3CJ8A

Crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
b'AMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransfe
publication title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 55
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3cj8A03
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3cj8A02
4.10.180.10 Few Secondary Structures Irregular Black beetle virus capsid protein Black beetle virus capsid protein 3cj8A01
4J09A 4G3PA 3BSSA 1QRMA 1V3WA 3I3AA 1NM2A 1KRRA 2RIJA 2IUAA 2V0HA 3DJ4A 3GOSA 3R5BA 2IU8A 4N27A 3VBNA 3T57A 2QJ3A 3VBKA 3P47A 4HZCA 4RR5A 1QREA 1MLAA 3OW5A 4AA7A 4IHGA 2GGQA 4IHHA 4H7OA 3EEVA 2ICYA 2NPOA 4KPXA 5AFUV 2I5KA 4N69A 4E6UA 1HM9A 4MZUA 3R5DA 4G3QA 5L6VA 1KRUA 1OCXA 2GGOA 4HZDA 1THJA 2OI5A 1KGQA 3GVDA 3EH0A 5E3PA 2QIVX 4EABA 4EGGA 1KHRA 1HM8A 3P1BA 3BXYA 3SRTA 5ADXV 3TZYA 3FSBA 1SSQA 3HJVA 2OI7A 4M99A 1XHDA 3HJJA 3SPTA 1G97A 3R3RA 3TK8A 2QC3A 1KRVA 2TDTA 4R7PA 3NZ2A 3VBLA 3HHDA 4AC3A 5L6SA 1KK5A 2Q4JA 3R2WA 3TISA 3FOQA 4IHFA 2WLGA 3BSYA 3EZOA 3I3XA 4ISXA 4E79A 1KQAA 3TQEA 2ICXA 4R37A 3OU9A 2VD4A 3BRKX 2XATA 3FTTA 3R5CA 3BSWA 4FCEA 4MYOA 4EA7A 4RL1A 1QQ0A 3EG4A 1XATA 1KK4A 2OEFA 2WLCA 3FSCA 3IGJA 3QATA 1YP3A 2QKXA 1LXAA 2P2OA 3DK5A 2IU9A 3KWCA 4G3SA 3MQHA 1T3DA 3IM8A 2V0KA 2W0VA 3FSYA 4K6RA 2WLEA 4M2BA 2W0WA 2V0LA 3R0SA 1HM0A 2QIAA 3R8YA 2V0IA 3H0PA 4G87A 1TDTA 2JFDA 4HUSA 5DEPA 3TZWA 4KQLA 4KPZA 2H1YA 5DZ7A 2IC7A 3V4EA 3R3IA 5U2KA 1FWYA 2JF2A 3JQYA 3D8VA 1YP4A 2G1HA 3IXCA 1V67A 3HSQA 1MR7A 3CJ8A 4N6BA 4EAAA 3GUEA 3FWWA 3OTZA 2JF3A 4KNXA 4E75A 2JFKA 3G87A 4HCQA 3KWDA 2G2ZA 3BFPA 2OEGA 1FXJA 3TDTA 4MFGA 2AQ9A 3SBMA 3OTMA 3PTWA 3RGIA 3FS8A 4M98A 5E3RA 2P5ZX 5AFUU 2CUYA 1Z90A 4J18A 3K89A 3IM9A 3VNPA 1MRLA 4QBUA 4M2AA 3TIOA 3VBIA 3D98A 3VBJA 5ADXU 3TZXA 2V0JA 3MC4A 4E1KA 5DZ6A 2WLDA 2FKOA 3KWEA 3MQGA 3ST8A 3TV0A 4E6TA 3Q1XA 2C2NA 1G95A 4AAWA 1KGTA 1QRGA 3VBMA 4DCLA 4KNRA 3R1WA 2G2OA 1S80A 5E3QA 4R36A 1MR9A 5F42A 4N6AA 3FSXA 1HV9A 3R5AA 4M9CA 4M28A 1SSTA 5DG3A 1J2ZA 3VBPA 3OUPA 1QRFA 4HURA 4EA8A 3R97A 1KK6A 3F1XA 4EA9A 3BV8A 5DEMA 2G2YA 2WLFA 2OI6A 3TWDA 3PMOA 3DHOA 1QRLA 3TZZA 1YP2A 3C8VA 3ECTA 4EQYA 2VHEA 1SSMA
chains in the Genus database with same CATH superfamily
1Q4RA 2R7OA 4LF5J 4K4TA 1ZAWA 5ETOA 4OHYA 4BCAA 4GKJJ 3R5DA 1X4CA 5CZXA 1XMQJ 3BXYA 3ISND 3H5UA 5AXNA 3HSZA 3EVMA 3PKYA 4LF2A 5HMZA 2ZVIA 4ISXA 1W2IA 4M5NA 3FVYA 2J5AA 2MQOA 1RWWB 4OV6A 4ICLA 5KFVA 1JLFB 5GAHU 5I4MA 3BBFA 5C24A 2V2KA 1CS4A 3M4XA 2RSQA 5D0EA 2XCPA 2W7AA 2HPUA 5LXRA 1V67A 3QGIA 5I42B 2CG4A 1T05A 3TAQA 2LXUA 2GVDB 2EK1A 2I1RA 3IG1B 1OYDA 2HWHA 4O3NA 2KM8C 2KXHA 3KLHB 2J76E 2IC3B 3OLAA 2AZ3A 3TWDA 1TL4A 4DV3J 2CPEA 4Q2LA 3CCUS 2HNDA 4ZLPA 4ZVRB 2HBQB 4AA7A 3CD7A 1FJ7A 3I0SA 3KLGB 5KFTA 3QT5A 3QFWA 4C98A 2JX2A 4CO1A 3QRRA 1MN7A 3MEKA 3R5GA 1PAEX 1G2EA 2PI5A 4DL0C 1FEEA 4RW7B 2DB1A 3GTYX 4MT1A 4NXMJ 1TK5A 1S6PB 4OZ3A 1RXOB 4RUCA 2UV8G 4C8KA 3MR3A 2HVDA 2B9WA 2BOAA 5IXUA 2DTJA 5E3AA 3T3FA 1HI1A 3D6MB 3RRHA 1FRLA 2DITA 1LW0A 2FLLA 2IJFA 4YFUA 3NBPB 2BACA 3I31A 1K1SA 4ETXA 3R27A 3JYTB 3ZZPA 4CH7A 2BRLA 4F0HA 3IC1A 1XJWB 3EGNA 1NJYA 3OR2B 1VBYA 3VAKA 1TK0A 3PDNA 2FLPA 2ZH3A 2IY5B 4DI6A 1HNXJ 3BSSA 3EXYA 2QA2A 4ES3A 1WG1A 1S99A 4X64F 4F4XA 4IRKA 2NXNA 3DI6A 1ZS6A 1HM9A 4I67A 4IKAA 3CDAA 3GVDA 3NS5A 2PI4A 2X1GA 2FDNA 4MKYA 3E2EA 1U0SA 4M99A 2HFSA 3HM9A 5D0RA 5KFGA 4IFYB 5KFFA 4KO0A 3HO1A 3H4BA 1NB7A 3N79A 2E5IA 3A12A 1JNZB 1LXAA 1SL0A 4MJKA 3LALA 3HX9A 4KH0B 1M1HA 3WC2A 2MZTA 3HFVA 1A6LA 2UXDF 5ETMA 2QMUB 1DTTB 4ZKAA 2MKKA 1HWIA 3BFPA 5J2PA 3W7BA 1VLOA 3TO8A 2ZH2A 1JKHB 2A6OA 4NPOA 1ZETA 3QRQA 2FKOA 3CDWA 4UW2A 5IM0A 4ENOA 4ZP6A 3OD2A 4XO0A 2B9EA 1PC5A 1PAUB 5D3GA 3THTA 4ANDA 1U0HA 3PNIA 2Y1IA 2Q1LA 2X1FA 1RCOB 3Q0AA 4HZCA 4K5SA 1QREA 2XSJA 4NA2A 5A8WA 4K4ZA 4LREA 4U8VA 3M32A 1HNWJ 2YH1A 2HURA 2PT0A 2K1RA 2VFSA 1KR4A 1JWWA 1XNQF 4F3MA 1I3OB 1X9MA 4B3TJ 2YNIA 3BH7B 4JI7F 4NLVA 2HS4A 2POKA 1HHQA 4C3LA 3J7YI 2FZKB 3MFHA 2GVZA 1TKDA 4CYUA 4B3MF 1UVIA 4R5PA 3NAHA 1P27B 3KWMA 4ED5A 1RU1A 1W2BR 5J2MA 4DG1A 1OQ6A 4CLWA 2MGZB 3BPDA 3OTDA 4E0DA 1FCAA 4B9VA 4OX8A 3DFEA 2NYHA 2D74B 2XY7A 3NMRA 1HWUA 2VIHA 3D0HE 2A1BA 5KFLA 3A8JA 3PCOB 4LFAJ 5E3QA 1S12A 2YNHB 4HHHA 4ERDA 2IM3A 2HBRB 2QO3A 4HVZA 1VQ6S 3OL8A 2DNQA 2IU8A 2M4MA 2XYHB 2XLJA 4DF8A 3L9ZA 3UR3C 3EEVA 5RUBA 1MNEA 1S6PA 3AT1B 4KPCA 2XHCA 4OI2A 3BGFA 1T9UA 5C25B 1WG4A 2XMJA 1L5UA 3POTB 4NCBA 2J0XA 3KHLA 3JTOA 4PG5A 1TU0B 1RADB 1RHUB 4YDDB 3SYZA 5LSOA 1K47A 2ASJA 3RTVA 2DIVA 4ED1A 3D7SB 2HBZB 3CO9A 2RRBA 3SIPB 1EKRA 2XO6A 2VFTA 1R0AA 3JB9k 2LYVA 1KVKA 1Y4ZB 3TVKA 1SC4B 3PIPQ 4KV8A 4J18A 4M5GA 3KHHA 4O0NA 3M9OB 5L1IA 3KDOA 4K7QA 3MURP 3LWMA 3R2DJ 2J9DE 4RPFA 3QYYA 3NXZA 3MTKA 4PG7A 4S0MA 2R7TA 4DCPB 2FHOB 5H9FJ 2V0HA 4P52A 5IWAF 1AXQA 3HJFA 1N6QA 3AD8C 4F2SA 2HK2A 1PBUA 3BSAA 2WVBA 2I5JA 2JVOA 1KGQA 3J80U 1KHRA 3GP9A 1HBMA 2GNKA 3C46A 3HKZD 2DGOA 1VFJA 2HRYA 4FN5A 1RAOA 4MKVA 2M70A 4I6YA 1BQXA 4OMFG 1GNKA 2J9CA 2HFZA 5GMEA 3UCZP 3VZHA 3DRXA 3CD0A 3E01B 2H5JB 4QW9A 3IXQA 4I2PB 4B9MA 4DBQA 4LBHA 4QPXA 5B7WA 1CEZA 5BR8J 5HBMB 1FWYA 3CC2S 2AW0A 3P5TL 4ZOSA 1KP6A 1S6QA 1AB8A 1EHWA 3PR4A 2EG1A 4ECTA 3W1YC 1APSA 4BC9A 2K8GA 1OS5A 2V9WA 2GZOA 3DDNA 1NZ8A 4CWBA 3FEZA 4LQ9A 3LF0A 2WSCC 4PG6A 2F9JA 3C8VA 4RJVA 1YJTA 4PQAA 3DXBA 3FFIA 4CT9A 5E7OB 1HD1A 4TYAA 5DDQC 2WRMA 1OQ3A 5ETLA 1IBCB 4ECYA 5A0YB 4A8XA 5GAGU 2HQCA 1IBMJ 2HZCA 4B9NA 3OUYB 2HNYA 3QO9B 1BHNA 3DOLA 4K5RA 1R3NA 3CJ5A 2J8AA 3CF5Q 3HT0A 5AJ3J 3BS9A 3HP6A 2CVIA 4PABA 2COLA 4TU8A 1S0VA 4XPCA 1GMWA 3OH2A 3D5MA 5KFYA 4A8QA 4ZVFA 5C42B 1UVNA 1KBRA 4DR3J 3J81U 2CPIA 3RB6A 4N6BA 3KHGA 3BO2A 1JJ2R 1N48A 1UJ5A 3B6BA 2QFIA 3RBXA 3TOQA 4FP9A 4I0WA 4Z7CA 3PO4A 3MEEB 4HHUA 2U2FA 1URNA 1AW0A 1JXVA 5LMUJ 4OHVA 4ZCLA 1HHSA 2XBPA 1SKSA 3DU5A 5KFZA 1CJTA 1NSQA 4DXLA 2AP6A 3B4DA 3BF4A 2DXEA 2GO8A 3OFHA 4UOGA 2HWTA 2KVIA 3LP1B 2VJUA 2UUBJ 2FHKA 4YDXA 2GGOA 4O4GA 3MOJB 1N5YB 4RW8B 5CQGA 2MLXA 4U95A 4MK8A 4WE1B 2ZKUA 3GCWP 1UJ6A 4B3SJ 1F60B 1FKAF 1NUEA 1JLBA 3DYAB 1GH8A 4R37A 1S97A 3EMTA 3H25A 1QQ0A 3FRZA 4PQUB 4QOTA 5HO4A 1S76D 3RB0A 2CXEA 3S1TA 3VAHA 1VK8A 3TUIC 1NH8A 3OSNA 2Z30B 3ZTRA 3M1VA 3D8VA 2NREA 1IR2A 3K5LA 3DDKA 3AOCA 2XEXA 3JXOA 5ADZA 5E3RA 2LECA 2KZZA 4KGKA 2XI2A 4EZ9A 1UVLA 1RBOB 5DG9A 4JV1A 2KJVA 4YB6A 3AXKA 1UFWA 4I6AA 2OKQA 4WK1A 2CJQA 2UUAF 2BJ9A 3QSYB 1YJNS 3VAGA 5KFSA 5J2NB 4Y0FA 4FF2A 1NBEB 3G8SA 4FVCA 5MLCV 3DHWC 4G3QA 2PN6A 2H9ZA 3EX7B 1HQEB 2BYCA 1FEHA 1S7IA 2E7VA 3PJ9A 1C4AA 2AEMA 4QR2A 4ZVTB 2WW4A 3M8PA 1HQUB 2JWNA 1Y5LB 2E7WA 1CQNA 4PWDA 4HH0A 1TL1A 3NGDA 3LQVA 4NYZA 4DZDA 1Q8KA 2QSWA 4I69A 4CP5A 3J7Z5 1FJEB 2O3DA 4OYPA 4TU7A 1ZTTA 5KFKA 1IJEB 2CJXB 3R8YA 2DNOA 1RLDA 3CJTA 3ILIA 1FTRA 2EFNA 3GG0A 1CG2A 3JQYA 5A6WA 3IXCA 3TX0A 4JI6F 2J7WA 3D9BA 5ETTA 2JFKA 2XNRA 1Q78A 1VK3A 3DRYA 1D8ZA 1YJRA 3S8SA 3BDEA 2RF2B 2VG6A 5BYQA 2Z57B 4ZPWR 3NWRA 1SJ1A 4E1KA 2ADBA 1DLOB 3VCDA 4ZP7A 3T1YJ 5SUHA 3GYGA 2ROEA 2EFVA 2MKHA 3N28A 5D4OA 2DVIA 3LO3A 1MG7A 5D0HA 3DC2A 2R2RA 1NK6A 1FRXA 1B7YB 3BN4A 3RB4A 1TVRA 1FE4A 3TJ9A 2CJAA 3RZAA 4NI2A 1KRPA 1MU2A 1N0VC 3AA8A 5G0RA 2K3KA 2HGNA 1SKRA 2JEGA 4G6VB 4BC7A 1RK8A 2PD1A 3TK8A 2C3OA 1HMVA 5FJ4A 4ECXA 1XTZA 4X64J 2ZWPA 1JLCB 2V4RA 1Q53A 3R5JB 4DR5F 1WI6A 3V6DB 2LQ8A 1RTIB 4K59A 3PM9A 1G3OA 5CCMA 5A8KB 5U47A 2R8KA 5CZVA 2J0QD 4Q0BA 5LXYA 2AX1A 1D9AA 5EN1A 2V8PA 3C6UA 3QAEA 4WFXA 2QZ8A 3ULHA 1CVJA 4G1QB 4YY3J 5CA5A 2XLIA 4DSKA 1GMVA 2DR9A 4EBEA 2KKHA 2UXDJ 1RB0A 1S5ZA 1YJVA 3IR5B 3OR1B 2PO4A 2NLWA 4RU9A 1QVFR 2RQ4A 1VIXA 3Q8YA 4X4NA 1R0CB 4J9NA 2B6AB 2B8PA 3DHXA 1CQMA 1LW2A 3QWPA 5B0AA 3BPSP 1NM2A 4FVMA 4WXWA 4ZP8A 2GX8A 1BQMB 4DPWA 5HVHA 3Q89A 4ZS6A 1VDHA 3QIPA 2R8JA 3NZ2A 4CO5A 4WFBQ 3FEXB 3D3BJ 3VQSA 1KTVA 2YWEA 3K8VA 4GVLA 2XZTB 3ILJA 4GC6A 4RL1A 4O3QA 2QMXA 5F9NA 1C1CB 3TA2A 4WP9A 4RBTA 3K5OA 2JLFA 4AE5A 1T3DA 4ILMA 2CQPA 3K5PA 1Y0HA 5DQGA 3DRSA 1XNQJ 2R8IA 4X2BA 2PC6A 1OYEA 3ZZOA 1I94J 4JI7J 4TLQA 5DDRC 2J6SA 2ZH4A 1IKWA 5KFHA 1Y3JA 3TRGA 3M8RA 1J5EF 4DSJA 5C2GA 5KT6A 2IAJA 4B3MJ 4DV0F 3NGRA 1EKSA 3CDEA 1SUQA 2QRRA 3R5AA 4OLPA 2V94A 2O5DA 4EFAC 2AT1B 1QRLA 5KAKA 4IRDA 1S57A 5EX0A 3MMAB 4A8KA 1HQUA 1UEUA 4FZVA 4ZVOB 1RTHB 1SJQA 1VBZA 4DS5A 4USUA 1RT1A 1I5OB 4JYAF 4F26A 1JLQA 3SCJE 4OYAA 4PG8A 2LCWA 4O44A 5B0GA 4M94A 1KHVA 4DR2J 4DPYA 1MN9A 4WTOB 2QG9B 2QL7B 5HMWA 4M5HA 3OH4A 2HHVA 4EA7A 3V81A 2XMAA 2R4FA 1KLMB 3IGJA 2WLCA 4L3KA 1K73T 4ELTA 4C11A 1U1NA 3MQHA 4HI1A 1IQZA 1FNOA 4MKAA 2A6MA 4OYXA 3RYLA 2RHSB 4QIVA 5F8JA 1T03B 1LV5A 4GO7X 5K5MA 1LWFA 2HS0A 5HP1B 3MD1A 4USMA 2NPFA 4PXBA 3ZZTA 3N5BA 1N88A 2ZNZA 3AJ1A 3MOZA 3A3OB 3KFWX 2R8GA 2HEKA 1P1LA 4KT0C 3Q2SC 3U27A 4OX9J 1VRTB 4OZ1A 3QPIA 5D78A 4CRJA 4MTPA 4I7FB 3FUYA 3ETMA 4FYWB 1B70B 3EM1A 2CKWA 1JLCA 2EKNA 4XTTA 4AUKA 2OSRA 5HQLA 3MR5A 1QLNA 3SRTA 3NOCA 4XDDA 4RNMA 1ZA2B 2JHEA 1RCXB 5IWAJ 4DU7A 2Y8YA 1VJQA 3OQ2A 2DGSA 3PZPA 1IKYA 5JMNA 2YKOA 2N7YA 2KTQA 3UNGC 1KC8T 3LA0A 2VZ9A 4ELVA 1SVDA 2XS5A 2HMIB 4LFCF 3GV5B 2D3OR 2Y0SD 1RUSA 4OZNA 2HGLA 2VB6A 3NLCA 3L7UA 4OLOA 3M05A 2CZ4A 4EK2A 3VZIA 1DQAA 4USKA 4OJHA 1T7PA 2GMLA 2CJBA 1GEHA 3MAAA 4WKYA 3VV2B 3DOKA 2EPIA 3GFHA 4K4WA 3VBIA 3MPDA 1EETB 4ID5B 4TN2A 4I2QA 4B3RF 3LGNA 3BSCA 2CJKA 5L9XA 2ZUAA 2VOPA 2L41A 2XSFA 3QIDA 2VBXA 5C2CA 4FF3A 3RAQA 2PMWA 3H59A 3CB4A 2FY1A 2IM0A 4ZPBA 2QX0A 2XG8A 2AGQA 1X9SA 1NXIA 3KLIA 1FDBA 1QTMA 2XQCA 1W26A 4X4RA 1NHUA 3FOQA 3MWBA 3KLEB 1IWGA 1UW9A 2XHWA 5BXIA 2GAHC 3FSCA 3E3XA 4G3SA 1C4CA 2W0VA 2R3VA 2ZEJA 2RAQA 3I5BA 4B3OB 2A18A 3CUNA 1U26A 1Y7PA 5KG6A 1AUSL 1RHQB 2JC1A 2OEKA 4LSNA 1VC6A 3AHPA 3H5SA 1F2HA 3Q22A 2ZJRQ 2N3LA 3VTIA 3FKBA 4HR2A 4K4UA 1QUPA 3MR6A 3OLBA 2BE2A 1OSDA 3Q83A 1JJHA 3OUPA 2F8HA 4B08A 1REVA 5DGAA 3OL9A 2Z2ZA 4LR7A 2XI3A 2KT3A 3NS7B 2E9RX 5K14A 4BS2A 2KRRA 2IRUA 4DR7F 1RTDB 4P72A 2ZH7A 3IRXA 4HL9A 5DQIA 3R2CJ 1VI7A 3UDCA 4FS1A 1FWKA 1KRVA 1FESA 2G0CA 4LBIA 1T8EA 3BM7A 1IWAA 2Z2YB 5J1EB 4M95A 3LH2S 2L9WA 2MPUA 3K8WA 1TMMA 2R7RA 4KFBB 2CVEA 2FJEB 3MXHP 5K9FA 1SH2A 4ED4A 2ATLA 1MMLA 2B7BB 4YB7A 1MWQA 3CCZA 1FX2A 2E5HA 3W2VB 4AL6A 2ZJPQ 3HI9A 4UQTA 4ZVGA 2V6AA 4ALZA 1CJUB 1HNZF 2UP1A 4PPDA 3H4DA 3FQKA 4UT4A 3VAIA 4QU7A 1SSTA 1J2ZA 2XCAA 3SQOP 1IBKF 3E51A 1ZH5A 4FYDA 4ZLJA 4ED6A 1JNRB 3ET6B 2R7XA 2PFDA 1YLXA 5F41A 5ITHA 4E98A 1OCXA 3W5YA 2IDEA 1QVGR 2GJIA 3PX4A 2WB4A 2LXFA 2AYGA 3KK3A 4FYYB 2IM2A 2DCUB 4JV2A 