4NYZ A;  3GQ9 A;  1GTE A;  3CDA A;  5HMZ A;  2LEB A;  5D6G A;  2G2O A;  2UU9 F;  4JI5 F;  1XMO J;  3ICL A;  1HNZ J;  2GO9 A;  5KFG A;  3UCZ P;  4MTP A;  3TVK A;  2XM3 A;  1FKP A;  1U1P A;  1Y00 A;  5F0W A;  2DGT A;  2ZZN A;  3IWX A;  2NXN A;  5DEM A;  3V6D A;  4DSI A;  3CJ8 A;  3LGH A;  2HHW A;  3RBD A;  1WC4 A;  4KGM A;  1J5E J;  1LQ9 A;  3VAG A;  1ZBT A;  4IDK A;  1TP7 A;  3J81 U;  4NI2 A;  4N27 A;  4I6Y A;  3W5Z A;  3OUP A;  1KS2 A;  5IWA F;  5A8R A;  2ZBR A;  3MMA A;  4ID5 A;  2BBE A;  3HSQ A;  1RBA A;  2AGO A;  1V5I B;  2GCF A;  2V68 A;  3J7A 1;  3FKB A;  4FVC A;  4JI1 J;  1VYA A;  4CLL A;  4NWB A;  6FDR A;  3FBE A;  2VC0 A;  1LXA A;  4LRF A;  4OHV A;  2VQE J;  2KFN A;  2I0X A;  2XMT A;  3K2Y A;  4JUZ A;  1HNI B;  3PX4 A;  3GJT B;  2KU7 A;  4WFB Q;  2P9C A;  1LEO A;  2ZKU A;  2C28 A;  1SH3 A;  3NGT A;  1VRQ C;  1NKB A;  3GON A;  2HFZ A;  4ED3 A;  4ZVO B;  2J76 E;  5EN1 A;  3MFH A;  5F8J A;  3R2W A;  4AUK A;  3W64 A;  3K5N A;  1YP2 A;  3BV8 A;  3P6Y C;  4LF5 F;  2QRR A;  3HHL A;  3H4B A;  2AZ3 A;  2R2S A;  4DR1 F;  3KKF A;  4QIE A;  2IYI A;  1HNZ F;  4C8O A;  2AYM A;  1WTB A;  5D78 A;  3TO8 A;  3KLV A;  3GR1 A;  2N7C A;  2NXE A;  2XI3 A;  1HI8 A;  2YWK A;  4PUO A;  4XPC A;  2Z4P A;  3ITH B;  4C0H A;  2I5K A;  3E51 A;  4IHF A;  5F9L A;  3R5C A;  2ZJP Q;  3QSI A;  3E3X A;  4ECU A;  3PV8 A;  1AUD A;  1NH7 A;  1B4S A;  2R7W A;  1EP4 A;  2VQF J;  2VJV A;  1L3K A;  4H4O B;  4NCG B;  2Z30 B;  5KOX A;  2DXF A;  3EPG A;  1IKY B;  3GJS B;  5HBM B;  1T9Y A;  2FC8 A;  4PXD A;  1J2Z A;  3G2X A;  2RUG A;  1S49 A;  3OTE A;  2AW0 A;  3ENV A;  3GV7 B;  3PFE A;  3I0R B;  1O6X A;  4MYT A;  3SSR A;  2HHQ A;  5L46 A;  1SPB P;  1IKV B;  3KLG B;  3BR9 A;  5A8K A;  1RKI A;  1YRT A;  4NLR A;  2RU3 A;  1KVI A;  1HPZ B;  3MCM A;  4ED6 A;  2MZ1 A;  3HX9 A;  1U02 A;  1N6Q B;  1QLN A;  1Y9O A;  2Y3Y A;  3VBP A;  2GML A;  3HHL D;  2LU1 A;  3GQA A;  1FKO B;  1MWZ A;  2QSW A;  2VG7 A;  3CUN A;  2WVE A;  4MZU A;  3IR5 B;  4ZVH A;  3MF5 A;  4IR9 A;  3PW7 A;  2UXB J;  3TYT A;  2W9A A;  5IV3 A;  2YWE A;  5HQ8 A;  3EH0 A;  4ANE A;  2BZ2 A;  2FVC A;  2AD9 A;  1TDT A;  2QL7 B;  3GR0 A;  4MYU A;  5BYS A;  2VQF F;  1M1K T;  4WK3 A;  3BKT A;  1N52 B;  3DLH A;  3I4P A;  3QRR A;  4C97 A;  3J7Z 5;  2HQ3 A;  4UUW A;  1VBZ A;  2F40 A;  2G0I A;  3PIP Q;  3FMB A;  1AT1 B;  3FUY A;  3MM5 B;  4IYQ A;  3T9Z A;  1S1U A;  2ZVS A;  1HQ2 A;  4OHW A;  4TYB A;  4P10 A;  4RBV A;  3HJJ A;  3IGJ A;  4USJ C;  4FNH A;  3MHY A;  1HLW A;  1SBR A;  2RQM A;  2MZT A;  5KT3 A;  1RAE B;  4DR6 J;  1NSQ A;  2X1G A;  2EXU A;  3NRB A;  3RB3 A;  4YQW A;  2CQB A;  3FSY A;  4P73 A;  2ZD1 A;  3AD9 C;  2V4J B;  2KXH A;  2W24 A;  2JC0 A;  4G3Q A;  3HF5 A;  2NYI A;  4YDX A;  5C42 A;  2BW2 A;  2ZH6 A;  2GMJ A;  3K5P A;  1WUU A;  2XI2 A;  4TYA A;  1RWM B;  4IHG A;  1WOR A;  2NZC A;  2WSC C;  1NAQ A;  2IJN A;  5EWE A;  4C4W A;  3OR2 A;  2BXJ A;  3R2C J;  2AHO B;  2UXB F;  3I82 A;  1R8H A;  4WJB A;  1RT3 A;  1YBA A;  3CCZ A;  3MEE A;  4A4J A;  1EX8 A; 