2XMWA 3Q8QB 2UUTA 1NCLA 2BR0A 2HFOA 1T02A 2YNFB 1N54B 1VQ4S 4ID8A 2E1AA 4XAKA 3S6EA 3NEKA 4DSLA 4IR9A 1BQNA 2OPQB 3GIJA 1WC3A 3KYLA 3DLLQ 2ZM6F 2V5HG 1RQ0A 1Z4UA 3CMAS 1GMUA 3CNQP 3JSBA 2ROPA 4ED2A 1O51A 5HVGA 2DO0A 3CCVS 4N76A 3US5A 4JI6J 3WX4A 4X4SA 3QZ7A 3OFFA 2M0GB 1SC3B 3VBKA 1Z2FA 2RH3A 4DUTA 3WDOA 2BBEA 4Y2KA 5KOWA 3R7BB 1FKPB 2YKMB 3ZTSA 4OHZA 2R9LA 4HTIA 2ZH8A 2V2ZA 1TL3A 3FCWA 3TQEA 4DX6A 3HVTB 3HCXA 2YH0A 4A8FA 3CCTA 1CPZA 4LF1A 1X5TA 2C2MB 1IVZA 2MKIA 5G4DA 4DR5J 4L76A 4DJBA 5KG4A 1TL7A 1JLGB 2GHWA 2C28A 1YGYA 2B0GA 1YZ6A 3M8ZA 2DNRA 2IVMA 5HAOA 3BH6B 2BJEA 2E44A 1BWVA 5CHCB 1F3FA 1VQYA 4WU2A 3E8OA 3ZZ0A 4DU8A 4PWWA 3N4WA 4ZPTR 2IUAA 2RE1A 1U1KA 3IP0A 4DV6J 4L72B 1IR1A 2CPFA 1C0UA 2HG4A 5M2UA 3QLHA 1RT7A 3HHNB 3A8EA 1TUVA 5M2RA 1U6ZA 1SXLA 2KN4A 5L6SA 4LJMA 1YKWA 3FDSA 3DRPA 3M2RB 4O3OA 3UO0A 3D54A 3RG6A 2MDAA 1NEEA 3FBCA 1BE4A 3ZNJ1 1LWEB 3NP5A 3I0RA 4Y2CA 2G4BA 3CCJS 2HNZA 1CULA 3MZIA 2DPIA 4XK8C 1S6OA 2FGOA 2QLJB 2BZ2A 4IG3A 1VRQC 4A47A 4LF7F 2LQ9A 2CUYA 3IS9B 1IN0A 3WBZA 3AJDA 5EWEA 3LP0A 1HPZA 4N7TA 4N6AA 1H3DA 3KXDA 3QMQA 1MMNA 1PJ5A 1S1UA 3KJQB 3MPYA 2BQRA 1N36J 3Q2TC 2OD6A 1J5EJ 2I0XA 2MZQA 3R5BA 2HFUA 1WD6A 1N4LA 4AL5A 1GAOA 1BUXA 1ZYQA 4AD6A 2DNGA 2CDRB 3M2VB 2GCFA 3GIRA 2GQCA 5HMYA 3CJSA 1SSQA 2DNPA 4CLTA 2B5JB 4U67Q 4WFNQ 1VC5A 1RTJB 3DKDA 2WSFC 3ENWA 1WEZA 1WF0A 1KHWA 2WLGA 3W61A 1QE1A 3I9V9 3WC0A 3IRWP 3M8QB 5E2QA 4MYOA 1EZZB 3CD5A 1AFIA 2H5EA 1WOOA 4H4MA 4ZDNA 2DNKA 5HLFB 3CVKA 1REGX 1JIHA 3J7YU 4FYVB 1H2VZ 2J9EA 4OI3A 3I56S 3V4IB 1RT6B 1WC0A 5JVHQ 3SBMA 3HZEA 3OW2R 1FI4A 3HULA 4QWDA 1NK7A 1Q8LA 2HVIA 4ZVEA 2V63A 1FVQA 4ZCKA 4HURA 4DSEA 2VDIA 2IFXA 5KFCA 4CTAB 2RKIB 3LWLA 4C4WA 3SFGA 1N33F 2FTRA 2GIFA 1U1LA 5CYMB 1MW7A 1KFSA 2R42A 2JEFA 3FZBA 4U96A 3DMJB 5HQMA 2KRBA 3TVZA 2RILA 2B9XA 1NJXA 5IT9U 2H65B 1PSDA 1VLYA 4ER8A 4K0KF 5D8HB 3SV3A 2D69A 1V3ZA 4FF1A 3M8SA 2XYGB 2B9YA 3M6XA 1RJJA 4LF5F 3NG8A 4C8LA 1KNZA 1IKVB 1RHKB 3PX0A 1VQNS 4GKJF 2ZZTA 5EGYA 4E75A 1VQKS 4EBDA 4O4RA 2AQ9A 3MDFA 3OTMA 3W5XA 2W24A 2P5ZX 2VFVA 3MM8A 3KUGA 4Y2AA 4LFCJ 2WVDA 2GHVC 1RWMB 4FKYA 1CJVA 3GLJA 3EUNA 3JSMA 3ST8A 3AOAA 2DGTA 2EFPA 3WQPA 3OHAA 3AH6A 2PE8A 5CH7B 3ZTQA 2U1AA 5JVGQ 2FVQA 4DCOB 1ZM9A 4YP3A 4E2FB 4RW4A 4N56A 2X1AA 2RRNA 5EWFA 4V19J 4MK9A 2YY3A 1F2GA 2L48A 4F3QA 4RR5A 3R9LA 1U25A 4B3RJ 4GVBB 4YUDA 1QAIA 3CCES 1AFJA 3GQ9A 3PW0A 5K8MA 3QNWB 3O1LA 1Y10A 3TAPA 2B43A 4A46A 2QLBB 5FIIA 1FTCA 4F4KA 1WDDA 2VPYB 2W7PA 5J2QA 1AROP 4ETZA 4USTA 4DV3F 2XB2D 2QN6B 3FSYA 1EARA 5HN0A 2ALYB 3WHIA 1ULRA 1YDLA 2Z4PA 5F8NA 1O5JA 4NMXA 1S9GB 3C8YA 3T19A 2GAGC 1KQSR 3KUEA 2F9DA 4PYAA 3C15A 4M2AA 3TIOA 3DRRB 3TV0A 3ELHA 4LSLB 3QT8A 4NXMF 3VBPA 2WAQD 4ZHRA 2YKNA 2L08A 2OFHX 2GW8A 2P9CA 1HBUB 2W9CA 5A8RB 2EBEA 4DL7A 3CMQA 2PMHA 4YR3A 2ICYA 1S1TB 2C3YA 1YBUA 1LEOA 3NCPA 1H38A 4OYZA 3UD5A 3CXCR 4LVNP 2AJFE 3LANA 1UVMA 4J91A 1M5OC 5H9FK 2Z58B 3MEGB 5ETVA 3SFUA 2RVJA 1FJGF 3VWSA 4OL8A 3C3LA 1HNXF 4QIFA 2H48B 3AA9A 4QU6A 5DG8A 4DV4J 4ZN1A 1HLWA 4HLBA 2GJ2A 3MPWA 2ZKTA 4WJBA 2BRKA 2VG5B 2OIHA 3HD1A 4U7CA 3GYXB 2I6WA 1CLFA 5KFUA 5DQHA 5L1LA 3BSNA 2MKJA 1JLAA 1SQEA 3QSIA 4JP8A 4NLUA 2CQ4A 3G82A 5KT3A 2FHMA 5IOLA 1OY9A 2N4DA 2OO4A 1WHXA 1B0TA 5F8MA 1UP1A 2CPJA 4NZ0A 2Q66A 5IC6B 1NDPA 1U6BA 2XM3A 3EJMA 3ENQA 4DEZA 1I6JA 4F0KA 1UKUA 1HNZJ 4DLEA 2NPOA 4E6UA 3CJRA 3MM6B 3ZFVA 3P1BA 3K5MA 3IN5A 2WVFA 3ILOA 5IFMA 1EX8A 4C2MA 3M9NB 1NK8A 3UNYA 3KLFB 2ZD1B 4DL2A 2KH9A 3PVXA 2WZ1A 4MKBA 2LDIA 3W64A 1NPPA 4NWBA 1DTQA 3GJTB 4HUSA 4LMZA 2JOQA 1V3SA 2DHSA 3R3IA 4D3GA 1X9WA 4EYIB 2DJWA 3I5CA 1SJ3P 4H4OA 3JSRA 1YIJS 3LAKA 4ZLNA 3B82A 3T41A 1RWOB 2YNGA 4B3TF 4DX7A 4V19X 2J7KA 4IH5A 1NKCA 1SV5B 4Y2IA 4F0MA 2BQUA 1YJWS 2J9DA 2BE9B 3BGLA 1RU2A 4KKOA 2MKSA 2BABA 2I8EA 3DLHA 2CFXA 3N5FA 4OZ0A 3GJSB 3K2YA 4O0IA 3I87A 3D0IE 4R8UB 2RD5C 3V6HA 4YQWA 2GMJA 1A7GE 4X4QA 1HFEL 3O3LA 3CJ0A 1HQ2A 5LM7E 3WX8A 2VPXB 2ZE2A 4LFAF 2RUGA 3CIZA 2PA3A 4OZ2A 3MF5A 4MMOA 1RABB 3IMQJ 2JC0A 1RAFB 4B02A 1E6VB 3UCUP 2BJ3A 2CNOB 3I82A 3UN2A 5FDLA 3C6TA 2RQMA 1KS2A 3G6VA 2QL5B 1FNMA 1K9MT 2BJ1A 1FFGB 3M6VA 3C19A 1DJ0A 3K5NA 4UUXA 5GMDA 3KK1A 2PSZA 2ZWOA 4H54A 1WEYA 2O67A 1QRGA 2KFNA 2HQIA 3OVSA 1BXNA 2WOMA 4JB8B 3DLBA 2B4OA 3EGWB 1IKXA 3BGOP 3W2WA 1URRA 1LFPA 4FXVA 4XDCA 1SH3A 3RBZA 2K06A 3D4JA 2BJ8A 4ES1A 1X8DA 4C97A 6FD1A 4CLPA 1KDNA 1I1GA 3W60A 5ETKA 2VQFF 3UVJA 3PKMA 2W9AA 4PUOA 3AQOA 4IHFA 2AJ4A 2MQ8A 3FTTA 3GR0A 1TKXA 2GGPA 4Y6IA 4ICLB 2ATCB 2P2OA 3OTOJ 5C24B 1CS4B 1TDTA 4OI4A 1SIWB 2Y1JA 4Z37A 4DL4A 1WSRA 4USVA 4EAAA 4FNHA 1T05B 1NDKA 3QWUA 1NLKL 4CIOA 3SI8A 4NL5A 2OPSA 3OHBA 4UOFA 3Q8VA 1VMBA 4L75A 5B08A 1FXLA 3RW7A 3PYEA 4LF7J 2KT5A 1YBTA 4X84A 4J09A 2BANA 3RJMB 2HNDB 1IM4A 3OTCA 5BR8F 1WEXA 3I0SB 2G0IA 4EABA 4WTYA 4QYZK 1LK5A 4IG0A 3RAMA 3TA1A 1LWCA 3SCIE 3UN3A 3AJ2A 1HA1A 3BSWA 4RW6A 1B0PA 1FXDA 1UVKA 3MM9A 1OMSA 1K0TA 2VKRA 1HM0A 2QIAA 2W8KA 1S0MA 1HBOA 4F4YA 1NKEA 3A8KA 5FLXY 1LW0B 4KSEB 3IWLA 4C8NA 4J9VA 2C3MA 2ALZA 1FT8A 4CO2A 1BY9A 4QBUA 4I6WA 1WORA 4X62F 1D1UA 3TUZC 4IYQA 1FO1A 2ZHAA 1VR6A 2B56A 3H90A 1TAUA 3QT6A 1U8SA 1WC6A 5IC4B 2Z0GA 4J9SA 2MHEA 3F0NA 1UPPA 2KB2A 2W01A 3RRKA 1HYSA 3D2WA 4C8MA 4DR3F 4PPZA 5L46A 3BEGB 3DI6B 1THJA 2OEMA 5ETNA 1PYSB 4FBTA 3T1HJ 4DR1J 1KQGB 2JJ4D 1N33J 2CPZA 3PR5B 3R2WA 1X5OA 4KO0B 1S1XA 3BRKX 3SDEA 3CWJA 2NXCA 2E5JA 1HI8A 4IFVA 2V0LA 2DHAA 4TKTA 2VPWB 3PJWA 3VGSA 4K0KJ 1U1PA 1PCAA 2K7KA 4Y65A 3MM5A 5F3ZA 2HAFA 2FZGB 2I2YA 1U1OA 1BMQB 1WOSA 5J2PB 5IS2A 5IV4A 3M6UA 1SKWA 2OAUA 4B3SF 2WLDA 2G2OA 1V5IB 3P8BB 2G0JA 5IM0B 4OQJA 3BV8A 3TX8A 3QGGA 5D3GB 2HIYA 1F3VA 1U0HB 2ZHOA 1P9YA 3RAXA 1WHVA 1FFSB 1BLUA 1VQ5S 3GFYA 4NZ7A 4F04B 2R2TA 2XSJB 5A8WB 2W2OP 5L6VA 1HKAA 1FXRA 3M32B 2V8GA 1Q95G 2CPXA 1TR0A 4CO0A 3R7SB 4DL6A 4QJVA 3L95X 3QGPA 2JLEA 1NRKA 1RT5A 1KTQA 2K1RB 2W9BA 3AXMA 4NEYA 1Z1ZA 3V4MA 2YNIB 2ZVSA 3NGKA 3T6BA 2R2UA 4FXWA 2ROGA 4X4PA 3EZUA 2W2NP 4UF4A 3HHKA 2VPZB 2QYCA 1YI2S 1RT2A 2FVPA 4DF4A 4CT8A 1SI9A 4RUAA 3BB5A 2GVZB 2C2RA 4IO1A 3KKFA 3SCLE 4CYUB 3DLGA 4R5PB 2WHOA 5J2MB 2OEGA 4DG1B 1ZZFA 2UVRA 2DIUA 2YQ1A 3H2LA 2V4JA 4FBUA 2XC9A 1S1VA 4B9LA 2VHGA 3D66A 1C1BA 4ZPCA 2YPYA 1FJCA 2HKEA 1C0TA 2OMLA 4WFAQ 2V34A 4NCAA 1OWXA 2AYMA 4LF6F 3FBFA 2FUG9 2NZ4A 1UZHA 1LWXA 5KG1A 3C16A 3VAJA 1RAIB 3HJJA 2RDJA 5CYJA 2F5GA 2FC8A 1FE0A 4PEOA 1HR0J 3T1YF 4CNZA 2BUNA 1YG0A 4M8LA 2BM0A 2F8MA 3G8TA 3KJNB 3VGUA 1B99A 1GXTA 5B0BA 3PV8A 3T5HA 2KL8A 2WLEA 1ZZNA 5LSLA 3GG1A 5D0GA 3DLEA 3SEOA 3BR9A 3ISNC 3K7RA 3TZWA 4MIWA 1PIEA 1VQOS 1R0AB 2DBBA 5T7LA 4CH0S 1FJGJ 3PRVA 3FBEA 2LDYA 4F2RA 2NSCA 2DHXA 4JI2J 4C7QA 3X1LB 3K89A 4RNNA 3VNPA 4HT7A 4KV8B 3MCMA 3BQ0A 3VBJA 4IH6A 1VQ8S 2YQ0A 2FYXA 3G2XA 1ZAXA 2CNNB 2AWZA 1T9XA 1B4SA 4WZQA 1YP2A 2H4YB 4DR4J 4KJIA 4WU3A 3UD4P 3N6NA 1N6QB 3PW2A 4CQ1A 2I5JB 3EDQB 1VHFA 4YY3F 3LPEA 1HBMB 3U02A 3ZXWA 3MCOA 2H4WB 2QC3A 3EPGA 4ECSA 3G6XA 5ETPA 1U1RA 1P8GA 5KFAA 2F8EX 2XATA 3RUBL 5ETRA 4DFPA 1JQGA 5KFIA 2V0KA 3OXGA 4C8YA 3BGRA 2HHUA 2FPHX 4M63A 2LA6A 2XWYA 1EQMA 2F1FA 2GO9A 4P7TA 1SB6A 3AY0A 1S6QB 2QA4G 3KK2A 2GA7A 5GVQA 4MFBA 4EEYA 3DLJA 1YJ7A 3SUCA 2HLUA 2Y3YA 1S80A 2ZBRA 1HARA 3UN5A 2IJNA 3VGTA 4HDGA 4LF8F 3OV7A 3MECA 2C3PA 4N27A 4WPAA 4M5JA 4I64A 4NZ6A 3FFIB 2C22A 1GTEA 1PJ6A 1TKZA 1I94F 2CPHA 1WTBA 2X7IA 2AHOB 5KT7A 4C3KA 3BO3A 5H9EK 2HNYB 3DOLB 1NNDA 1RWNB 4WIQA 2FZCB 2LQ5A 5B0FA 4ZVQB 1K1QA 2VG7A 3OH1A 3RR7A 2NQPA 1H0HB 3GONA 4RNOA 3CJ2A 2EXUA 5DJBA 4CLYA 1CC7A 1RAJA 1M0SA 4BBYA 2IA6A 2VOOA 3CJKA 1Q8IA 1H98A 2Y9HA 2BM1A 2E9ZA 2CQGA 4DR2F 4WIIA 4IQMA 1MRLA 1AZSA 2IRYA 2VC0A 2NS1B 1HHTP 3O8WA 2M5YA 3NGSA 1J5OA 4OI6A 4JV5J 1D8YA 4EA9A 1Y5NB 4YB5A 1CJTB 2HFNA 3VBNA 4M5DA 2JH3A 2WVEA 4KPXA 1M5VC 2OUGA 4Y34A 1KOHA 1NPKA 4WP3A 4O4GB 3M2UA 4NRTA 4TY8A 2XZWA 2P5VA 2FJXA 4ES2A 1J2VA 3PACA 2RU3A 4Z7YA 4F50A 4D3HA 1VRUA 4U9RA 5CYQA 2ZH9A 1JLBB 4JI4J 2HVZA 4OX9F 3SSSA 2MHNA 5THWA 4AXJA 4TYBA 4OYWA 1J27A 2DH8A 4OHWA 2DNHA 4IDKA 5ETQA 1IUJA 1UEVA 4QIGA 2KG1A 4A8SA 3TEHB 2VQFJ 2C2ZB 1R27B 3V2UC 2IC7A 4CH1A 3M1VB 2Z2MA 3WIUA 5F8LA 1N5TA 4O3RA 2XMMA 3IM9A 1FRKA 3MAQA 3G9CA 4Q8EA 2YX1A 2V68A 2WW8A 4EI2A 3GIKA 5LT5A 2EFOA 4DR6J 3DLKA 1H2TZ 4DFJA 4X66F 2QYGA 4J9PA 5HVFA 2IMWP 1S1WA 4NXNF 2NUHA 3J81j 1WDTA 4LF4F 2VONA 1F5AA 3HHLA 4Q44A 3CCWA 1HM8A 4GKKJ 5KFPA 1VQPS 2TDTA 3M6WA 5HROA 2H51B 4F4AA 3M8PB 4PZVA 3U7JA 4M1KA 1VQ9S 3GFZA 2YWWA 4PWDB 1V3RA 4H4KC 4UY85 1EQ0A 1TK8A 1TL1B 4KHMA 1XATA 4RLEA 4ZA1A 1T9TA 2NR0A 3IM8A 1S9EA 2FVRA 2W0WA 1WELA 1TV6A 8ATCB 2HQGA 2KG0A 2JEJA 1WC1A 3CIMA 3KNAA 4CO4A 2CQ1A 4A48A 4K4SA 2ZOGA 4HCQA 2XMVA 3CT9A 5K8PA 2PA8D 3H7HB 2HZAA 3V6JA 3FS8A 2JLGA 1UA1A 2VD3A 3KMSA 3W3SA 3DOMA 1ZM2A 2VG6B 2HRUA 3VF0B 4HEA9 3MEDA 2IYIA 3EPIA 4OI0A 1X5PA 4LIRA 2WONA 4X4TA 4LVOP 1FD2A 4G1IA 4ECWA 1TVRB 4X62J 3A1YG 1EJ7L 1U48A 3TUPA 2CQ0A 4WWSA 2B4VA 4OZLA 4NI2B 2FVCA 3BKTA 1MU2B 3JSYA 1M90T 5G0RB 5I3UA 3MMBA 2OI7A 1OPZA 3CSKA 1CJKA 1A9NB 1IJFB 4EU0A 1T0TV 4KBIA 1N32F 1HMVB 2VFRA 2GIRA 4CLLA 2L9NA 1DHMA 1FK9A 3NNHA 3HF5A 3T6JA 4IR1A 3GILA 3TP2A 3C14A 4EMDA 3HT3A 3V4EA 3CD6S 3H40A 1YP4A 4Q0BB 5HSPA 4USJC 3C6UB 3W5ZA 2D9OA 3KJFB 2YKPA 1GX6A 4CM0A 4ITSA 3MQGA 4W90B 4J9LA 4ZMMA 4OIXA 1GFWB 3R97A 3IA0A 4L6V3 4U7UK 2HHHJ 1KKHA 5MAOA 4B9UA 5F9LA 2XGPA 1X4BA 4KR0B 1LW2B 4KC5A 4MIBA 2ZJQQ 4DN9A 2B3TB 1QSSA 3OW5A 3DGPA 1M8NA 2IM1A 2BW7A 3MD3A 2OH2A 2ERRA 1RWVB 4Y00A 1F9HA 2YX4A 3J7ZT 3QIPB 1UETA 2DRAA 2V0NA 1KQAA 1FKOA 3T5LA 2YXLA 3U1NA 3ZC4A 4MYTA 4P7VA 1VQMS 1YRUA 4NLXA 3OJSA 2MZSA 5KT4A 1WF1A 4M2BA 1NDCA 1X31C 3D6TB 1H6KX 1YX2A 1HNVA 3F44A 3DRSB 2Q6BA 5KFRA 1RYRA 5D4LA 2XS2A 4DPUA 3HSGA 5CAAA 4V1Ak 1RI7A 2CQCA 5CXTA 1IKWB 4AXIA 1WJ9A 4P75A 2IAJB 4QCLA 3QAUA 1SUQB 4FYXB 3V6KA 5J1NA 3BBCA 3MCNA 1UA0A 3UW1A 2QEXS 3G86A 2YWGA 2PMZD 3WIVA 3PIOQ 3DM2A 3N6LA 3O5TB 2L9DA 5D4NA 1RT1B 1SJ4P 1OJ4A 4AQYJ 1JLQB 4CLZA 3BZQA 3H8YA 4O44B 2Z2LA 1SJFA 3J7AN 1KK5A 4URSA 2VDHA 3TJ8A 4LF6J 2ICXA 3MM7A 4K50A 2XLKA 4FCEA 1Q81T 1RE1B 3V81B 2OEFA 2EFGA 4GC7A 4C11B 5JUMA 3I4HX 2FD2A 2XS7A 2Y8WA 3NKYA 4OYIA 4O3SA 3J81Y 3FQLA 4F8RA 1GXLA 4QYZJ 4DS4A 1H7XA 1LWFB 1Z2ZA 3T5KA 2OPRA 4XIUA 4RW9A 5HI7A 3TAMA 3KWEA 4ED3A 4NLDA 3GSDA 2N3OA 2HSEB 2OEJA 4DZ6A 3GZ7A 2DK2A 4P2SA 2DPJA 2FY8A 4PCQA 1RZMA 3NMAA 3TZZA 3GOSA 2V2QA 1TKTA 3I4PA 2CAJA 1YTYA 2NZCA 1SJRA 4M5KA 1R0BG 5E3PA 4Y2MA 3BKFA 3QZ8A 3ITHA 2OP5A 4R25A 2KXNB 3TNVA 3AFGA 3LAMA 5DETA 3J7A1 3I5AA 1XN9A 4HACA 2HQFA 3R5CA 2HHSA 2EC2A 3AD9C 1UCNA 4B9TA 2OPPA 2QLFB 1IKYB 3O44A 2XYPB 1B7FA 2KYXA 3TEGA 1HWLA 3OXFA 1PYTA 3IWXA 5A6PA 4IH7A 2Q43A 4DV6F 4KPZA 1O6XA 4EZ6A 3IR7B 1P1TA 9RUBA 3CJ8A 3OTZA 2A2CA 3B8HA 2LLZA 1F1BB 1NJWA 3MAAB 2KT2A 3LOUA 1M5KC 2CZVC 4DWIA 2E9TA 2N7CA 3DOKB 1Y3KA 5DZ6A 2CYYA 4N41A 3I6PA 1T9VA 2V9KA 2Z56B 4I2QB 4DCLA 2NXEA 1X4FA 5CABA 2M8DB 1UFLA 1UVJA 4MIAA 4WYWA 2MLZA 3PMOA 4J9KA 1YSJA 4NCGA 2DXDA 3CDUA 2VKZG 1QD1A 5D4PA 2YX7A 3N0VA 3D1QA 5L38A 3IAM9 2AJ2A 4LF8J 1S79A 5HATA 1SCJB 4A8MP 2Q3PA 3KLIB 3HPOA 1KQFB 2AZ1A 3UWTA 1K44A 3W9JA 3D6FB 1LKZA 4MH8A 3KWCA 2QL9B 2M9KA 1N36F 2B4PA 1Q86T 2E29A 4W98A 3ICLA 2OJ3A 1LQ9A 3GV8B 3RU0A 1R8HA 2KO1A 2ZDPA 2HQDA 5DM7Q 1WKKA 3OVAA 2IYGA 3HVAA 4XPEA 2WK4A 3MMCA 4LSNB 3F41A 3KJVA 2NCKL 3GQ8A 2MZ1A 3PFOA 4OJ3A 3EGZA 3PRBA 2L3MA 2BJDA 4PXDA 2DR5A 2QGFB 4AL7A 1UWBA 5LMNF 2BE2B 2XMUA 3I9ZA 4P71A 1B0VA 1REVB 3HLUA 3KHRA 3SQGA 2E66A 4DV2J 4ZJOA 4WF9Q 4WFYA 1TUWA 4ZP9A 5K14B 1FNXH 1JLEA 2LQJA 1NU4A 1F0XA 1UAWA 2MMYA 5DLGA 2AQ4A 3ENAA 2W4CA 3TUJC 3IRXB 3FCHA 4YHHF 2DNLA 3SXLA 4NLGA 1JJCB 1WNEA 3SMZA 2GHPA 4K2JA 2JEIA 3ZNUA 3PEHA 2AJ0A 3K0JA 7FD1A 2P8IA 3OH3A 6AT1B 2KJWA 4OYBA 4PYDA 2ZC3A 1X4HA 1M5HA 4K6RA 3A8IA 1H72C 3GJQB 3GQAA 3NS6A 1RT3A 3QT7A 2AJQA 2UU9F 1SBRA 4ECZA 2QV6A 2HK3A 3EE3A 2YWFA 4DV5F 2IBKA 4DQQA 1GX5A 2D3ZA 4NLPA 3OL6A 4DN0A 2HQ3A 1U4BA 4L74A 1E6YA 3IFEA 2QLXA 3LW5C 2D9PA 1KQKA 1RWUA 3M30A 2CA9A 3KG0A 3D0GE 1MROA 2ABYA 3LPYA 1ZOTA 4N69A 1EP4A 3EH0A 1NB2A 4X66J 3HHEA 2VV5A 3SPTA 1XMOJ 3TYTA 4BWJA 1RTZA 4YOEA 3KK3B 2UVUA 2WCXA 2ZBQA 4NXNJ 1CBKA 3QQCD 3P6YC 2XO7A 4LF4J 3BQ1A 4E79A 2DR6A 2OTJS 2F63A 1XEZA 5J1PA 1KK4A 5EWGA 2MYFA 4ECUA 1ELOA 1XMBA 1HNIA 2JFDA 1FDNA 5DRKA 1BQNB 1AA1B 5KFJA 2R7WA 2YVSA 4UQGA 4KNXA 4EGLA 4OX6A 2MB0B 4QWEA 1RT4A 2DGWA 3OFGA 2MSTA 3EZ5A 1TTHB 2RQCA 3T9ZA 3BREA 2EW9A 2X3GA 1L3SA 4JOUA 3EDRB 2DGUA 3UE2A 3UI3A 1QRFA 2DGXA 4ZVSB 2BMBA 3KOAA 2R2SA 1DRZA 1HBNA 3DHOA 4C8OA 4ZK7M 1O8BA 1RP5A 3T57A 1YRXA 4JI8J 4JI1J 5AFUV 2JZ5A 2K3IA 3NAIA 3TZYA 3FSBA 1F9EB 5L39A 1XR5A 4I1TA 1PYOB 1HWKA 5KFWA 3GV7B 3JQKA 2WTFA 1KLNA 5KG5A 4TVAB 1TL3B 2EI5A 4JI0J 3MR7A 1XK8A 5B0DA 4L3NA 2QFJA 1JLFA 2KHCA 4WK3A 3PY8A 1B64A 2NSBA 1QAYA 2RS2A 1N32J 1GT8A 4WZMA 2BQ3A 1DARA 1JXLA 4Q45A 2XY5A 4CZCA 5I42A 4B17A 2Y1LB 5H9EJ 3L3CA 2DHHA 1ZM3A 3EXCX 2R7QA 2JL9A 1NMEB 1TL7B 3PTWA 5AFUU 2OHDA 3EVWA 4WBFA 2V0JA 2GVDA 5E0OA 3IG1A 3ZZZA 1WC5A 4NLTA 3H2UB 2ZNYA 3KLHA 2E1MC 1X4GA 2IC3A 4NEZA 2OLWA 3AAWB 2YTCA 1K0VA 2QSFA 2MQQA 3H2VE 3Q8RB 2CADA 4DV4F 2LA4A 5AE2A 1KRRA 1HD0A 2EK6A 2RU9A 1MLAA 3KLGA 3CW2C 2VF3A 4OI1A 1C0UB 1FERA 2ZOMA 2VODA 2CQIA 3HJVA 3QLHB 1RT7B 5F0WA 2QA1A 1EIYB 1WSVA 4X65F 1T3OA 1DQ9A 4RW7A 2QE5A 1XNRF 2C2EA 4WFZA 1MWYA 4DV7F 4OYOA 1ZBTA 3DRPB 3HHLC 4HYKA 3HVRA 2V69A 2E1RA 3GU0A 2UUCF 3DK5A 4P2XA 1NK4A 3I0RB 2EG2A 2HNZB 1CULB 2A2DA 2I38A 3FRYA 2VBZA 1LFWA 1WG5A 2G1HA 2N82B 3UD3P 1RA6A 3NBPA 4IG3B 1W25A 2XMKA 5IT4A 4CLFA 4JI3F 3IGNA 5HJXA 3JYTA 2MXYA 3THVA 1JK9B 2CWXA 4B9SA 2ZZMA 2XTJP 2P9GA 1RA7A 3OR2A 2MJNA 3OTBA 3LP0B 1HPZB 3P96A 3F1XA 3P45B 4DSIA 2OI6A 3MUTP 2C3UA 2YWKA 1S1UB 2VH7A 2VBYA 3I3AA 2NPIA 1WI8A 2CQ2A 2YKQA 1JJ4A 3W8GA 3UDVA 4EGGA 4WKRA 4NASA 2H54B 5KOXA 4IFYA 3W9HA 2HHWA 1A0OB 4DUYJ 1UZDA 2E5GA 1S77D 2JVRA 1QE1B 3HD2A 4DSFA 4F25A 1VBXA 3EICA 2KM8B 3QGHA 2E1CA 2Y1RI 3QATA 2J7UA 4C0HA 5E33A 2RT3A 1S6UA 1KD1T 1YWXA 2CPDA 4H4MB 2IMOA 3GE9A 1DTTA 2UUWA 4BDPA 3R6LB 1HI0P 2WSEC 1JKHA 2BVZA 4C6AA 4FPRA 4OZJA 4EYHB 4F02A 2RRAA 3I55S 4KTQA 2AGPA 1JX4A 4FXDA 4PR6A 1YJ9S 3ECTA 1F5BA 3KG4A 1OY8A 2AF6A 4PWUA 2V8HA 5LJ5Y 2VQEJ 4F3OA 1TP7A 2CNKB 1T94A 1FFWB 4GRSA 4NYPA 2HBYB 5KG3A 4DPXA 3TR5A 1S4FA 3T1AA 2GS8A 2M2BA 4P9SA 1V6HA 2RS8A 1GXUA 1QAXA 4P73A 4WP8A 1IBLJ 3PW5A 2HWIA 4W4MA 1KVIA 3MGJA 4HTJA 4NOHA 3QBCA 2PIIA 3R6GB 4LF9F 2KYZA 3BR8A 4CLKA 1ACMB 1LK7A 5HJYA 3GUEA 4TQRA 2JF3A 2MGZA 3HK2A 5BYRA 2VJVA 1FDDA 4J9MA 3MM8B 4HDHA 2KU7A 1M5SA 1TAQA 4J7CA 1CJVB 3P4UB 3JSMB 2DKOB 2OMOA 4YMEA 1QSLA 3NCQA 4JV0A 2FHJA 2YNHA 4LRCA 1FF2A 1VISA 2E1PA 2VC1A 3OTOF 2JDJA 4RW4B 2E7XA 2DNNA 1NPRA 4AYBD 4DQPA 1YRTA 3P3DA 2J0WA 1L3TA 1P9QC 5C25A 4DV1J 3A4TA 8AT1B 2BKNA 5CD4A 7AT1B 1WHYA 2HVHA 3POTA 1XQIA 1Q79A 3W65A 2W1BA 4USIA 4NMLA 3ILLA 3Q23A 4EUVA 4UOHA 5J2QB 1VYAA 1OO0B 3R7NB 5EUHA 1YP3A 3TVYA 1X0FA 3FMWA 1N52B 2R7SA 4AFFA 3BO4A 3D68A 4L73A 4UOCA 3BSOA 4C0BA 3D3CJ 4ANEA 1UMJA 3B78A 3CGIA 3GSIA 4CM2A 4YB1P 2MKYA 8RUCA 3KTQA 2ASLA 3BN7A 3C15B 2IVFB 2OELA 4ZIVA 5C5JA 3AQPA 1S9FA 3BBBA 1XERA 4ZHRB 1ITPA 4QR1A 2YKNB 3H5XA 3CDBA 4J37A 2KVQE 3JAMY 2W9CB 3FJ2A 2J8SA 3P5BP 1S7HA 1Q82T 1S10A 4NLOA 3AOBA 3KMQA 5LMNJ 3W9IA 5AXLA 2F4VF 1TMJA 2RDDA 3QJJA 2HS3A 5L9NA 3HSJA 1XWLA 3HHDA 1F6TA 3DN9A 1MSWD 2MQPA 4DUZF 2LP4A 1JMTA 1PO6A 2DYAA 3FEYB 4YHHJ 3E01A 4K4YA 1NO8A 4I2PA 4QWAA 1DFDA 4KIAA 1T11A 2Z8QA 5HBMA 3RB3A 3H42A 5DZ7A 3PXGa 1L0SA 1X0PA 3PFEA 3QJPA 3T1HF 1UEKA 4DR1F 3M9MB 4OJGA 2JNJA 5DG7A 1N5QA 3FC9A 2HIQA 3R3TA 2ZC4A 2GIQA 1FA0A 2GV1A 1JLAB 1KGTA 4ZPDA 2UU9J 5KT2A 3G82B 4KNRA 1Q5YA 1X60A 3H98A 3OVBA 4ED8A 3W8PA 4RX6A 4EA8A 4EBCA 2IRXA 4QWBA 4DV5J 3L7PA 3F56A 2HHXA 1Q7LB 1QRMA 1KOOA 1PC4A 5K20B 4Q5VA 1WUUA 2BEFA 4A8YA 1Y00A 5A0YA 1KRUA 2XGQA 4DL5A 3HZGA 1LXNA 3NNAA 2LEPA 3OUYA 1FHTA 1NJZA 4HH1A 3QO9A 1R8BA 2PDAA 4F67A 1NZAA 2K7JA 3CCRS 1SQGA 2Q4JA 3HFKA 3T9NA 5DGBA 2XY6A 2I9SA 1TZ0A 2HLTA 3KUHA 1R31A 3IR6B 1NK0A 2ZUGA 3M8YA 5HL7Q 3MUMP 1LNQA 1DTQB 5C42A 3BJYA 2CWKA 5B09A 3VVTA 2GMHA 1U45A 2FJDB 1RAEB 2MEWA 5KFQA 4H4OB 4M98A 4IOBA 4FF4A 1U02A 3MEEA 3FNNA 1VIOA 2YNGB 1VGYA 4DHVA 2X3DA 4F7VA 4KE5A 1SL1A 3ETOA 4TLRA 4PXEA 4C3MA 4G1PA 2W25A 2ACMA 3JQJA 5AT1B 3QJLA 1Q5VA 2AX0A 3LP1A 2R7VA 4KKOB 5BJRA 3FK4A 1N5YA 5KT5A 4RW8A 4WE1A 4O23A 2VFUA 5L1KA 4N8NA 4AC3A 3VVUA 2EFQA 2QA4S 9ATCB 3DYAA 3GYNA 5KG0A 5GADI 2FQQB 1Z2LA 3OU9A 2ZE2B 3VAFA 2BOPA 4PQUA 3MHYA 2QLWA 3MAHA 2YWHA 3BYPA 3CO0P 5AE1A 2M88A 3ZTPA 4F4ZA 2UXCF 4DOZA 2NXUA 2GJFA 3ONQA 5FDLB 3I32A 3C6TB 4RWWA 5AXMA 3G6ES 2FGCA 1X5SA 2BE7D 1ROFA 1NKBA 2LVWA 4OV1A 2DR8A 2HAIA 4NLWA 1HR0F 5FD1A 3KK1B 4IUFA 2LEAA 3ZTOA 1EWWA 4ZVPB 4ANCA 2ZDOA 2WOMB 4P74A 3O6QA 3D28A 1L3VA 1QAJA 3GQ7A 3G96A 3DDIA 3C2PA 2MKCA 1IKXB 5J2NA 4TY9A 3W2WB 5GAEI 4PAAA 1OY6A 1HQEA 2IA0A 4RNFA 2LEBA 3M7VA 4JI2F 3UDLA 5IT9Y 3W63A 5JXSA 2RDIA 3UVJB 4PUOB 1KVJA 1KSPA 4OJ1A 6FDRA 2AMCB 2V67A 3FMBA 2LU1A 3CJ4A 1TKXB 2GGPB 4YS2A 4M5MA 3EVOA 1WKLA 1RACB 4X65J 3D1HA 4DR4F 2IHR1 2VA3A 5HMXA 1XNRJ 4KQLA 4ZCIA 4DV7J 1UL3A 2M52A 4C0OC 2MQMA 1M5PC 1BWEA 2UUCJ 2IPOB 1R89A 3VALA 1LOUA 1N0UA 2RF2A 4J90A 4LSZB 1R7IA 4J9QA 1DLOA 3HFZB 3D98A 2KI2A 1UW4A 5CCLA 2OPSB 3K17A 3BDPA 4X4VA 2QIFA 5F42A 3AODA 4M28A 2HVEA 3PHTA 4JI3J 2GFFA 2V8VA 1SL2A 2BANB 2FVSA 3L7OA 5LL6d 3NOGA 1NSAA 3NRBA 1GTHA 1SH0A 3P49B 4IG0B 3DXSX 1RHMB 1LWCB 3CJQA 5DDPC 4OHXA 3B54A 1CSJA 2CG8A 2V4QA 2KHDA 5GAHI 2H3EB 3V6DA 2MZJA 1RTIA 4KH1B 2APOA 4RW6B 1U7LA 4LRBA 1VQSA 4A8WA 3MM9B 4NYOA 2LQBA 5A8KA 3PRDA 3TARA 4WCEQ 4G87A 5HK4A 1HBOB 3GMGA 1Y9OA 4RNHA 2J6UA 1HW8A 3PYFA 2LU2A 5L8RC 5T14A 2AEJA 2IJRA 4IQXA 2N4CA 2G2ZA 2Q79A 4G1QA 4MK7A 5AXKA 1FX4A 1U8WA 3HXMA 3PW7A 1X4DA 1QTNB 5KFNA 1QUVA 3NY0A 4H4KA 3BKUA 3OR1A 4YR0A 4R36A 3SV4A 3UCGA 5KTQA 2EC0A 1KK6A 4KHPF 2VUGA 4DDFA 2B6AA 4EQYA 1WHWA 2RIJA 3RRGA 2B4UA 4DFKA 1G1XA 2D7SA 4CLUA 3ISZA 1HYSB 1BQMA 4DQSA 1OIAA 4AT1B 1EAYC 3F73A 2FJVA 3MI7X 4P2MA 2VBWA 3FCVA 1BC6A 3ZO7A 4QPTA 3HHLD 1Q7YT 4YEAA 3Q8UA 1M1KT 4ZJQA 1NH7A 1S1XB 4JV5F 1TL5A 1C1CA 5I3PA 3SDEB 5KFBA 4I56A 3SCKE 4A8OA 4HT5A 4IFVB 3BYRA 2ZHBA 2HFVA 2ZOFA 5F8GA 3LTOA 5A76A 2F7VA 5KFXA 4Q7AA 1S72S 3D6HB 4TU9A 2FJAB 3GWCA 3MM5B 4DQIA 5BYSA 4KRWA 3N6MA 5KFOA 1N4IA 2C1EB 3G4SS 3N01A 1XR7A 3NCRA 3O2IA 1PG5B 1G95A 4LF9J 3VBMA 2BJ7A 4JI4F 2OTLS 3CMES 5DG3A 2HW3A 2FLNA 5F3TA 4Q8FA 2LMIA 1U09A 5DEMA 1Q8BA 3G6YA 3MMAA 2DHGA 2X51A 4OZ5A 5T41A 3RBDA 4E8UA 3IBWA 4ECQA 1RTHA 1K8AT 4IHGA 1PJ7A 2DEIA 5DLFA 2KFZA 4UUWA 4DLGA 2ZH1A 2QIVX 1RKJA 1G97A 4G65A 4TQSA 1RBLA 1RT5B 5IQQA 1S48A 1GMWD 1FDAA 2W9BB 2FJBB 3OSPA 2DISA 4DR6F 1KLMA 1F5CA 2ZITA 2QTWA 1XR6A 2F4FA 1RT2B 1F9FA 4KB7A 2W2QP 1Y5IB 1FRHA 2EVZA 3DCAA 2DGVA 1T03A 1R43A 2C2OB 1VJWA 1RHRB 2GC8A 2GQQA 3X3UA 5HP1A 3G71S 3DLGB 3G87A 4GKKF 1FXJA 3UPFA 1JXEA 3U1MA 2XZDB 2V4JB 1RLCL 1S1VB 3Q1XA 2IBOA 2Q6CA 1YHQS 1MR9A 1VRTA 1C1BB 3I96A 4I7FA 1X4EA 2ZH6A 2WLFA 1QY7A 1GK8A 4ECRA 4QR0A 3UR0A 1NSKL 2C2KB 1NJIT 1C0TB 2ACYA 4DCJB 2OGUA 3G8QA 3KNGA 4GMKA 2CJ9A 4KGVB 3MFIA 4IHHA 1VHIA 3SSQA 2CIMA 3MR2A 1U2CA 2BDPA 5DDOC 4QYRA 3C16B 2F40A 2M8HA 4ZN3A 2HHPA 4UZBA 3T5JA 4UTGA 3TISA 3BSYA 4MYUA 4ZITA 1NK9A 3RW6A 2MSSA 4CCHA 4CDIA 2F4VJ 2UUAJ 2D3UA 3FZ2A 3VR1A 2HMIA 2AKWB 3GFXA 5D15A 2V0IA 4OYMA 1DQ8A 5GMKa 5DEPA 3DLEB 4J5OA 2O01C 5IZHA 1S49A 4DUZJ 5T7LB 3PW4A 3KWDA 3IAS9 4NRUA 2DNYA 4MFGA 2AV5A 3RGIA 1WWHA 4RBVA 1OSCA 2W8LA 4U7UD 4LIWA 1EETA 4ID5A 5E41A 2LKZA 1U2RA 4DMZA 3CCLS 1QM9A 1XBWA 1HWJA 3CJ3A 4A4JA 2O66A 2KZMA 1QSYA 3GIMA 3W66A 4G3PA 2HHQA 2EWHA 4H7OA 3DU6A 1R8CA 4MZUA 2H5IB 2GQ2A 3EWGA 5B0CA 2WVCA 3AB2B 3PG9A 2CDQA 2G13A 1AT1B 2CQDA 3MCSA 1TFWA 5IT0A 3KLEA 4IOCQ 3EZOA 3JAMU 4DFMA 1S4EA 5KFMA 2HHHF 3TW0A 2ILYA 4B3OA 3BGRB 2VICA 4R0EA 1SKUB 3A3PB 3ZZRA 1VBKA 5U2KA 3ADAC 1WTFA 3TWZA 4FS2A 3KK2B 4MFBB 5SZTA 5DM6Q 2P6TA 1WACA 1RKIA 3R1HA 2C2NA 1YQHA 2DO4A 1H74A 4IRCA 1QJHA 1S0NA 5A2QY 3MECB 1FVSA 1JB0C 3MMJA 3TQ1A 3AB4B 2DH7A 4P6QA 4ILLA 3TJAA 2HHTA 3N9UC 1RTDA 1TKZB 2W2PP 1DBDA 4LQ3A 4HZDA 3GR1A 4RO0A 4WXOA 2M3DA 4BHQA 1UWAA 4K4XA 1FRMA 2XWXA 3I3XA 3Q8PB 5J1EA 3A13A 2VD4A 1D09B 1NHVA 3IBFB 5KFDA 2E5LF 4LRFA 2VG7B 4KFBA 1U49A 1NHKL 4NX9A 1XIQA 1OPIA 3ZZUA 2FC9A 2DXFA 3CJKB 1MR7A 1EB0A 3W2VA 4AQYF 4NLYA 3L09A 3PYDA 1WF2A 5I3QA 4ED7A 4N5SA 1CJUA 2DH9A 2X1BA 1FD8A 2UXCJ 4CI0B 1AZSB 2LXIA 4LRAA 3K57A 2ZFHA 4ZVUB 1D0EA 2MQNA 4GO5X 1J5OB 4J9RA 5F8HA 3IBCB 3CC4S 3TDTA 2QMWA 3ET6A 5LOQA 3GQCA 3RR8A 3M8WA 5GAGI 4M5DB 2I5KA 1KFDA 3NGTA 1RWPB 4NE9C 2DEJA 1HIYA 2MZRA 1W7WA 4LFBF 4O3PA 3M2UB 1XHDA 2VL1A 3W62A 2KXFA 4TY8B 3PJXA 2YQ3A 4N8OA 1VRUB 4DV0J 5E3CA 2V2VA 5CYQB 2G9OA 2YNFA 1TUGB 2P9EA 4JI5F 2AD9A 4IDKB 4W92B 4RUBA 4LR9A 2H1YA 1RWKB 2OPQA 1RHJB 2P6SA 1T3NA 3THPA 4KGZB 3HSQA 4JYAJ 2ASYA 4CO3A 2RMLA 1N34F 3A3NB 4KAIA 1ZM4A 4I68A 1SIZA 5IV3A 2ZH5A 3CEDA 4N77A 2CQBA 2OFGX 3IO1A 4DPTA 4Y28C 1RSCA 3H5YA 2NUUG 2UZAA 2BA9A 3V5RA 2ZBPA 1G4CA 3DLKB 1ZTWA 1NDLA 1D9DA 