#chains in the Genus database with same CATH homology
 1KGT A;  3MQH A;  3TWD A;  5DEM A;  2QKX A;  2OEF A;  3KWD A;  1V67 A;  2OI5 A;  5AFU U;  4R36 A;  1HM0 A;  1KHR A;  4N6A A;  3ECT A;  5DG3 A;  3CJ8 A;  4IHH A;  4EAB A;  3R3I A;  4KPZ A;  1FWY A;  1HM9 A;  2CUY A;  2G2Y A;  2JFD A;  4KQL A;  2VD4 A;  2G1H A;  4N6B A;  2IUA A;  4M99 A;  2WLE A;  3PMO A;  1QRE A;  3C8V A;  2WLF A;  3HJJ A;  4EGG A;  2FKO A;  3IGJ A;  2Q4J A;  3I3A A;  3IXC A;  2JF3 A;  1SST A;  4ISX A;  1MR9 A;  4N27 A;  5AFU V;  5DEP A;  3VBP A;  3EZO A;  2WLD A;  3QAT A;  2W0W A;  4RL1 A;  3TZX A;  3VBK A;  4G87 A;  2XAT A;  5E3P A;  1G95 A;  1MR7 A;  4E75 A;  3D8V A;  2G2Z A;  3OUP A;  3TQE A;  3OTM A;  2OEG A;  2ICX A;  2ICY A;  2WLG A;  1T3D A;  3F1X A;  3FSX A;  4M2B A;  3SRT A;  3VBL A;  3FSC A;  4E1K A;  1MLA A;  3TZY A;  2H1Y A;  3R5D A;  3TZZ A;  2QIA A;  1SSM A;  2GGQ A;  2V0K A;  2JFK A;  1KK6 A;  1XAT A;  3R1W A;  4E79 A;  3R97 A;  2I5K A;  3P1B A;  4HUR A;  5ADX U;  3FSY A;  3OW5 A;  2GGO A;  3P47 A;  4QBU A;  4IHF A;  4KNX A;  4M28 A;  3I3X A;  3TDT A;  3DK5 A;  3KWC A;  5DZ7 A;  2RIJ A;  2WLC A;  3HSQ A;  3R5C A;  3VBI A;  3VNP A;  1KK5 A;  3TIO A;  4G3Q A;  4E6U A;  2V0J A;  2QJ3 A;  4M98 A;  3R0S A;  4MFG A;  4MZU A;  3T57 A;  3TV0 A;  1Z90 A;  4FCE A;  1V3W A;  4R7P A;  3TK8 A;  3ST8 A;  1YP3 A;  2V0L A;  3EEV A;  4HCQ A;  5F42 A;  1OCX A;  3R5A A;  5ADX V;  4KPX A;  5L6S A;  1YP4 A;  1QRF A;  3FOQ A;  4R37 A;  1KRR A;  4EQY A;  1G97 A;  1NM2 A;  3VBM A;  3MC4 A;  3GOS A;  1XHD A;  2NPO A;  1MRL A;  2OI7 A;  4J09 A;  2C2N A;  3MQG A;  3V4E A;  2IU9 A;  2V0H A;  4N69 A;  3FS8 A;  1LXA A;  1HV9 A;  2AQ9 A;  3EH0 A;  2QC3 A;  3Q1X A;  4EAA A;  4IHG A;  1KRU A;  1QRG A;  2OI6 A;  2TDT A;  3BRK X;  3BSY A;  4K6R A;  2VHE A;  5L6V A;  4HZC A;  3TZW A;  3K89 A;  1S80 A;  1KK4 A;  4MYO A;  4AA7 A;  4H7O A;  3NZ2 A;  2IU8 A;  3R8Y A;  3DHO A;  1TDT A;  3SPT A;  3GVD A;  1J2Z A;  5DZ6 A;  2IC7 A;  1QQ0 A;  2W0V A;  3OU9 A;  3VBJ A;  4AC3 A;  3IM9 A;  2P5Z X;  1QRM A;  1SSQ A;  4HZD A;  3TIS A;  3BSW A;  3BXY A;  3JQY A;  3VBN A;  3GUE A;  2G2O A;  3PTW A;  4EA9 A;  3OTZ A;  3EG4 A;  3DJ4 A;  4AAW A;  3D98 A;  4E6T A;  1FXJ A;  3G87 A;  2JF2 A;  2V0I A;  4M2A A;  3IM8 A;  1KGQ A;  4EA7 A;  3R3R A;  3BSS A;  3KWE A;  3FTT A;  4M9C A;  3H0P A;  1KRV A;  3FSB A;  4RR5 A;  4HUS A;  5E3Q A;  3FWW A;  2QIV X;  3RGI A;  3HJV A;  1QRL A;  3HHD A;  1KQA A;  1THJ A;  5U2K A;  5E3R A;  2P2O A;  3R2W A;  4EA8 A;  4G3S A;  3R5B A;  4KNR A;  4DCL A;  4G3P A;  3BFP A;  3SBM A;  1YP2 A;  3BV8 A;  1HM8 A;  4J18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...