1TQLA 1S1WB 3BQ2A 3K58A 3OFEA 3HHLB 1FKPA 2YKMA 4FNIA 3UFCX 1Q16B 1IR0A 2UXBF 4PG4A 1RDRA 2BXJA 2CJYB 2YBVA 3LP2B 5HROB 4K2XA 2RNEA 1U24A 3QRPA 1NAQA 2AYEA 2F65A 3HVTA 5KG2A 3CCSS 4KGXB 3VAMA 2WBRA 2ADCA 2ZBIA 3CPWR 1UJ4A 1RGVA 1S9EB 5HQ8A 3NGUA 1TV6B 3KLVA 1YJUA 1X4AA 3SZ2A 4ZVHA 4N47A 1ZPVA 2D3O1 2B8QA 1H7WA 2BX6A 1JLGA 4X4OA 1TELA 1U2FA 4RWXA 1Z90A 1U1QA 3DOMB 2FJWA 2DY9A 1DURA 3D1OA 4E6TA 3DGVA 3MEDB 2UVVA 1SC1B 1SC6A 2RJZA 1YVFA 1XMQF 1GQEA 2V50A 1XC9A 2WONB 2BKOA 1V5VA 4J9OA 1IM6A 2VASA 3KG1A 3KDNA 2JRSA 1WKJA 1RISA 1VCTA 2HRTA 4FPIA 4KHPJ 1R8AA 1YZ7A 5I3UB 3LGMA 3MMBB 3EYZA 1CJKB 2FIUA 1L3UA 3M2RA 2G1DA 2XNQA 4LT6A 4DPOA 5JJBA 3OPKA 1LWEA 1FK9B 4LRDA 1U1MA 3GPAA 1MWZA 3NNCA 2UVWA 3OJUA 1S59A 1Q0NA 4FDFA 5KFEA 4DV2F 3C14B 1G7CB 5LJ3Y 2NXJA 4KGMA 4YR2A 4U8YA 3TA0A 5K8NA 3HMJG 2DNMA 3PO5A 3IS9A 2A0FB 1RYSA 4X4UA 4NA1A 2RUSA 2B7CB 4AAWA 1L3KA 2D1CA 1O0PA 5KG7A 3CC7S 3GJRB 2KFYA 2G2YA 5EDWA 1VQ7S 1KWMA 2YKAA 2KDOA 4JBCA 3DJ4A 1WOPA 2CNLB 1LXJA 1RWXB 4EWTA 2GGQA 3IGVA 3M2VA 3DGPB 4F36A 5ADXV 4UY8T 2B5JA 1BD6A 3OTEA 2QT7A 1RTJA 4CNYA 1C2PA 4ILRA 3FSIA 1FWPA 4QIWD 3M8QA 4TXSA 1FKOB 4ECVA 4U6PA 2HZVA 1RAAB 3H20A 5HLFA 3MTJA 3R0SA 1DZ5A 4BLGA 2FLOA 1PGZA 2A10A 1HNVB 2A3JA 2AGOA 4LBPA 2DCLA 2JF2A 3OBIA 4DR7J 3V4IA 1RT6A 1BGXT 5K8OA 4BWMA 1DY3A 1ZAVA 1XMOF 5ETSA 3VQTA 7FDRA 1N5VA 3S7RA 5ADXU 1SQFA 4EO8A 3EGVA 4JUZA 2AU0A 3FSXA 3TANA 2MQLA 2CPYA 3JQMA 3BGUA 5F8IA 4CTAA 2RKIA 1UTAA 4ELUA 1SSMA 3HDSA 3LP2A 3NL0A 5L1JA 3P47A 5CYMA 4NLSA 2HYIB 4DX8H 2MY7A 3DM2B 4NLRA 1DAXA 3DMJA 1YITS 2B51A 1RAGB 2D41A 4USHA 4IO9Q 2O1PA 1QDUB 4DX5A 4R7PA 4FKXA 4ED0A 1WC4A 5EX3A 3MM7B 3FBBA 3HSDA 1X7VA 3SSRA 5DS7A 3GIIA 2QKXA 1RAHB 1IBKJ 3JTPA 2PFFB 2J6TA 1IKVA 3D67A 5C7PA 2AJ1A 4JI8F 4JI1F 3RBEA 1N5SA 3NWGA 1SPBP 2W7OA 1IXKA 2WB1D 2DT9A 2OPRB 5M2PA 2AIRB 4RUHA 2R7UA 2IVYA 4RW9B 5IQ6A 3TAMB 4JI0F 3Q8SB 2P2CB 2DD8S 2W4PA 1HNWF 3PYGA 1FWLA 3ENVA 5D77A 5DO2A 3JTNA 2VHEA 2IIHA 1TKTB 2BKPA 4MAKA 4QQBA 4GVBA 4KYZA 2CZ9A 4NLQA 1H2UX 2MJUA 3DNCA 2DRBA 2ZM6J 2CQHA 3VBLA 3ITHB 3K59A 2CQ3A 1S0OA 2J0SD 2IDLA 4URQU 1T9YA 4HACB 2M7SA 1ZPWX 5HANA 4R0JA 3ZZYA 1M1GA 4F4WA 3TI0A 5F0UA 2K2PA 2OPPB 4USWA 1KEKA 3U1LA 4KY3A 4J9UE 3H0PA 1V9OA 3B4MA 3VHQA 3AD7C 3IWNC 1NK5A 4RBUA 4OFZA 1KONA 1S9GA 2C42A 4G3IA 1IQTA 5FLXU 4HHJA 4HI2A 1MMDA 2ZZNA 2R8HA 4ATNA 4LUBA 2PEBA 3DRRA 3LUYA 3TZXA 4LSLA 3J80Y 2PEHA 1AYEA 4KHRA 4WYLA 2AEFA 4ZCMA 2EEYA 1FRIA 3PX6A 1HBUA 3MC4A 5A8RA 1P6TA 2DRDA 1D9FA 4NCGB 4YN3B 3CTRA 1UPMB 3OGZA 2ASDA 2OSQA 1N8RT 3GB0A 1S1TA 2CRLA 4P2FA 3JS9A 2W4DA 4URGA 2OI5A 2JSXA 4EO6A 1R6VA 2LFVA 2HGMA 5D6GA 1HW9A 5CD4H 4P10A 3R3RA 3CE8A 1Y11A 4Q43A 1RBAA 4QWCA 2V8DA 2DY1A 3MEGA 5LSRA 3R1LA 2DGQA 4ZIWA 1U6FA 4LR8A 4PRFA 1ZA1B 1I51B 3OXLA 1T9WA 1ICEB 2VG5A 5H1SV 3HVWA 2E5LJ 1R8PA 4UZCA 3GCXP 3MPVA 2FB0A 3MMCB 3CCMS 2AYBA 1PBAA 1B3TA 4RZRA 3KJVB 1YBAA 2ZBCA 2DR7A 4DUYF 1UFKA 2VU5A 4QW8A 4M9CA 1UWBB 2BW2A 4ZJLA 4M5IA 2PGCA 5AE3A 3UQSA 1V3WA 2WBMA 3SQGB 3CULA 2FHJD 3OT9A 4C9DA 2QJ3A 5EHHA 2XMTA 4Z2XA 2OD4A 1G6BA 2ILZA 5E5NA 3MM6A 1JLEB 3WZ0A 3Q24A 4RU2A 2EBGA 2C2DA 4KQZA 1VS3A 3KLFA 2ZD1A 5A2QU 4HKQA 4ZPAA 1Q1KA 3Q86A 4ZPVR 2EKYA 1VC0A 4M5LA 4LFBJ 5GADU 4QIEA 2IU9A 1T95A 4C48A 3VGVA 3FGVA 1YK9A 1FRJA 4DL3A 4PKDB 1RT3B 3S01A 2VQEF 4PXCA 2YPZA 1KN6A 1NSPA 2MY8A 4QZVB 1CC8A 4JI5J 4RKUC 2NYIA 4OX7A 3MUVP 1VQLS 1H73A 5B0EA 4I4BA 2Y0BB 2F3JA 4DQRA 1SV5A 1E6YB 1IBLF 4CLSA 1AUDA 2BV3A 2XULA 1IBMF 3M30B 2RB7A 1N34J 3R1WA 3CCQS 4NA3A 2VA2A 3OL7A 3PEJA 2MTLA 1MROB 5AJ3F 1U47A 5GAEU 4ZLLA 1EP4B 3OH0A 4R8UA 3L4BC 3UDEA 1PILA 3HKWA 3C66A 3MPUB 3PHEA 2RHQB 1N56A 4Y3CA 3QFHA 1HL6A 1VOMA 3EG4A 4K8RA 1E6VA 2UXBJ 2UV8A 4C8ZA 2DNZA 1HNIB 2MLYA 5LMUF 4KPYA 1TFYA 3FWWA 4DV1F 1D3WA 2W2MP 4TNOA 1RT4B 2RQKA 2OI2A 4IOAQ 4Q2MA 2UUBF 1PKUA 1HV9A 3LGHA 4K4VA 1R6YA 2SXLA 1HBNB
chains in the Genus database with same CATH topology
4J09A 4G3PA 3BSSA 1QRMA 1V3WA 3I3AA 1NM2A 1KRRA 2RIJA 2IUAA 2V0HA 3DJ4A 3GOSA 3R5BA 2IU8A 4N27A 3VBNA 3T57A 2QJ3A 3VBKA 3P47A 4HZCA 4RR5A 1QREA 1MLAA 3OW5A 4AA7A 4IHGA 2GGQA 4IHHA 4H7OA 3EEVA 2ICYA 2NPOA 4KPXA 5AFUV 2I5KA 4N69A 4E6UA 1HM9A 4MZUA 3R5DA 4G3QA 5L6VA 1KRUA 1OCXA 2GGOA 4HZDA 1THJA 2OI5A 1KGQA 3GVDA 3EH0A 5E3PA 2QIVX 4EABA 4EGGA 1KHRA 1HM8A 3P1BA 3BXYA 3SRTA 5ADXV 3TZYA 3FSBA 1SSQA 3HJVA 2OI7A 4M99A 1XHDA 3HJJA 3SPTA 1G97A 3R3RA 3TK8A 2QC3A 1KRVA 2TDTA 4R7PA 3NZ2A 3VBLA 3HHDA 4AC3A 5L6SA 1KK5A 2Q4JA 3R2WA 3TISA 3FOQA 4IHFA 2WLGA 3BSYA 3EZOA 3I3XA 4ISXA 4E79A 1KQAA 3TQEA 2ICXA 4R37A 3OU9A 2VD4A 3BRKX 2XATA 3FTTA 3R5CA 3BSWA 4FCEA 4MYOA 4EA7A 4RL1A 1QQ0A 3EG4A 1XATA 1KK4A 2OEFA 2WLCA 3FSCA 3IGJA 3QATA 1YP3A 2QKXA 1LXAA 2P2OA 3DK5A 2IU9A 3KWCA 4G3SA 3MQHA 1T3DA 3IM8A 2V0KA 2W0VA 3FSYA 4K6RA 2WLEA 4M2BA 2W0WA 2V0LA 3R0SA 1HM0A 2QIAA 3R8YA 2V0IA 3H0PA 4G87A 1TDTA 2JFDA 4HUSA 5DEPA 3TZWA 4KQLA 4KPZA 2H1YA 5DZ7A 2IC7A 3V4EA 3R3IA 5U2KA 1FWYA 2JF2A 3JQYA 3D8VA 1YP4A 2G1HA 3IXCA 1V67A 3HSQA 1MR7A 3CJ8A 4N6BA 4EAAA 3GUEA 3FWWA 3OTZA 2JF3A 4KNXA 4E75A 2JFKA 3G87A 4HCQA 3KWDA 2G2ZA 3BFPA 2OEGA 1FXJA 3TDTA 4MFGA 2AQ9A 3SBMA 3OTMA 3PTWA 3RGIA 3FS8A 4M98A 5E3RA 2P5ZX 5AFUU 2CUYA 1Z90A 4J18A 3K89A 3IM9A 3VNPA 1MRLA 4QBUA 4M2AA 3TIOA 3VBIA 3D98A 3VBJA 5ADXU 3TZXA 2V0JA 3MC4A 4E1KA 5DZ6A 2WLDA 2FKOA 3KWEA 3MQGA 3ST8A 3TV0A 4E6TA 3Q1XA 2C2NA 1G95A 4AAWA 1KGTA 1QRGA 3VBMA 4DCLA 4KNRA 3R1WA 2G2OA 1S80A 5E3QA 4R36A 1MR9A 5F42A 4N6AA 3FSXA 1HV9A 3R5AA 4M9CA 4M28A 1SSTA 5DG3A 1J2ZA 3VBPA 3OUPA 1QRFA 4HURA 4EA8A 3R97A 1KK6A 3F1XA 4EA9A 3BV8A 5DEMA 2G2YA 2WLFA 2OI6A 3TWDA 3PMOA 3DHOA 1QRLA 3TZZA 1YP2A 3C8VA 3ECTA 4EQYA 2VHEA 1SSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J09 A;  4G3P A;  3BSS A;  1QRM A;  1V3W A;  3I3A A;  1NM2 A;  1KRR A;  2RIJ A;  2IUA A;  2V0H A;  3DJ4 A;  3GOS A;  3R5B A;  2IU8 A;  4N27 A;  3VBN A;  3T57 A;  2QJ3 A;  3VBK A;  3P47 A;  4HZC A;  4RR5 A;  1QRE A;  1MLA A;  3OW5 A;  4AA7 A;  4IHG A;  2GGQ A;  4IHH A;  4H7O A;  3EEV A;  2ICY A;  2NPO A;  4KPX A;  5AFU V;  2I5K A;  4N69 A;  4E6U A;  1HM9 A;  4MZU A;  3R5D A;  4G3Q A;  5L6V A;  1KRU A;  1OCX A;  2GGO A;  4HZD A;  1THJ A;  2OI5 A;  1KGQ A;  3GVD A;  3EH0 A;  5E3P A;  2QIV X;  4EAB A;  4EGG A;  1KHR A;  1HM8 A;  3P1B A;  3BXY A;  3SRT A;  5ADX V;  3TZY A;  3FSB A;  1SSQ A;  3HJV A;  2OI7 A;  4M99 A;  1XHD A;  3HJJ A;  3SPT A;  1G97 A;  3R3R A;  3TK8 A;  2QC3 A;  1KRV A;  2TDT A;  4R7P A;  3NZ2 A;  3VBL A;  3HHD A;  4AC3 A;  5L6S A;  1KK5 A;  2Q4J A;  3R2W A;  3TIS A;  3FOQ A;  4IHF A;  2WLG A;  3BSY A;  3EZO A;  3I3X A;  4ISX A;  4E79 A;  1KQA A;  3TQE A;  2ICX A;  4R37 A;  3OU9 A;  2VD4 A;  3BRK X;  2XAT A;  3FTT A;  3R5C A;  3BSW A;  4FCE A;  4MYO A;  4EA7 A;  4RL1 A;  1QQ0 A;  3EG4 A;  1XAT A;  1KK4 A;  2OEF A;  2WLC A;  3FSC A;  3IGJ A;  3QAT A;  1YP3 A;  2QKX A;  1LXA A;  2P2O A;  3DK5 A;  2IU9 A;  3KWC A;  4G3S A;  3MQH A;  1T3D A;  3IM8 A;  2V0K A;  2W0V A;  3FSY A;  4K6R A;  2WLE A;  4M2B A;  2W0W A;  2V0L A;  3R0S A;  1HM0 A;  2QIA A;  3R8Y A;  2V0I A;  3H0P A;  4G87 A;  1TDT A;  2JFD A;  4HUS A;  5DEP A;  3TZW A;  4KQL A;  4KPZ A;  2H1Y A;  5DZ7 A;  2IC7 A;  3V4E A;  3R3I A;  5U2K A;  1FWY A;  2JF2 A;  3JQY A;  3D8V A;  1YP4 A;  2G1H A;  3IXC A;  1V67 A;  3HSQ A;  1MR7 A;  3CJ8 A;  4N6B A;  4EAA A;  3GUE A;  3FWW A;  3OTZ A;  2JF3 A;  4KNX A;  4E75 A;  2JFK A;  3G87 A;  4HCQ A;  3KWD A;  2G2Z A;  3BFP A;  2OEG A;  1FXJ A;  3TDT A;  4MFG A;  2AQ9 A;  3SBM A;  3OTM A;  3PTW A;  3RGI A;  3FS8 A;  4M98 A;  5E3R A;  2P5Z X;  5AFU U;  2CUY A;  1Z90 A;  4J18 A;  3K89 A;  3IM9 A;  3VNP A;  1MRL A;  4QBU A;  4M2A A;  3TIO A;  3VBI A;  3D98 A;  3VBJ A;  5ADX U;  3TZX A;  2V0J A;  3MC4 A;  4E1K A;  5DZ6 A;  2WLD A;  2FKO A;  3KWE A;  3MQG A;  3ST8 A;  3TV0 A;  4E6T A;  3Q1X A;  2C2N A;  1G95 A;  4AAW A;  1KGT A;  1QRG A;  3VBM A;  4DCL A;  4KNR A;  3R1W A;  2G2O A;  1S80 A;  5E3Q A;  4R36 A;  1MR9 A;  5F42 A;  4N6A A;  3FSX A;  1HV9 A;  3R5A A;  4M9C A;  4M28 A;  1SST A;  5DG3 A;  1J2Z A;  3VBP A;  3OUP A;  1QRF A;  4HUR A;  4EA8 A;  3R97 A;  1KK6 A;  3F1X A;  4EA9 A;  3BV8 A;  5DEM A;  2G2Y A;  2WLF A;  2OI6 A;  3TWD A;  3PMO A;  3DHO A;  1QRL A;  3TZZ A;  1YP2 A;  3C8V A;  3ECT A;  4EQY A;  2VHE A;  1SSM A; 
#chains in the Genus database with same CATH topology
 1Q4R A;  2R7O A;  4LF5 J;  4K4T A;  1ZAW A;  5ETO A;  4OHY A;  4BCA A;  4GKJ J;  3R5D A;  1X4C A;  5CZX A;  1XMQ J;  3BXY A;  3ISN D;  3H5U A;  5AXN A;  3HSZ A;  3EVM A;  3PKY A;  4LF2 A;  5HMZ A;  2ZVI A;  4ISX A;  1W2I A;  4M5N A;  3FVY A;  2J5A A;  2MQO A;  1RWW B;  4OV6 A;  4ICL A;  5KFV A;  1JLF B;  5GAH U;  5I4M A;  3BBF A;  5C24 A;  2V2K A;  1CS4 A;  3M4X A;  2RSQ A;  5D0E A;  2XCP A;  2W7A A;  2HPU A;  5LXR A;  1V67 A;  3QGI A;  5I42 B;  2CG4 A;  1T05 A;  3TAQ A;  2LXU A;  2GVD B;  2EK1 A;  2I1R A;  3IG1 B;  1OYD A;  2HWH A;  4O3N A;  2KM8 C;  2KXH A;  3KLH B;  2J76 E;  2IC3 B;  3OLA A;  2AZ3 A;  3TWD A;  1TL4 A;  4DV3 J;  2CPE A;  4Q2L A;  3CCU S;  2HND A;  4ZLP A;  4ZVR B;  2HBQ B;  4AA7 A;  3CD7 A;  1FJ7 A;  3I0S A;  3KLG B;  5KFT A;  3QT5 A;  3QFW A;  4C98 A;  2JX2 A;  4CO1 A;  3QRR A;  1MN7 A;  3MEK A;  3R5G A;  1PAE X;  1G2E A;  2PI5 A;  4DL0 C;  1FEE A;  4RW7 B;  2DB1 A;  3GTY X;  4MT1 A;  4NXM J;  1TK5 A;  1S6P B;  4OZ3 A;  1RXO B;  4RUC A;  2UV8 G;  4C8K A;  3MR3 A;  2HVD A;  2B9W A;  2BOA A;  5IXU A;  2DTJ A;  5E3A A;  3T3F A;  1HI1 A;  3D6M B;  3RRH A;  1FRL A;  2DIT A;  1LW0 A;  2FLL A;  2IJF A;  4YFU A;  3NBP B;  2BAC A;  3I31 A;  1K1S A;  4ETX A;  3R27 A;  3JYT B;  3ZZP A;  4CH7 A;  2BRL A;  4F0H A;  3IC1 A;  1XJW B;  3EGN A;  1NJY A;  3OR2 B;  1VBY A;  3VAK A;  1TK0 A;  3PDN A;  2FLP A;  2ZH3 A;  2IY5 B;  4DI6 A;  1HNX J;  3BSS A;  3EXY A;  2QA2 A;  4ES3 A;  1WG1 A;  1S99 A;  4X64 F;  4F4X A;  4IRK A;  2NXN A;  3DI6 A;  1ZS6 A;  1HM9 A;  4I67 A;  4IKA A;  3CDA A;  3GVD A;  3NS5 A;  2PI4 A;  2X1G A;  2FDN A;  4MKY A;  3E2E A;  1U0S A;  4M99 A;  2HFS A;  3HM9 A;  5D0R A;  5KFG A;  4IFY B;  5KFF A;  4KO0 A;  3HO1 A;  3H4B A;  1NB7 A;  3N79 A;  2E5I A;  3A12 A;  1JNZ B;  1LXA A;  1SL0 A;  4MJK A;  3LAL A;  3HX9 A;  4KH0 B;  1M1H A;  3WC2 A;  2MZT A;  3HFV A;  1A6L A;  2UXD F;  5ETM A;  2QMU B;  1DTT B;  4ZKA A;  2MKK A;  1HWI A;  3BFP A;  5J2P A;  3W7B A;  1VLO A;  3TO8 A;  2ZH2 A;  1JKH B;  2A6O A;  4NPO A;  1ZET A;  3QRQ A;  2FKO A;  3CDW A;  4UW2 A;  5IM0 A;  4ENO A;  4ZP6 A;  3OD2 A;  4XO0 A;  2B9E A;  1PC5 A;  1PAU B;  5D3G A;  3THT A;  4AND A;  1U0H A;  3PNI A;  2Y1I A;  2Q1L A;  2X1F A;  1RCO B;  3Q0A A;  4HZC A;  4K5S A;  1QRE A;  2XSJ A;  4NA2 A;  5A8W A;  4K4Z A;  4LRE A;  4U8V A;  3M32 A;  1HNW J;  2YH1 A;  2HUR A;  2PT0 A;  2K1R A;  2VFS A;  1KR4 A;  1JWW A;  1XNQ F;  4F3M A;  1I3O B;  1X9M A;  4B3T J;  2YNI A;  3BH7 B;  4JI7 F;  4NLV A;  2HS4 A;  2POK A;  1HHQ A;  4C3L A;  3J7Y I;  2FZK B;  3MFH A;  2GVZ A;  1TKD A;  4CYU A;  4B3M F;  1UVI A;  4R5P A;  3NAH A;  1P27 B;  3KWM A;  4ED5 A;  1RU1 A;  1W2B R;  5J2M A;  4DG1 A;  1OQ6 A;  4CLW A;  2MGZ B;  3BPD A;  3OTD A;  4E0D A;  1FCA A;  4B9V A;  4OX8 A;  3DFE A;  2NYH A;  2D74 B;  2XY7 A;  3NMR A;  1HWU A;  2VIH A;  3D0H E;  2A1B A;  5KFL A;  3A8J A;  3PCO B;  4LFA J;  5E3Q A;  1S12 A;  2YNH B;  4HHH A;  4ERD A;  2IM3 A;  2HBR B;  2QO3 A;  4HVZ A;  1VQ6 S;  3OL8 A;  2DNQ A;  2IU8 A;  2M4M A;  2XYH B;  2XLJ A;  4DF8 A;  3L9Z A;  3UR3 C;  3EEV A;  5RUB A;  1MNE A;  1S6P A;  3AT1 B;  4KPC A;  2XHC A;  4OI2 A;  3BGF A;  1T9U A;  5C25 B;  1WG4 A;  2XMJ A;  1L5U A;  3POT B;  4NCB A;  2J0X A;  3KHL A;  3JTO A;  4PG5 A;  1TU0 B;  1RAD B;  1RHU B;  4YDD B;  3SYZ A;  5LSO A;  1K47 A;  2ASJ A;  3RTV A;  2DIV A;  4ED1 A;  3D7S B;  2HBZ B;  3CO9 A;  2RRB A;  3SIP B;  1EKR A;  2XO6 A;  2VFT A;  1R0A A;  3JB9 k;  2LYV A;  1KVK A;  1Y4Z B;  3TVK A;  1SC4 B;  3PIP Q;  4KV8 A;  4J18 A;  4M5G A;  3KHH A;  4O0N A;  3M9O B;  5L1I A;  3KDO A;  4K7Q A;  3MUR P;  3LWM A;  3R2D J;  2J9D E;  4RPF A;  3QYY A;  3NXZ A;  3MTK A;  4PG7 A;  4S0M A;  2R7T A;  4DCP B;  2FHO B;  5H9F J;  2V0H A;  4P52 A;  5IWA F;  1AXQ A;  3HJF A;  1N6Q A;  3AD8 C;  4F2S A;  2HK2 A;  1PBU A;  3BSA A;  2WVB A;  2I5J A;  2JVO A;  1KGQ A;  3J80 U;  1KHR A;  3GP9 A;  1HBM A;  2GNK A;  3C46 A;  3HKZ D;  2DGO A;  1VFJ A;  2HRY A;  4FN5 A;  1RAO A;  4MKV A;  2M70 A;  4I6Y A;  1BQX A;  4OMF G;  1GNK A;  2J9C A;  2HFZ A;  5GME A;  3UCZ P;  3VZH A;  3DRX A;  3CD0 A;  3E01 B;  2H5J B;  4QW9 A;  3IXQ A;  4I2P B;  4B9M A;  4DBQ A;  4LBH A;  4QPX A;  5B7W A;  1CEZ A;  5BR8 J;  5HBM B;  1FWY A;  3CC2 S;  2AW0 A;  3P5T L;  4ZOS A;  1KP6 A;  1S6Q A;  1AB8 A;  1EHW A;  3PR4 A;  2EG1 A;  4ECT A;  3W1Y C;  1APS A;  4BC9 A;  2K8G A;  1OS5 A;  2V9W A;  2GZO A;  3DDN A;  1NZ8 A;  4CWB A;  3FEZ A;  4LQ9 A;  3LF0 A;  2WSC C;  4PG6 A;  2F9J A;  3C8V A;  4RJV A;  1YJT A;  4PQA A;  3DXB A;  3FFI A;  4CT9 A;  5E7O B;  1HD1 A;  4TYA A;  5DDQ C;  2WRM A;  1OQ3 A;  5ETL A;  1IBC B;  4ECY A;  5A0Y B;  4A8X A;  5GAG U;  2HQC A;  1IBM J;  2HZC A;  4B9N A;  3OUY B;  2HNY A;  3QO9 B;  1BHN A;  3DOL A;  4K5R A;  1R3N A;  3CJ5 A;  2J8A A;  3CF5 Q;  3HT0 A;  5AJ3 J;  3BS9 A;  3HP6 A;  2CVI A;  4PAB A;  2COL A;  4TU8 A;  1S0V A;  4XPC A;  1GMW A;  3OH2 A;  3D5M A;  5KFY A;  4A8Q A;  4ZVF A;  5C42 B;  1UVN A;  1KBR A;  4DR3 J;  3J81 U;  2CPI A;  3RB6 A;  4N6B A;  3KHG A;  3BO2 A;  1JJ2 R;  1N48 A;  1UJ5 A;  3B6B A;  2QFI A;  3RBX A;  3TOQ A;  4FP9 A;  4I0W A;  4Z7C A;  3PO4 A;  3MEE B;  4HHU A;  2U2F A;  1URN A;  1AW0 A;  1JXV A;  5LMU J;  4OHV A;  4ZCL A;  1HHS A;  2XBP A;  1SKS A;  3DU5 A;  5KFZ A;  1CJT A;  1NSQ A;  4DXL A;  2AP6 A;  3B4D A;  3BF4 A;  2DXE A;  2GO8 A;  3OFH A;  4UOG A;  2HWT A;  2KVI A;  3LP1 B;  2VJU A;  2UUB J;  2FHK A;  4YDX A;  2GGO A;  4O4G A;  3MOJ B;  1N5Y B;  4RW8 B;  5CQG A;  2MLX A;  4U95 A;  4MK8 A;  4WE1 B;  2ZKU A;  3GCW P;  1UJ6 A;  4B3S J;  1F60 B;  1FKA F;  1NUE A;  1JLB A;  3DYA B;  1GH8 A;  4R37 A;  1S97 A;  3EMT A;  3H25 A;  1QQ0 A;  3FRZ A;  4PQU B;  4QOT A;  5HO4 A;  1S76 D;  3RB0 A;  2CXE A;  3S1T A;  3VAH A;  1VK8 A;  3TUI C;  1NH8 A;  3OSN A;  2Z30 B;  3ZTR A;  3M1V A;  3D8V A;  2NRE A;  1IR2 A;  3K5L A;  3DDK A;  3AOC A;  2XEX A;  3JXO A;  5ADZ A;  5E3R A;  2LEC A;  2KZZ A;  4KGK A;  2XI2 A;  4EZ9 A;  1UVL A;  1RBO B;  5DG9 A;  4JV1 A;  2KJV A;  4YB6 A;  3AXK A;  1UFW A;  4I6A A;  2OKQ A;  4WK1 A;  2CJQ A;  2UUA F;  2BJ9 A;  3QSY B;  1YJN S;  3VAG A;  5KFS A;  5J2N B;  4Y0F A;  4FF2 A;  1NBE B;  3G8S A;  4FVC A;  5MLC V;  3DHW C;  4G3Q A;  2PN6 A;  2H9Z A;  3EX7 B;  1HQE B;  2BYC A;  1FEH A;  1S7I A;  2E7V A;  3PJ9 A;  1C4A A;  2AEM A;  4QR2 A;  4ZVT B;  2WW4 A;  3M8P A;  1HQU B;  2JWN A;  1Y5L B;  2E7W A;  1CQN A;  4PWD A;  4HH0 A;  1TL1 A;  3NGD A;  3LQV A;  4NYZ A;  4DZD A;  1Q8K A;  2QSW A;  4I69 A;  4CP5 A;  3J7Z 5;  1FJE B;  2O3D A;  4OYP A;  4TU7 A;  1ZTT A;  5KFK A;  1IJE B;  2CJX B;  3R8Y A;  2DNO A;  1RLD A;  3CJT A;  3ILI A;  1FTR A;  2EFN A;  3GG0 A;  1CG2 A;  3JQY A;  5A6W A;  3IXC A;  3TX0 A;  4JI6 F;  2J7W A;  3D9B A;  5ETT A;  2JFK A;  2XNR A;  1Q78 A;  1VK3 A;  3DRY A;  1D8Z A;  1YJR A;  3S8S A;  3BDE A;  2RF2 B;  2VG6 A;  5BYQ A;  2Z57 B;  4ZPW R;  3NWR A;  1SJ1 A;  4E1K A;  2ADB A;  1DLO B;  3VCD A;  4ZP7 A;  3T1Y J;  5SUH A;  3GYG A;  2ROE A;  2EFV A;  2MKH A;  3N28 A;  5D4O A;  2DVI A;  3LO3 A;  1MG7 A;  5D0H A;  3DC2 A;  2R2R A;  1NK6 A;  1FRX A;  1B7Y B;  3BN4 A;  3RB4 A;  1TVR A;  1FE4 A;  3TJ9 A;  2CJA A;  3RZA A;  4NI2 A;  1KRP A;  1MU2 A;  1N0V C;  3AA8 A;  5G0R A;  2K3K A;  2HGN A;  1SKR A;  2JEG A;  4G6V B;  4BC7 A;  1RK8 A;  2PD1 A;  3TK8 A;  2C3O A;  1HMV A;  5FJ4 A;  4ECX A;  1XTZ A;  4X64 J;  2ZWP A;  1JLC B;  2V4R A;  1Q53 A;  3R5J B;  4DR5 F;  1WI6 A;  3V6D B;  2LQ8 A;  1RTI B;  4K59 A;  3PM9 A;  1G3O A;  5CCM A;  5A8K B;  5U47 A;  2R8K A;  5CZV A;  2J0Q D;  4Q0B A;  5LXY A;  2AX1 A;  1D9A A;  5EN1 A;  2V8P A;  3C6U A;  3QAE A;  4WFX A;  2QZ8 A;  3ULH A;  1CVJ A;  4G1Q B;  4YY3 J;  5CA5 A;  2XLI A;  4DSK A;  1GMV A;  2DR9 A;  4EBE A;  2KKH A;  2UXD J;  1RB0 A;  1S5Z A;  1YJV A;  3IR5 B;  3OR1 B;  2PO4 A;  2NLW A;  4RU9 A;  1QVF R;  2RQ4 A;  1VIX A;  3Q8Y A;  4X4N A;  1R0C B;  4J9N A;  2B6A B;  2B8P A;  3DHX A;  1CQM A;  1LW2 A;  3QWP A;  5B0A A;  3BPS P;  1NM2 A;  4FVM A;  4WXW A;  4ZP8 A;  2GX8 A;  1BQM B;  4DPW A;  5HVH A;  3Q89 A;  4ZS6 A;  1VDH A;  3QIP A;  2R8J A;  3NZ2 A;  4CO5 A;  4WFB Q;  3FEX B;  3D3B J;  3VQS A;  1KTV A;  2YWE A;  3K8V A;  4GVL A;  2XZT B;  3ILJ A;  4GC6 A;  4RL1 A;  4O3Q A;  2QMX A;  5F9N A;  1C1C B;  3TA2 A;  4WP9 A;  4RBT A;  3K5O A;  2JLF A;  4AE5 A;  1T3D A;  4ILM A;  2CQP A;  3K5P A;  1Y0H A;  5DQG A;  3DRS A;  1XNQ J;  2R8I A;  4X2B A;  2PC6 A;  1OYE A;  3ZZO A;  1I94 J;  4JI7 J;  4TLQ A;  5DDR C;  2J6S A;  2ZH4 A;  1IKW A;  5KFH A;  1Y3J A;  3TRG A;  3M8R A;  1J5E F;  4DSJ A;  5C2G A;  5KT6 A;  2IAJ A;  4B3M J;  4DV0 F;  3NGR A;  1EKS A;  3CDE A;  1SUQ A;  2QRR A;  3R5A A;  4OLP A;  2V94 A;  2O5D A;  4EFA C;  2AT1 B;  1QRL A;  5KAK A;  4IRD A;  1S57 A;  5EX0 A;  3MMA B;  4A8K A;  1HQU A;  1UEU A;  4FZV A;  4ZVO B;  1RTH B;  1SJQ A;  1VBZ A;  4DS5 A;  4USU A;  1RT1 A;  1I5O B;  4JYA F;  4F26 A;  1JLQ A;  3SCJ E;  4OYA A;  4PG8 A;  2LCW A;  4O44 A;  5B0G A;  4M94 A;  1KHV A;  4DR2 J;  4DPY A;  1MN9 A;  4WTO B;  2QG9 B;  2QL7 B;  5HMW A;  4M5H A;  3OH4 A;  2HHV A;  4EA7 A;  3V81 A;  2XMA A;  2R4F A;  1KLM B;  3IGJ A;  2WLC A;  4L3K A;  1K73 T;  4ELT A;  4C11 A;  1U1N A;  3MQH A;  4HI1 A;  1IQZ A;  1FNO A;  4MKA A;  2A6M A;  4OYX A;  3RYL A;  2RHS B;  4QIV A;  5F8J A;  1T03 B;  1LV5 A;  4GO7 X;  5K5M A;  1LWF A;  2HS0 A;  5HP1 B;  3MD1 A;  4USM A;  2NPF A;  4PXB A;  3ZZT A;  3N5B A;  1N88 A;  2ZNZ A;  3AJ1 A;  3MOZ A;  3A3O B;  3KFW X;  2R8G A;  2HEK A;  1P1L A;  4KT0 C;  3Q2S C;  3U27 A;  4OX9 J;  1VRT B;  4OZ1 A;  3QPI A;  5D78 A;  4CRJ A;  4MTP A;  4I7F B;  3FUY A;  3ETM A;  4FYW B;  1B70 B;  3EM1 A;  2CKW A;  1JLC A;  2EKN A;  4XTT A;  4AUK A;  2OSR A;  5HQL A;  3MR5 A;  1QLN A;  3SRT A;  3NOC A;  4XDD A;  4RNM A;  1ZA2 B;  2JHE A;  1RCX B;  5IWA J;  4DU7 A;  2Y8Y A;  1VJQ A;  3OQ2 A;  2DGS A;  3PZP A;  1IKY A;  5JMN A;  2YKO A;  2N7Y A;  2KTQ A;  3UNG C;  1KC8 T;  3LA0 A;  2VZ9 A;  4ELV A;  1SVD A;  2XS5 A;  2HMI B;  4LFC F;  3GV5 B;  2D3O R;  2Y0S D;  1RUS A;  4OZN A;  2HGL A;  2VB6 A;  3NLC A;  3L7U A;  4OLO A;  3M05 A;  2CZ4 A;  4EK2 A;  3VZI A;  1DQA A;  4USK A;  4OJH A;  1T7P A;  2GML A;  2CJB A;  1GEH A;  3MAA A;  4WKY A;  3VV2 B;  3DOK A;  2EPI A;  3GFH A;  4K4W A;  3VBI A;  3MPD A;  1EET B;  4ID5 B;  4TN2 A;  4I2Q A;  4B3R F;  3LGN A;  3BSC A;  2CJK A;  5L9X A;  2ZUA A;  2VOP A;  2L41 A;  2XSF A;  3QID A;  2VBX A;  5C2C A;  4FF3 A;  3RAQ A;  2PMW A;  3H59 A;  3CB4 A;  2FY1 A;  2IM0 A;  4ZPB A;  2QX0 A;  2XG8 A;  2AGQ A;  1X9S A;  1NXI A;  3KLI A;  1FDB A;  1QTM A;  2XQC A;  1W26 A;  4X4R A;  1NHU A;  3FOQ A;  3MWB A;  3KLE B;  1IWG A;  1UW9 A;  2XHW A;  5BXI A;  2GAH C;  3FSC A;  3E3X A;  4G3S A;  1C4C A;  2W0V A;  2R3V A;  2ZEJ A;  2RAQ A;  3I5B A;  4B3O B;  2A18 A;  3CUN A;  1U26 A;  1Y7P A;  5KG6 A;  1AUS L;  1RHQ B;  2JC1 A;  2OEK A;  4LSN A;  1VC6 A;  3AHP A;  3H5S A;  1F2H A;  3Q22 A;  2ZJR Q;  2N3L A;  3VTI A;  3FKB A;  4HR2 A;  4K4U A;  1QUP A;  3MR6 A;  3OLB A;  2BE2 A;  1OSD A;  3Q83 A;  1JJH A;  3OUP A;  2F8H A;  4B08 A;  1REV A;  5DGA A;  3OL9 A;  2Z2Z A;  4LR7 A;  2XI3 A;  2KT3 A;  3NS7 B;  2E9R X;  5K14 A;  4BS2 A;  2KRR A;  2IRU A;  4DR7 F;  1RTD B;  4P72 A;  2ZH7 A;  3IRX A;  4HL9 A;  5DQI A;  3R2C J;  1VI7 A;  3UDC A;  4FS1 A;  1FWK A;  1KRV A;  1FES A;  2G0C A;  4LBI A;  1T8E A;  3BM7 A;  1IWA A;  2Z2Y B;  5J1E B;  4M95 A;  3LH2 S;  2L9W A;  2MPU A;  3K8W A;  1TMM A;  2R7R A;  4KFB B;  2CVE A;  2FJE B;  3MXH P;  5K9F A;  1SH2 A;  4ED4 A;  2ATL A;  1MML A;  2B7B B;  4YB7 A;  1MWQ A;  3CCZ A;  1FX2 A;  2E5H A;  3W2V B;  4AL6 A;  2ZJP Q;  3HI9 A;  4UQT A;  4ZVG A;  2V6A A;  4ALZ A;  1CJU B;  1HNZ F;  2UP1 A;  4PPD A;  3H4D A;  3FQK A;  4UT4 A;  3VAI A;  4QU7 A;  1SST A;  1J2Z A;  2XCA A;  3SQO P;  1IBK F;  3E51 A;  1ZH5 A;  4FYD A;  4ZLJ A;  4ED6 A;  1JNR B;  3ET6 B;  2R7X A;  2PFD A;  1YLX A;  5F41 A;  5ITH A;  4E98 A;  1OCX A;  3W5Y A;  2IDE A;  1QVG R;  2GJI A;  3PX4 A;  2WB4 A;  2LXF A;  2AYG A;  3KK3 A;  4FYY B;  2IM2 A;  2DCU B;  4JV2 A;  2XMW A;  3Q8Q B;  2UUT A;  1NCL A;  2BR0 A;  2HFO A;  1T02 A;  2YNF B;  1N54 B;  1VQ4 S;  4ID8 A;  2E1A A;  4XAK A;  3S6E A;  3NEK A;  4DSL A;  4IR9 A;  1BQN A;  2OPQ B;  3GIJ A;  1WC3 A;  3KYL A;  3DLL Q;  2ZM6 F;  2V5H G;  1RQ0 A;  1Z4U A;  3CMA S;  1GMU A;  3CNQ P;  3JSB A;  2ROP A;  4ED2 A;  1O51 A;  5HVG A;  2DO0 A;  3CCV S;  4N76 A;  3US5 A;  4JI6 J;  3WX4 A;  4X4S A;  3QZ7 A;  3OFF A;  2M0G B;  1SC3 B;  3VBK A;  1Z2F A;  2RH3 A;  4DUT A;  3WDO A;  2BBE A;  4Y2K A;  5KOW A;  3R7B B;  1FKP B;  2YKM B;  3ZTS A;  4OHZ A;  2R9L A;  4HTI A;  2ZH8 A;  2V2Z A;  1TL3 A;  3FCW A;  3TQE A;  4DX6 A;  3HVT B;  3HCX A;  2YH0 A;  4A8F A;  3CCT A;  1CPZ A;  4LF1 A;  1X5T A;  2C2M B;  1IVZ A;  2MKI A;  5G4D A;  4DR5 J;  4L76 A;  4DJB A;  5KG4 A;  1TL7 A;  1JLG B;  2GHW A;  2C28 A;  1YGY A;  2B0G A;  1YZ6 A;  3M8Z A;  2DNR A;  2IVM A;  5HAO A;  3BH6 B;  2BJE A;  2E44 A;  1BWV A;  5CHC B;  1F3F A;  1VQY A;  4WU2 A;  3E8O A;  3ZZ0 A;  4DU8 A;  4PWW A;  3N4W A;  4ZPT R;  2IUA A;  2RE1 A;  1U1K A;  3IP0 A;  4DV6 J;  4L72 B;  1IR1 A;  2CPF A;  1C0U A;  2HG4 A;  5M2U A;  3QLH A;  1RT7 A;  3HHN B;  3A8E A;  1TUV A;  5M2R A;  1U6Z A;  1SXL A;  2KN4 A;  5L6S A;  4LJM A;  1YKW A;  3FDS A;  3DRP A;  3M2R B;  4O3O A;  3UO0 A;  3D54 A;  3RG6 A;  2MDA A;  1NEE A;  3FBC A;  1BE4 A;  3ZNJ 1;  1LWE B;  3NP5 A;  3I0R A;  4Y2C A;  2G4B A;  3CCJ S;  2HNZ A;  1CUL A;  3MZI A;  2DPI A;  4XK8 C;  1S6O A;  2FGO A;  2QLJ B;  2BZ2 A;  4IG3 A;  1VRQ C;  4A47 A;  4LF7 F;  2LQ9 A;  2CUY A;  3IS9 B;  1IN0 A;  3WBZ A;  3AJD A;  5EWE A;  3LP0 A;  1HPZ A;  4N7T A;  4N6A A;  1H3D A;  3KXD A;  3QMQ A;  1MMN A;  1PJ5 A;  1S1U A;  3KJQ B;  3MPY A;  2BQR A;  1N36 J;  3Q2T C;  2OD6 A;  1J5E J;  2I0X A;  2MZQ A;  3R5B A;  2HFU A;  1WD6 A;  1N4L A;  4AL5 A;  1GAO A;  1BUX A;  1ZYQ A;  4AD6 A;  2DNG A;  2CDR B;  3M2V B;  2GCF A;  3GIR A;  2GQC A;  5HMY A;  3CJS A;  1SSQ A;  2DNP A;  4CLT A;  2B5J B;  4U67 Q;  4WFN Q;  1VC5 A;  1RTJ B;  3DKD A;  2WSF C;  3ENW A;  1WEZ A;  1WF0 A;  1KHW A;  2WLG A;  3W61 A;  1QE1 A;  3I9V 9;  3WC0 A;  3IRW P;  3M8Q B;  5E2Q A;  4MYO A;  1EZZ B;  3CD5 A;  1AFI A;  2H5E A;  1WOO A;  4H4M A;  4ZDN A;  2DNK A;  5HLF B;  3CVK A;  1REG X;  1JIH A;  3J7Y U;  4FYV B;  1H2V Z;  2J9E A;  4OI3 A;  3I56 S;  3V4I B;  1RT6 B;  1WC0 A;  5JVH Q;  3SBM A;  3HZE A;  3OW2 R;  1FI4 A;  3HUL A;  4QWD A;  1NK7 A;  1Q8L A;  2HVI A;  4ZVE A;  2V63 A;  1FVQ A;  4ZCK A;  4HUR A;  4DSE A;  2VDI A;  2IFX A;  5KFC A;  4CTA B;  2RKI B;  3LWL A;  4C4W A;  3SFG A;  1N33 F;  2FTR A;  2GIF A;  1U1L A;  5CYM B;  1MW7 A;  1KFS A;  2R42 A;  2JEF A;  3FZB A;  4U96 A;  3DMJ B;  5HQM A;  2KRB A;  3TVZ A;  2RIL A;  2B9X A;  1NJX A;  5IT9 U;  2H65 B;  1PSD A;  1VLY A;  4ER8 A;  4K0K F;  5D8H B;  3SV3 A;  2D69 A;  1V3Z A;  4FF1 A;  3M8S A;  2XYG B;  2B9Y A;  3M6X A;  1RJJ A;  4LF5 F;  3NG8 A;  4C8L A;  1KNZ A;  1IKV B;  1RHK B;  3PX0 A;  1VQN S;  4GKJ F;  2ZZT A;  5EGY A;  4E75 A;  1VQK S;  4EBD A;  4O4R A;  2AQ9 A;  3MDF A;  3OTM A;  3W5X A;  2W24 A;  2P5Z X;  2VFV A;  3MM8 A;  3KUG A;  4Y2A A;  4LFC J;  2WVD A;  2GHV C;  1RWM B;  4FKY A;  1CJV A;  3GLJ A;  3EUN A;  3JSM A;  3ST8 A;  3AOA A;  2DGT A;  2EFP A;  3WQP A;  3OHA A;  3AH6 A;  2PE8 A;  5CH7 B;  3ZTQ A;  2U1A A;  5JVG Q;  2FVQ A;  4DCO B;  1ZM9 A;  4YP3 A;  4E2F B;  4RW4 A;  4N56 A;  2X1A A;  2RRN A;  5EWF A;  4V19 J;  4MK9 A;  2YY3 A;  1F2G A;  2L48 A;  4F3Q A;  4RR5 A;  3R9L A;  1U25 A;  4B3R J;  4GVB B;  4YUD A;  1QAI A;  3CCE S;  1AFJ A;  3GQ9 A;  3PW0 A;  5K8M A;  3QNW B;  3O1L A;  1Y10 A;  3TAP A;  2B43 A;  4A46 A;  2QLB B;  5FII A;  1FTC A;  4F4K A;  1WDD A;  2VPY B;  2W7P A;  5J2Q A;  1ARO P;  4ETZ A;  4UST A;  4DV3 F;  2XB2 D;  2QN6 B;  3FSY A;  1EAR A;  5HN0 A;  2ALY B;  3WHI A;  1ULR A;  1YDL A;  2Z4P A;  5F8N A;  1O5J A;  4NMX A;  1S9G B;  3C8Y A;  3T19 A;  2GAG C;  1KQS R;  3KUE A;  2F9D A;  4PYA A;  3C15 A;  4M2A A;  3TIO A;  3DRR B;  3TV0 A;  3ELH A;  4LSL B;  3QT8 A;  4NXM F;  3VBP A;  2WAQ D;  4ZHR A;  2YKN A;  2L08 A;  2OFH X;  2GW8 A;  2P9C A;  1HBU B;  2W9C A;  5A8R B;  2EBE A;  4DL7 A;  3CMQ A;  2PMH A;  4YR3 A;  2ICY A;  1S1T B;  2C3Y A;  1YBU A;  1LEO A;  3NCP A;  1H38 A;  4OYZ A;  3UD5 A;  3CXC R;  4LVN P;  2AJF E;  3LAN A;  1UVM A;  4J91 A;  1M5O C;  5H9F K;  2Z58 B;  3MEG B;  5ETV A;  3SFU A;  2RVJ A;  1FJG F;  3VWS A;  4OL8 A;  3C3L A;  1HNX F;  4QIF A;  2H48 B;  3AA9 A;  4QU6 A;  5DG8 A;  4DV4 J;  4ZN1 A;  1HLW A;  4HLB A;  2GJ2 A;  3MPW A;  2ZKT A;  4WJB A;  2BRK A;  2VG5 B;  2OIH A;  3HD1 A;  4U7C A;  3GYX B;  2I6W A;  1CLF A;  5KFU A;  5DQH A;  5L1L A;  3BSN A;  2MKJ A;  1JLA A;  1SQE A;  3QSI A;  4JP8 A;  4NLU A;  2CQ4 A;  3G82 A;  5KT3 A;  2FHM A;  5IOL A;  1OY9 A;  2N4D A;  2OO4 A;  1WHX A;  1B0T A;  5F8M A;  1UP1 A;  2CPJ A;  4NZ0 A;  2Q66 A;  5IC6 B;  1NDP A;  1U6B A;  2XM3 A;  3EJM A;  3ENQ A;  4DEZ A;  1I6J A;  4F0K A;  1UKU A;  1HNZ J;  4DLE A;  2NPO A;  4E6U A;  3CJR A;  3MM6 B;  3ZFV A;  3P1B A;  3K5M A;  3IN5 A;  2WVF A;  3ILO A;  5IFM A;  1EX8 A;  4C2M A;  3M9N B;  1NK8 A;  3UNY A;  3KLF B;  2ZD1 B;  4DL2 A;  2KH9 A;  3PVX A;  2WZ1 A;  4MKB A;  2LDI A;  3W64 A;  1NPP A;  4NWB A;  1DTQ A;  3GJT B;  4HUS A;  4LMZ A;  2JOQ A;  1V3S A;  2DHS A;  3R3I A;  4D3G A;  1X9W A;  4EYI B;  2DJW A;  3I5C A;  1SJ3 P;  4H4O A;  3JSR A;  1YIJ S;  3LAK A;  4ZLN A;  3B82 A;  3T41 A;  1RWO B;  2YNG A;  4B3T F;  4DX7 A;  4V19 X;  2J7K A;  4IH5 A;  1NKC A;  1SV5 B;  4Y2I A;  4F0M A;  2BQU A;  1YJW S;  2J9D A;  2BE9 B;  3BGL A;  1RU2 A;  4KKO A;  2MKS A;  2BAB A;  2I8E A;  3DLH A;  2CFX A;  3N5F A;  4OZ0 A;  3GJS B;  3K2Y A;  4O0I A;  3I87 A;  3D0I E;  4R8U B;  2RD5 C;  3V6H A;  4YQW A;  2GMJ A;  1A7G E;  4X4Q A;  1HFE L;  3O3L A;  3CJ0 A;  1HQ2 A;  5LM7 E;  3WX8 A;  2VPX B;  2ZE2 A;  4LFA F;  2RUG A;  3CIZ A;  2PA3 A;  4OZ2 A;  3MF5 A;  4MMO A;  1RAB B;  3IMQ J;  2JC0 A;  1RAF B;  4B02 A;  1E6V B;  3UCU P;  2BJ3 A;  2CNO B;  3I82 A;  3UN2 A;  5FDL A;  3C6T A;  2RQM A;  1KS2 A;  3G6V A;  2QL5 B;  1FNM A;  1K9M T;  2BJ1 A;  1FFG B;  3M6V A;  3C19 A;  1DJ0 A;  3K5N A;  4UUX A;  5GMD A;  3KK1 A;  2PSZ A;  2ZWO A;  4H54 A;  1WEY A;  2O67 A;  1QRG A;  2KFN A;  2HQI A;  3OVS A;  1BXN A;  2WOM A;  4JB8 B;  3DLB A;  2B4O A;  3EGW B;  1IKX A;  3BGO P;  3W2W A;  1URR A;  1LFP A;  4FXV A;  4XDC A;  1SH3 A;  3RBZ A;  2K06 A;  3D4J A;  2BJ8 A;  4ES1 A;  1X8D A;  4C97 A;  6FD1 A;  4CLP A;  1KDN A;  1I1G A;  3W60 A;  5ETK A;  2VQF F;  3UVJ A;  3PKM A;  2W9A A;  4PUO A;  3AQO A;  4IHF A;  2AJ4 A;  2MQ8 A;  3FTT A;  3GR0 A;  1TKX A;  2GGP A;  4Y6I A;  4ICL B;  2ATC B;  2P2O A;  3OTO J;  5C24 B;  1CS4 B;  1TDT A;  4OI4 A;  1SIW B;  2Y1J A;  4Z37 A;  4DL4 A;  1WSR A;  4USV A;  4EAA A;  4FNH A;  1T05 B;  1NDK A;  3QWU A;  1NLK L;  4CIO A;  3SI8 A;  4NL5 A;  2OPS A;  3OHB A;  4UOF A;  3Q8V A;  1VMB A;  4L75 A;  5B08 A;  1FXL A;  3RW7 A;  3PYE A;  4LF7 J;  2KT5 A;  1YBT A;  4X84 A;  4J09 A;  2BAN A;  3RJM B;  2HND B;  1IM4 A;  3OTC A;  5BR8 F;  1WEX A;  3I0S B;  2G0I A;  4EAB A;  4WTY A;  4QYZ K;  1LK5 A;  4IG0 A;  3RAM A;  3TA1 A;  1LWC A;  3SCI E;  3UN3 A;  3AJ2 A;  1HA1 A;  3BSW A;  4RW6 A;  1B0P A;  1FXD A;  1UVK A;  3MM9 A;  1OMS A;  1K0T A;  2VKR A;  1HM0 A;  2QIA A;  2W8K A;  1S0M A;  1HBO A;  4F4Y A;  1NKE A;  3A8K A;  5FLX Y;  1LW0 B;  4KSE B;  3IWL A;  4C8N A;  4J9V A;  2C3M A;  2ALZ A;  1FT8 A;  4CO2 A;  1BY9 A;  4QBU A;  4I6W A;  1WOR A;  4X62 F;  1D1U A;  3TUZ C;  4IYQ A;  1FO1 A;  2ZHA A;  1VR6 A;  2B56 A;  3H90 A;  1TAU A;  3QT6 A;  1U8S A;  1WC6 A;  5IC4 B;  2Z0G A;  4J9S A;  2MHE A;  3F0N A;  1UPP A;  2KB2 A;  2W01 A;  3RRK A;  1HYS A;  3D2W A;  4C8M A;  4DR3 F;  4PPZ A;  5L46 A;  3BEG B;  3DI6 B;  1THJ A;  2OEM A;  5ETN A;  1PYS B;  4FBT A;  3T1H J;  4DR1 J;  1KQG B;  2JJ4 D;  1N33 J;  2CPZ A;  3PR5 B;  3R2W A;  1X5O A;  4KO0 B;  1S1X A;  3BRK X;  3SDE A;  3CWJ A;  2NXC A;  2E5J A;  1HI8 A;  4IFV A;  2V0L A;  2DHA A;  4TKT A;  2VPW B;  3PJW A;  3VGS A;  4K0K J;  1U1P A;  1PCA A;  2K7K A;  4Y65 A;  3MM5 A;  5F3Z A;  2HAF A;  2FZG B;  2I2Y A;  1U1O A;  1BMQ B;  1WOS A;  5J2P B;  5IS2 A;  5IV4 A;  3M6U A;  1SKW A;  2OAU A;  4B3S F;  2WLD A;  2G2O A;  1V5I B;  3P8B B;  2G0J A;  5IM0 B;  4OQJ A;  3BV8 A;  3TX8 A;  3QGG A;  5D3G B;  2HIY A;  1F3V A;  1U0H B;  2ZHO A;  1P9Y A;  3RAX A;  1WHV A;  1FFS B;  1BLU A;  1VQ5 S;  3GFY A;  4NZ7 A;  4F04 B;  2R2T A;  2XSJ B;  5A8W B;  2W2O P;  5L6V A;  1HKA A;  1FXR A;  3M32 B;  2V8G A;  1Q95 G;  2CPX A;  1TR0 A;  4CO0 A;  3R7S B;  4DL6 A;  4QJV A;  3L95 X;  3QGP A;  2JLE A;  1NRK A;  1RT5 A;  1KTQ A;  2K1R B;  2W9B A;  3AXM A;  4NEY A;  1Z1Z A;  3V4M A;  2YNI B;  2ZVS A;  3NGK A;  3T6B A;  2R2U A;  4FXW A;  2ROG A;  4X4P A;  3EZU A;  2W2N P;  4UF4 A;  3HHK A;  2VPZ B;  2QYC A;  1YI2 S;  1RT2 A;  2FVP A;  4DF4 A;  4CT8 A;  1SI9 A;  4RUA A;  3BB5 A;  2GVZ B;  2C2R A;  4IO1 A;  3KKF A;  3SCL E;  4CYU B;  3DLG A;  4R5P B;  2WHO A;  5J2M B;  2OEG A;  4DG1 B;  1ZZF A;  2UVR A;  2DIU A;  2YQ1 A;  3H2L A;  2V4J A;  4FBU A;  2XC9 A;  1S1V A;  4B9L A;  2VHG A;  3D66 A;  1C1B A;  4ZPC A;  2YPY A;  1FJC A;  2HKE A;  1C0T A;  2OML A;  4WFA Q;  2V34 A;  4NCA A;  1OWX A;  2AYM A;  4LF6 F;  3FBF A;  2FUG 9;  2NZ4 A;  1UZH A;  1LWX A;  5KG1 A;  3C16 A;  3VAJ A;  1RAI B;  3HJJ A;  2RDJ A;  5CYJ A;  2F5G A;  2FC8 A;  1FE0 A;  4PEO A;  1HR0 J;  3T1Y F;  4CNZ A;  2BUN A;  1YG0 A;  4M8L A;  2BM0 A;  2F8M A;  3G8T A;  3KJN B;  3VGU A;  1B99 A;  1GXT A;  5B0B A;  3PV8 A;  3T5H A;  2KL8 A;  2WLE A;  1ZZN A;  5LSL A;  3GG1 A;  5D0G A;  3DLE A;  3SEO A;  3BR9 A;  3ISN C;  3K7R A;  3TZW A;  4MIW A;  1PIE A;  1VQO S;  1R0A B;  2DBB A;  5T7L A;  4CH0 S;  1FJG J;  3PRV A;  3FBE A;  2LDY A;  4F2R A;  2NSC A;  2DHX A;  4JI2 J;  4C7Q A;  3X1L B;  3K89 A;  4RNN A;  3VNP A;  4HT7 A;  4KV8 B;  3MCM A;  3BQ0 A;  3VBJ A;  4IH6 A;  1VQ8 S;  2YQ0 A;  2FYX A;  3G2X A;  1ZAX A;  2CNN B;  2AWZ A;  1T9X A;  1B4S A;  4WZQ A;  1YP2 A;  2H4Y B;  4DR4 J;  4KJI A;  4WU3 A;  3UD4 P;  3N6N A;  1N6Q B;  3PW2 A;  4CQ1 A;  2I5J B;  3EDQ B;  1VHF A;  4YY3 F;  3LPE A;  1HBM B;  3U02 A;  3ZXW A;  3MCO A;  2H4W B;  2QC3 A;  3EPG A;  4ECS A;  3G6X A;  5ETP A;  1U1R A;  1P8G A;  5KFA A;  2F8E X;  2XAT A;  3RUB L;  5ETR A;  4DFP A;  1JQG A;  5KFI A;  2V0K A;  3OXG A;  4C8Y A;  3BGR A;  2HHU A;  2FPH X;  4M63 A;  2LA6 A;  2XWY A;  1EQM A;  2F1F A;  2GO9 A;  4P7T A;  1SB6 A;  3AY0 A;  1S6Q B;  2QA4 G;  3KK2 A;  2GA7 A;  5GVQ A;  4MFB A;  4EEY A;  3DLJ A;  1YJ7 A;  3SUC A;  2HLU A;  2Y3Y A;  1S80 A;  2ZBR A;  1HAR A;  3UN5 A;  2IJN A;  3VGT A;  4HDG A;  4LF8 F;  3OV7 A;  3MEC A;  2C3P A;  4N27 A;  4WPA A;  4M5J A;  4I64 A;  4NZ6 A;  3FFI B;  2C22 A;  1GTE A;  1PJ6 A;  1TKZ A;  1I94 F;  2CPH A;  1WTB A;  2X7I A;  2AHO B;  5KT7 A;  4C3K A;  3BO3 A;  5H9E K;  2HNY B;  3DOL B;  1NND A;  1RWN B;  4WIQ A;  2FZC B;  2LQ5 A;  5B0F A;  4ZVQ B;  1K1Q A;  2VG7 A;  3OH1 A;  3RR7 A;  2NQP A;  1H0H B;  3GON A;  4RNO A;  3CJ2 A;  2EXU A;  5DJB A;  4CLY A;  1CC7 A;  1RAJ A;  1M0S A;  4BBY A;  2IA6 A;  2VOO A;  3CJK A;  1Q8I A;  1H98 A;  2Y9H A;  2BM1 A;  2E9Z A;  2CQG A;  4DR2 F;  4WII A;  4IQM A;  1MRL A;  1AZS A;  2IRY A;  2VC0 A;  2NS1 B;  1HHT P;  3O8W A;  2M5Y A;  3NGS A;  1J5O A;  4OI6 A;  4JV5 J;  1D8Y A;  4EA9 A;  1Y5N B;  4YB5 A;  1CJT B;  2HFN A;  3VBN A;  4M5D A;  2JH3 A;  2WVE A;  4KPX A;  1M5V C;  2OUG A;  4Y34 A;  1KOH A;  1NPK A;  4WP3 A;  4O4G B;  3M2U A;  4NRT A;  4TY8 A;  2XZW A;  2P5V A;  2FJX A;  4ES2 A;  1J2V A;  3PAC A;  2RU3 A;  4Z7Y A;  4F50 A;  4D3H A;  1VRU A;  4U9R A;  5CYQ A;  2ZH9 A;  1JLB B;  4JI4 J;  2HVZ A;  4OX9 F;  3SSS A;  2MHN A;  5THW A;  4AXJ A;  4TYB A;  4OYW A;  1J27 A;  2DH8 A;  4OHW A;  2DNH A;  4IDK A;  5ETQ A;  1IUJ A;  1UEV A;  4QIG A;  2KG1 A;  4A8S A;  3TEH B;  2VQF J;  2C2Z B;  1R27 B;  3V2U C;  2IC7 A;  4CH1 A;  3M1V B;  2Z2M A;  3WIU A;  5F8L A;  1N5T A;  4O3R A;  2XMM A;  3IM9 A;  1FRK A;  3MAQ A;  3G9C A;  4Q8E A;  2YX1 A;  2V68 A;  2WW8 A;  4EI2 A;  3GIK A;  5LT5 A;  2EFO A;  4DR6 J;  3DLK A;  1H2T Z;  4DFJ A;  4X66 F;  2QYG A;  4J9P A;  5HVF A;  2IMW P;  1S1W A;  4NXN F;  2NUH A;  3J81 j;  1WDT A;  4LF4 F;  2VON A;  1F5A A;  3HHL A;  4Q44 A;  3CCW A;  1HM8 A;  4GKK J;  5KFP A;  1VQP S;  2TDT A;  3M6W A;  5HRO A;  2H51 B;  4F4A A;  3M8P B;  4PZV A;  3U7J A;  4M1K A;  1VQ9 S;  3GFZ A;  2YWW A;  4PWD B;  1V3R A;  4H4K C;  4UY8 5;  1EQ0 A;  1TK8 A;  1TL1 B;  4KHM A;  1XAT A;  4RLE A;  4ZA1 A;  1T9T A;  2NR0 A;  3IM8 A;  1S9E A;  2FVR A;  2W0W A;  1WEL A;  1TV6 A;  8ATC B;  2HQG A;  2KG0 A;  2JEJ A;  1WC1 A;  3CIM A;  3KNA A;  4CO4 A;  2CQ1 A;  4A48 A;  4K4S A;  2ZOG A;  4HCQ A;  2XMV A;  3CT9 A;  5K8P A;  2PA8 D;  3H7H B;  2HZA A;  3V6J A;  3FS8 A;  2JLG A;  1UA1 A;  2VD3 A;  3KMS A;  3W3S A;  3DOM A;  1ZM2 A;  2VG6 B;  2HRU A;  3VF0 B;  4HEA 9;  3MED A;  2IYI A;  3EPI A;  4OI0 A;  1X5P A;  4LIR A;  2WON A;  4X4T A;  4LVO P;  1FD2 A;  4G1I A;  4ECW A;  1TVR B;  4X62 J;  3A1Y G;  1EJ7 L;  1U48 A;  3TUP A;  2CQ0 A;  4WWS A;  2B4V A;  4OZL A;  4NI2 B;  2FVC A;  3BKT A;  1MU2 B;  3JSY A;  1M90 T;  5G0R B;  5I3U A;  3MMB A;  2OI7 A;  1OPZ A;  3CSK A;  1CJK A;  1A9N B;  1IJF B;  4EU0 A;  1T0T V;  4KBI A;  1N32 F;  1HMV B;  2VFR A;  2GIR A;  4CLL A;  2L9N A;  1DHM A;  1FK9 A;  3NNH A;  3HF5 A;  3T6J A;  4IR1 A;  3GIL A;  3TP2 A;  3C14 A;  4EMD A;  3HT3 A;  3V4E A;  3CD6 S;  3H40 A;  1YP4 A;  4Q0B B;  5HSP A;  4USJ C;  3C6U B;  3W5Z A;  2D9O A;  3KJF B;  2YKP A;  1GX6 A;  4CM0 A;  4ITS A;  3MQG A;  4W90 B;  4J9L A;  4ZMM A;  4OIX A;  1GFW B;  3R97 A;  3IA0 A;  4L6V 3;  4U7U K;  2HHH J;  1KKH A;  5MAO A;  4B9U A;  5F9L A;  2XGP A;  1X4B A;  4KR0 B;  1LW2 B;  4KC5 A;  4MIB A;  2ZJQ Q;  4DN9 A;  2B3T B;  1QSS A;  3OW5 A;  3DGP A;  1M8N A;  2IM1 A;  2BW7 A;  3MD3 A;  2OH2 A;  2ERR A;  1RWV B;  4Y00 A;  1F9H A;  2YX4 A;  3J7Z T;  3QIP B;  1UET A;  2DRA A;  2V0N A;  1KQA A;  1FKO A;  3T5L A;  2YXL A;  3U1N A;  3ZC4 A;  4MYT A;  4P7V A;  1VQM S;  1YRU A;  4NLX A;  3OJS A;  2MZS A;  5KT4 A;  1WF1 A;  4M2B A;  1NDC A;  1X31 C;  3D6T B;  1H6K X;  1YX2 A;  1HNV A;  3F44 A;  3DRS B;  2Q6B A;  5KFR A;  1RYR A;  5D4L A;  2XS2 A;  4DPU A;  3HSG A;  5CAA A;  4V1A k;  1RI7 A;  2CQC A;  5CXT A;  1IKW B;  4AXI A;  1WJ9 A;  4P75 A;  2IAJ B;  4QCL A;  3QAU A;  1SUQ B;  4FYX B;  3V6K A;  5J1N A;  3BBC A;  3MCN A;  1UA0 A;  3UW1 A;  2QEX S;  3G86 A;  2YWG A;  2PMZ D;  3WIV A;  3PIO Q;  3DM2 A;  3N6L A;  3O5T B;  2L9D A;  5D4N A;  1RT1 B;  1SJ4 P;  1OJ4 A;  4AQY J;  1JLQ B;  4CLZ A;  3BZQ A;  3H8Y A;  4O44 B;  2Z2L A;  1SJF A;  3J7A N;  1KK5 A;  4URS A;  2VDH A;  3TJ8 A;  4LF6 J;  2ICX A;  3MM7 A;  4K50 A;  2XLK A;  4FCE A;  1Q81 T;  1RE1 B;  3V81 B;  2OEF A;  2EFG A;  4GC7 A;  4C11 B;  5JUM A;  3I4H X;  2FD2 A;  2XS7 A;  2Y8W A;  3NKY A;  4OYI A;  4O3S A;  3J81 Y;  3FQL A;  4F8R A;  1GXL A;  4QYZ J;  4DS4 A;  1H7X A;  1LWF B;  1Z2Z A;  3T5K A;  2OPR A;  4XIU A;  4RW9 A;  5HI7 A;  3TAM A;  3KWE A;  4ED3 A;  4NLD A;  3GSD A;  2N3O A;  2HSE B;  2OEJ A;  4DZ6 A;  3GZ7 A;  2DK2 A;  4P2S A;  2DPJ A;  2FY8 A;  4PCQ A;  1RZM A;  3NMA A;  3TZZ A;  3GOS A;  2V2Q A;  1TKT A;  3I4P A;  2CAJ A;  1YTY A;  2NZC A;  1SJR A;  4M5K A;  1R0B G;  5E3P A;  4Y2M A;  3BKF A;  3QZ8 A;  3ITH A;  2OP5 A;  4R25 A;  2KXN B;  3TNV A;  3AFG A;  3LAM A;  5DET A;  3J7A 1;  3I5A A;  1XN9 A;  4HAC A;  2HQF A;  3R5C A;  2HHS A;  2EC2 A;  3AD9 C;  1UCN A;  4B9T A;  2OPP A;  2QLF B;  1IKY B;  3O44 A;  2XYP B;  1B7F A;  2KYX A;  3TEG A;  1HWL A;  3OXF A;  1PYT A;  3IWX A;  5A6P A;  4IH7 A;  2Q43 A;  4DV6 F;  4KPZ A;  1O6X A;  4EZ6 A;  3IR7 B;  1P1T A;  9RUB A;  3CJ8 A;  3OTZ A;  2A2C A;  3B8H A;  2LLZ A;  1F1B B;  1NJW A;  3MAA B;  2KT2 A;  3LOU A;  1M5K C;  2CZV C;  4DWI A;  2E9T A;  2N7C A;  3DOK B;  1Y3K A;  5DZ6 A;  2CYY A;  4N41 A;  3I6P A;  1T9V A;  2V9K A;  2Z56 B;  4I2Q B;  4DCL A;  2NXE A;  1X4F A;  5CAB A;  2M8D B;  1UFL A;  1UVJ A;  4MIA A;  4WYW A;  2MLZ A;  3PMO A;  4J9K A;  1YSJ A;  4NCG A;  2DXD A;  3CDU A;  2VKZ G;  1QD1 A;  5D4P A;  2YX7 A;  3N0V A;  3D1Q A;  5L38 A;  3IAM 9;  2AJ2 A;  4LF8 J;  1S79 A;  5HAT A;  1SCJ B;  4A8M P;  2Q3P A;  3KLI B;  3HPO A;  1KQF B;  2AZ1 A;  3UWT A;  1K44 A;  3W9J A;  3D6F B;  1LKZ A;  4MH8 A;  3KWC A;  2QL9 B;  2M9K A;  1N36 F;  2B4P A;  1Q86 T;  2E29 A;  4W98 A;  3ICL A;  2OJ3 A;  1LQ9 A;  3GV8 B;  3RU0 A;  1R8H A;  2KO1 A;  2ZDP A;  2HQD A;  5DM7 Q;  1WKK A;  3OVA A;  2IYG A;  3HVA A;  4XPE A;  2WK4 A;  3MMC A;  4LSN B;  3F41 A;  3KJV A;  2NCK L;  3GQ8 A;  2MZ1 A;  3PFO A;  4OJ3 A;  3EGZ A;  3PRB A;  2L3M A;  2BJD A;  4PXD A;  2DR5 A;  2QGF B;  4AL7 A;  1UWB A;  5LMN F;  2BE2 B;  2XMU A;  3I9Z A;  4P71 A;  1B0V A;  1REV B;  3HLU A;  3KHR A;  3SQG A;  2E66 A;  4DV2 J;  4ZJO A;  4WF9 Q;  4WFY A;  1TUW A;  4ZP9 A;  5K14 B;  1FNX H;  1JLE A;  2LQJ A;  1NU4 A;  1F0X A;  1UAW A;  2MMY A;  5DLG A;  2AQ4 A;  3ENA A;  2W4C A;  3TUJ C;  3IRX B;  3FCH A;  4YHH F;  2DNL A;  3SXL A;  4NLG A;  1JJC B;  1WNE A;  3SMZ A;  2GHP A;  4K2J A;  2JEI A;  3ZNU A;  3PEH A;  2AJ0 A;  3K0J A;  7FD1 A;  2P8I A;  3OH3 A;  6AT1 B;  2KJW A;  4OYB A;  4PYD A;  2ZC3 A;  1X4H A;  1M5H A;  4K6R A;  3A8I A;  1H72 C;  3GJQ B;  3GQA A;  3NS6 A;  1RT3 A;  3QT7 A;  2AJQ A;  2UU9 F;  1SBR A;  4ECZ A;  2QV6 A;  2HK3 A;  3EE3 A;  2YWF A;  4DV5 F;  2IBK A;  4DQQ A;  1GX5 A;  2D3Z A;  4NLP A;  3OL6 A;  4DN0 A;  2HQ3 A;  1U4B A;  4L74 A;  1E6Y A;  3IFE A;  2QLX A;  3LW5 C;  2D9P A;  1KQK A;  1RWU A;  3M30 A;  2CA9 A;  3KG0 A;  3D0G E;  1MRO A;  2ABY A;  3LPY A;  1ZOT A;  4N69 A;  1EP4 A;  3EH0 A;  1NB2 A;  4X66 J;  3HHE A;  2VV5 A;  3SPT A;  1XMO J;  3TYT A;  4BWJ A;  1RTZ A;  4YOE A;  3KK3 B;  2UVU A;  2WCX A;  2ZBQ A;  4NXN J;  1CBK A;  3QQC D;  3P6Y C;  2XO7 A;  4LF4 J;  3BQ1 A;  4E79 A;  2DR6 A;  2OTJ S;  2F63 A;  1XEZ A;  5J1P A;  1KK4 A;  5EWG A;  2MYF A;  4ECU A;  1ELO A;  1XMB A;  1HNI A;  2JFD A;  1FDN A;  5DRK A;  1BQN B;  1AA1 B;  5KFJ A;  2R7W A;  2YVS A;  4UQG A;  4KNX A;  4EGL A;  4OX6 A;  2MB0 B;  4QWE A;  1RT4 A;  2DGW A;  3OFG A;  2MST A;  3EZ5 A;  1TTH B;  2RQC A;  3T9Z A;  3BRE A;  2EW9 A;  2X3G A;  1L3S A;  4JOU A;  3EDR B;  2DGU A;  3UE2 A;  3UI3 A;  1QRF A;  2DGX A;  4ZVS B;  2BMB A;  3KOA A;  2R2S A;  1DRZ A;  1HBN A;  3DHO A;  4C8O A;  4ZK7 M;  1O8B A;  1RP5 A;  3T57 A;  1YRX A;  4JI8 J;  4JI1 J;  5AFU V;  2JZ5 A;  2K3I A;  3NAI A;  3TZY A;  3FSB A;  1F9E B;  5L39 A;  1XR5 A;  4I1T A;  1PYO B;  1HWK A;  5KFW A;  3GV7 B;  3JQK A;  2WTF A;  1KLN A;  5KG5 A;  4TVA B;  1TL3 B;  2EI5 A;  4JI0 J;  3MR7 A;  1XK8 A;  5B0D A;  4L3N A;  2QFJ A;  1JLF A;  2KHC A;  4WK3 A;  3PY8 A;  1B64 A;  2NSB A;  1QAY A;  2RS2 A;  1N32 J;  1GT8 A;  4WZM A;  2BQ3 A;  1DAR A;  1JXL A;  4Q45 A;  2XY5 A;  4CZC A;  5I42 A;  4B17 A;  2Y1L B;  5H9E J;  3L3C A;  2DHH A;  1ZM3 A;  3EXC X;  2R7Q A;  2JL9 A;  1NME B;  1TL7 B;  3PTW A;  5AFU U;  2OHD A;  3EVW A;  4WBF A;  2V0J A;  2GVD A;  5E0O A;  3IG1 A;  3ZZZ A;  1WC5 A;  4NLT A;  3H2U B;  2ZNY A;  3KLH A;  2E1M C;  1X4G A;  2IC3 A;  4NEZ A;  2OLW A;  3AAW B;  2YTC A;  1K0V A;  2QSF A;  2MQQ A;  3H2V E;  3Q8R B;  2CAD A;  4DV4 F;  2LA4 A;  5AE2 A;  1KRR A;  1HD0 A;  2EK6 A;  2RU9 A;  1MLA A;  3KLG A;  3CW2 C;  2VF3 A;  4OI1 A;  1C0U B;  1FER A;  2ZOM A;  2VOD A;  2CQI A;  3HJV A;  3QLH B;  1RT7 B;  5F0W A;  2QA1 A;  1EIY B;  1WSV A;  4X65 F;  1T3O A;  1DQ9 A;  4RW7 A;  2QE5 A;  1XNR F;  2C2E A;  4WFZ A;  1MWY A;  4DV7 F;  4OYO A;  1ZBT A;  3DRP B;  3HHL C;  4HYK A;  3HVR A;  2V69 A;  2E1R A;  3GU0 A;  2UUC F;  3DK5 A;  4P2X A;  1NK4 A;  3I0R B;  2EG2 A;  2HNZ B;  1CUL B;  2A2D A;  2I38 A;  3FRY A;  2VBZ A;  1LFW A;  1WG5 A;  2G1H A;  2N82 B;  3UD3 P;  1RA6 A;  3NBP A;  4IG3 B;  1W25 A;  2XMK A;  5IT4 A;  4CLF A;  4JI3 F;  3IGN A;  5HJX A;  3JYT A;  2MXY A;  3THV A;  1JK9 B;  2CWX A;  4B9S A;  2ZZM A;  2XTJ P;  2P9G A;  1RA7 A;  3OR2 A;  2MJN A;  3OTB A;  3LP0 B;  1HPZ B;  3P96 A;  3F1X A;  3P45 B;  4DSI A;  2OI6 A;  3MUT P;  2C3U A;  2YWK A;  1S1U B;  2VH7 A;  2VBY A;  3I3A A;  2NPI A;  1WI8 A;  2CQ2 A;  2YKQ A;  1JJ4 A;  3W8G A;  3UDV A;  4EGG A;  4WKR A;  4NAS A;  2H54 B;  5KOX A;  4IFY A;  3W9H A;  2HHW A;  1A0O B;  4DUY J;  1UZD A;  2E5G A;  1S77 D;  2JVR A;  1QE1 B;  3HD2 A;  4DSF A;  4F25 A;  1VBX A;  3EIC A;  2KM8 B;  3QGH A;  2E1C A;  2Y1R I;  3QAT A;  2J7U A;  4C0H A;  5E33 A;  2RT3 A;  1S6U A;  1KD1 T;  1YWX A;  2CPD A;  4H4M B;  2IMO A;  3GE9 A;  1DTT A;  2UUW A;  4BDP A;  3R6L B;  1HI0 P;  2WSE C;  1JKH A;  2BVZ A;  4C6A A;  4FPR A;  4OZJ A;  4EYH B;  4F02 A;  2RRA A;  3I55 S;  4KTQ A;  2AGP A;  1JX4 A;  4FXD A;  4PR6 A;  1YJ9 S;  3ECT A;  1F5B A;  3KG4 A;  1OY8 A;  2AF6 A;  4PWU A;  2V8H A;  5LJ5 Y;  2VQE J;  4F3O A;  1TP7 A;  2CNK B;  1T94 A;  1FFW B;  4GRS A;  4NYP A;  2HBY B;  5KG3 A;  4DPX A;  3TR5 A;  1S4F A;  3T1A A;  2GS8 A;  2M2B A;  4P9S A;  1V6H A;  2RS8 A;  1GXU A;  1QAX A;  4P73 A;  4WP8 A;  1IBL J;  3PW5 A;  2HWI A;  4W4M A;  1KVI A;  3MGJ A;  4HTJ A;  4NOH A;  3QBC A;  2PII A;  3R6G B;  4LF9 F;  2KYZ A;  3BR8 A;  4CLK A;  1ACM B;  1LK7 A;  5HJY A;  3GUE A;  4TQR A;  2JF3 A;  2MGZ A;  3HK2 A;  5BYR A;  2VJV A;  1FDD A;  4J9M A;  3MM8 B;  4HDH A;  2KU7 A;  1M5S A;  1TAQ A;  4J7C A;  1CJV B;  3P4U B;  3JSM B;  2DKO B;  2OMO A;  4YME A;  1QSL A;  3NCQ A;  4JV0 A;  2FHJ A;  2YNH A;  4LRC A;  1FF2 A;  1VIS A;  2E1P A;  2VC1 A;  3OTO F;  2JDJ A;  4RW4 B;  2E7X A;  2DNN A;  1NPR A;  4AYB D;  4DQP A;  1YRT A;  3P3D A;  2J0W A;  1L3T A;  1P9Q C;  5C25 A;  4DV1 J;  3A4T A;  8AT1 B;  2BKN A;  5CD4 A;  7AT1 B;  1WHY A;  2HVH A;  3POT A;  1XQI A;  1Q79 A;  3W65 A;  2W1B A;  4USI A;  4NML A;  3ILL A;  3Q23 A;  4EUV A;  4UOH A;  5J2Q B;  1VYA A;  1OO0 B;  3R7N B;  5EUH A;  1YP3 A;  3TVY A;  1X0F A;  3FMW A;  1N52 B;  2R7S A;  4AFF A;  3BO4 A;  3D68 A;  4L73 A;  4UOC A;  3BSO A;  4C0B A;  3D3C J;  4ANE A;  1UMJ A;  3B78 A;  3CGI A;  3GSI A;  4CM2 A;  4YB1 P;  2MKY A;  8RUC A;  3KTQ A;  2ASL A;  3BN7 A;  3C15 B;  2IVF B;  2OEL A;  4ZIV A;  5C5J A;  3AQP A;  1S9F A;  3BBB A;  1XER A;  4ZHR B;  1ITP A;  4QR1 A;  2YKN B;  3H5X A;  3CDB A;  4J37 A;  2KVQ E;  3JAM Y;  2W9C B;  3FJ2 A;  2J8S A;  3P5B P;  1S7H A;  1Q82 T;  1S10 A;  4NLO A;  3AOB A;  3KMQ A;  5LMN J;  3W9I A;  5AXL A;  2F4V F;  1TMJ A;  2RDD A;  3QJJ A;  2HS3 A;  5L9N A;  3HSJ A;  1XWL A;  3HHD A;  1F6T A;  3DN9 A;  1MSW D;  2MQP A;  4DUZ F;  2LP4 A;  1JMT A;  1PO6 A;  2DYA A;  3FEY B;  4YHH J;  3E01 A;  4K4Y A;  1NO8 A;  4I2P A;  4QWA A;  1DFD A;  4KIA A;  1T11 A;  2Z8Q A;  5HBM A;  3RB3 A;  3H42 A;  5DZ7 A;  3PXG a;  1L0S A;  1X0P A;  3PFE A;  3QJP A;  3T1H F;  1UEK A;  4DR1 F;  3M9M B;  4OJG A;  2JNJ A;  5DG7 A;  1N5Q A;  3FC9 A;  2HIQ A;  3R3T A;  2ZC4 A;  2GIQ A;  1FA0 A;  2GV1 A;  1JLA B;  1KGT A;  4ZPD A;  2UU9 J;  5KT2 A;  3G82 B;  4KNR A;  1Q5Y A;  1X60 A;  3H98 A;  3OVB A;  4ED8 A;  3W8P A;  4RX6 A;  4EA8 A;  4EBC A;  2IRX A;  4QWB A;  4DV5 J;  3L7P A;  3F56 A;  2HHX A;  1Q7L B;  1QRM A;  1KOO A;  1PC4 A;  5K20 B;  4Q5V A;  1WUU A;  2BEF A;  4A8Y A;  1Y00 A;  5A0Y A;  1KRU A;  2XGQ A;  4DL5 A;  3HZG A;  1LXN A;  3NNA A;  2LEP A;  3OUY A;  1FHT A;  1NJZ A;  4HH1 A;  3QO9 A;  1R8B A;  2PDA A;  4F67 A;  1NZA A;  2K7J A;  3CCR S;  1SQG A;  2Q4J A;  3HFK A;  3T9N A;  5DGB A;  2XY6 A;  2I9S A;  1TZ0 A;  2HLT A;  3KUH A;  1R31 A;  3IR6 B;  1NK0 A;  2ZUG A;  3M8Y A;  5HL7 Q;  3MUM P;  1LNQ A;  1DTQ B;  5C42 A;  3BJY A;  2CWK A;  5B09 A;  3VVT A;  2GMH A;  1U45 A;  2FJD B;  1RAE B;  2MEW A;  5KFQ A;  4H4O B;  4M98 A;  4IOB A;  4FF4 A;  1U02 A;  3MEE A;  3FNN A;  1VIO A;  2YNG B;  1VGY A;  4DHV A;  2X3D A;  4F7V A;  4KE5 A;  1SL1 A;  3ETO A;  4TLR A;  4PXE A;  4C3M A;  4G1P A;  2W25 A;  2ACM A;  3JQJ A;  5AT1 B;  3QJL A;  1Q5V A;  2AX0 A;  3LP1 A;  2R7V A;  4KKO B;  5BJR A;  3FK4 A;  1N5Y A;  5KT5 A;  4RW8 A;  4WE1 A;  4O23 A;  2VFU A;  5L1K A;  4N8N A;  4AC3 A;  3VVU A;  2EFQ A;  2QA4 S;  9ATC B;  3DYA A;  3GYN A;  5KG0 A;  5GAD I;  2FQQ B;  1Z2L A;  3OU9 A;  2ZE2 B;  3VAF A;  2BOP A;  4PQU A;  3MHY A;  2QLW A;  3MAH A;  2YWH A;  3BYP A;  3CO0 P;  5AE1 A;  2M88 A;  3ZTP A;  4F4Z A;  2UXC F;  4DOZ A;  2NXU A;  2GJF A;  3ONQ A;  5FDL B;  3I32 A;  3C6T B;  4RWW A;  5AXM A;  3G6E S;  2FGC A;  1X5S A;  2BE7 D;  1ROF A;  1NKB A;  2LVW A;  4OV1 A;  2DR8 A;  2HAI A;  4NLW A;  1HR0 F;  5FD1 A;  3KK1 B;  4IUF A;  2LEA A;  3ZTO A;  1EWW A;  4ZVP B;  4ANC A;  2ZDO A;  2WOM B;  4P74 A;  3O6Q A;  3D28 A;  1L3V A;  1QAJ A;  3GQ7 A;  3G96 A;  3DDI A;  3C2P A;  2MKC A;  1IKX B;  5J2N A;  4TY9 A;  3W2W B;  5GAE I;  4PAA A;  1OY6 A;  1HQE A;  2IA0 A;  4RNF A;  2LEB A;  3M7V A;  4JI2 F;  3UDL A;  5IT9 Y;  3W63 A;  5JXS A;  2RDI A;  3UVJ B;  4PUO B;  1KVJ A;  1KSP A;  4OJ1 A;  6FDR A;  2AMC B;  2V67 A;  3FMB A;  2LU1 A;  3CJ4 A;  1TKX B;  2GGP B;  4YS2 A;  4M5M A;  3EVO A;  1WKL A;  1RAC B;  4X65 J;  3D1H A;  4DR4 F;  2IHR 1;  2VA3 A;  5HMX A;  1XNR J;  4KQL A;  4ZCI A;  4DV7 J;  1UL3 A;  2M52 A;  4C0O C;  2MQM A;  1M5P C;  1BWE A;  2UUC J;  2IPO B;  1R89 A;  3VAL A;  1LOU A;  1N0U A;  2RF2 A;  4J90 A;  4LSZ B;  1R7I A;  4J9Q A;  1DLO A;  3HFZ B;  3D98 A;  2KI2 A;  1UW4 A;  5CCL A;  2OPS B;  3K17 A;  3BDP A;  4X4V A;  2QIF A;  5F42 A;  3AOD A;  4M28 A;  2HVE A;  3PHT A;  4JI3 J;  2GFF A;  2V8V A;  1SL2 A;  2BAN B;  2FVS A;  3L7O A;  5LL6 d;  3NOG A;  1NSA A;  3NRB A;  1GTH A;  1SH0 A;  3P49 B;  4IG0 B;  3DXS X;  1RHM B;  1LWC B;  3CJQ A;  5DDP C;  4OHX A;  3B54 A;  1CSJ A;  2CG8 A;  2V4Q A;  2KHD A;  5GAH I;  2H3E B;  3V6D A;  2MZJ A;  1RTI A;  4KH1 B;  2APO A;  4RW6 B;  1U7L A;  4LRB A;  1VQS A;  4A8W A;  3MM9 B;  4NYO A;  2LQB A;  5A8K A;  3PRD A;  3TAR A;  4WCE Q;  4G87 A;  5HK4 A;  1HBO B;  3GMG A;  1Y9O A;  4RNH A;  2J6U A;  1HW8 A;  3PYF A;  2LU2 A;  5L8R C;  5T14 A;  2AEJ A;  2IJR A;  4IQX A;  2N4C A;  2G2Z A;  2Q79 A;  4G1Q A;  4MK7 A;  5AXK A;  1FX4 A;  1U8W A;  3HXM A;  3PW7 A;  1X4D A;  1QTN B;  5KFN A;  1QUV A;  3NY0 A;  4H4K A;  3BKU A;  3OR1 A;  4YR0 A;  4R36 A;  3SV4 A;  3UCG A;  5KTQ A;  2EC0 A;  1KK6 A;  4KHP F;  2VUG A;  4DDF A;  2B6A A;  4EQY A;  1WHW A;  2RIJ A;  3RRG A;  2B4U A;  4DFK A;  1G1X A;  2D7S A;  4CLU A;  3ISZ A;  1HYS B;  1BQM A;  4DQS A;  1OIA A;  4AT1 B;  1EAY C;  3F73 A;  2FJV A;  3MI7 X;  4P2M A;  2VBW A;  3FCV A;  1BC6 A;  3ZO7 A;  4QPT A;  3HHL D;  1Q7Y T;  4YEA A;  3Q8U A;  1M1K T;  4ZJQ A;  1NH7 A;  1S1X B;  4JV5 F;  1TL5 A;  1C1C A;  5I3P A;  3SDE B;  5KFB A;  4I56 A;  3SCK E;  4A8O A;  4HT5 A;  4IFV B;  3BYR A;  2ZHB A;  2HFV A;  2ZOF A;  5F8G A;  3LTO A;  5A76 A;  2F7V A;  5KFX A;  4Q7A A;  1S72 S;  3D6H B;  4TU9 A;  2FJA B;  3GWC A;  3MM5 B;  4DQI A;  5BYS A;  4KRW A;  3N6M A;  5KFO A;  1N4I A;  2C1E B;  3G4S S;  3N01 A;  1XR7 A;  3NCR A;  3O2I A;  1PG5 B;  1G95 A;  4LF9 J;  3VBM A;  2BJ7 A;  4JI4 F;  2OTL S;  3CME S;  5DG3 A;  2HW3 A;  2FLN A;  5F3T A;  4Q8F A;  2LMI A;  1U09 A;  5DEM A;  1Q8B A;  3G6Y A;  3MMA A;  2DHG A;  2X51 A;  4OZ5 A;  5T41 A;  3RBD A;  4E8U A;  3IBW A;  4ECQ A;  1RTH A;  1K8A T;  4IHG A;  1PJ7 A;  2DEI A;  5DLF A;  2KFZ A;  4UUW A;  4DLG A;  2ZH1 A;  2QIV X;  1RKJ A;  1G97 A;  4G65 A;  4TQS A;  1RBL A;  1RT5 B;  5IQQ A;  1S48 A;  1GMW D;  1FDA A;  2W9B B;  2FJB B;  3OSP A;  2DIS A;  4DR6 F;  1KLM A;  1F5C A;  2ZIT A;  2QTW A;  1XR6 A;  2F4F A;  1RT2 B;  1F9F A;  4KB7 A;  2W2Q P;  1Y5I B;  1FRH A;  2EVZ A;  3DCA A;  2DGV A;  1T03 A;  1R43 A;  2C2O B;  1VJW A;  1RHR B;  2GC8 A;  2GQQ A;  3X3U A;  5HP1 A;  3G71 S;  3DLG B;  3G87 A;  4GKK F;  1FXJ A;  3UPF A;  1JXE A;  3U1M A;  2XZD B;  2V4J B;  1RLC L;  1S1V B;  3Q1X A;  2IBO A;  2Q6C A;  1YHQ S;  1MR9 A;  1VRT A;  1C1B B;  3I96 A;  4I7F A;  1X4E A;  2ZH6 A;  2WLF A;  1QY7 A;  1GK8 A;  4ECR A;  4QR0 A;  3UR0 A;  1NSK L;  2C2K B;  1NJI T;  1C0T B;  2ACY A;  4DCJ B;  2OGU A;  3G8Q A;  3KNG A;  4GMK A;  2CJ9 A;  4KGV B;  3MFI A;  4IHH A;  1VHI A;  3SSQ A;  2CIM A;  3MR2 A;  1U2C A;  2BDP A;  5DDO C;  4QYR A;  3C16 B;  2F40 A;  2M8H A;  4ZN3 A;  2HHP A;  4UZB A;  3T5J A;  4UTG A;  3TIS A;  3BSY A;  4MYU A;  4ZIT A;  1NK9 A;  3RW6 A;  2MSS A;  4CCH A;  4CDI A;  2F4V J;  2UUA J;  2D3U A;  3FZ2 A;  3VR1 A;  2HMI A;  2AKW B;  3GFX A;  5D15 A;  2V0I A;  4OYM A;  1DQ8 A;  5GMK a;  5DEP A;  3DLE B;  4J5O A;  2O01 C;  5IZH A;  1S49 A;  4DUZ J;  5T7L B;  3PW4 A;  3KWD A;  3IAS 9;  4NRU A;  2DNY A;  4MFG A;  2AV5 A;  3RGI A;  1WWH A;  4RBV A;  1OSC A;  2W8L A;  4U7U D;  4LIW A;  1EET A;  4ID5 A;  5E41 A;  2LKZ A;  1U2R A;  4DMZ A;  3CCL S;  1QM9 A;  1XBW A;  1HWJ A;  3CJ3 A;  4A4J A;  2O66 A;  2KZM A;  1QSY A;  3GIM A;  3W66 A;  4G3P A;  2HHQ A;  2EWH A;  4H7O A;  3DU6 A;  1R8C A;  4MZU A;  2H5I B;  2GQ2 A;  3EWG A;  5B0C A;  2WVC A;  3AB2 B;  3PG9 A;  2CDQ A;  2G13 A;  1AT1 B;  2CQD A;  3MCS A;  1TFW A;  5IT0 A;  3KLE A;  4IOC Q;  3EZO A;  3JAM U;  4DFM A;  1S4E A;  5KFM A;  2HHH F;  3TW0 A;  2ILY A;  4B3O A;  3BGR B;  2VIC A;  4R0E A;  1SKU B;  3A3P B;  3ZZR A;  1VBK A;  5U2K A;  3ADA C;  1WTF A;  3TWZ A;  4FS2 A;  3KK2 B;  4MFB B;  5SZT A;  5DM6 Q;  2P6T A;  1WAC A;  1RKI A;  3R1H A;  2C2N A;  1YQH A;  2DO4 A;  1H74 A;  4IRC A;  1QJH A;  1S0N A;  5A2Q Y;  3MEC B;  1FVS A;  1JB0 C;  3MMJ A;  3TQ1 A;  3AB4 B;  2DH7 A;  4P6Q A;  4ILL A;  3TJA A;  2HHT A;  3N9U C;  1RTD A;  1TKZ B;  2W2P P;  1DBD A;  4LQ3 A;  4HZD A;  3GR1 A;  4RO0 A;  4WXO A;  2M3D A;  4BHQ A;  1UWA A;  4K4X A;  1FRM A;  2XWX A;  3I3X A;  3Q8P B;  5J1E A;  3A13 A;  2VD4 A;  1D09 B;  1NHV A;  3IBF B;  5KFD A;  2E5L F;  4LRF A;  2VG7 B;  4KFB A;  1U49 A;  1NHK L;  4NX9 A;  1XIQ A;  1OPI A;  3ZZU A;  2FC9 A;  2DXF A;  3CJK B;  1MR7 A;  1EB0 A;  3W2V A;  4AQY F;  4NLY A;  3L09 A;  3PYD A;  1WF2 A;  5I3Q A;  4ED7 A;  4N5S A;  1CJU A;  2DH9 A;  2X1B A;  1FD8 A;  2UXC J;  4CI0 B;  1AZS B;  2LXI A;  4LRA A;  3K57 A;  2ZFH A;  4ZVU B;  1D0E A;  2MQN A;  4GO5 X;  1J5O B;  4J9R A;  5F8H A;  3IBC B;  3CC4 S;  3TDT A;  2QMW A;  3ET6 A;  5LOQ A;  3GQC A;  3RR8 A;  3M8W A;  5GAG I;  4M5D B;  2I5K A;  1KFD A;  3NGT A;  1RWP B;  4NE9 C;  2DEJ A;  1HIY A;  2MZR A;  1W7W A;  4LFB F;  4O3P A;  3M2U B;  1XHD A;  2VL1 A;  3W62 A;  2KXF A;  4TY8 B;  3PJX A;  2YQ3 A;  4N8O A;  1VRU B;  4DV0 J;  5E3C A;  2V2V A;  5CYQ B;  2G9O A;  2YNF A;  1TUG B;  2P9E A;  4JI5 F;  2AD9 A;  4IDK B;  4W92 B;  4RUB A;  4LR9 A;  2H1Y A;  1RWK B;  2OPQ A;  1RHJ B;  2P6S A;  1T3N A;  3THP A;  4KGZ B;  3HSQ A;  4JYA J;  2ASY A;  4CO3 A;  2RML A;  1N34 F;  3A3N B;  4KAI A;  1ZM4 A;  4I68 A;  1SIZ A;  5IV3 A;  2ZH5 A;  3CED A;  4N77 A;  2CQB A;  2OFG X;  3IO1 A;  4DPT A;  4Y28 C;  1RSC A;  3H5Y A;  2NUU G;  2UZA A;  2BA9 A;  3V5R A;  2ZBP A;  1G4C A;  3DLK B;  1ZTW A;  1NDL A;  1D9D A;  1TQL A;  1S1W B;  3BQ2 A;  3K58 A;  3OFE A;  3HHL B;  1FKP A;  2YKM A;  4FNI A;  3UFC X;  1Q16 B;  1IR0 A;  2UXB F;  4PG4 A;  1RDR A;  2BXJ A;  2CJY B;  2YBV A;  3LP2 B;  5HRO B;  4K2X A;  2RNE A;  1U24 A;  3QRP A;  1NAQ A;  2AYE A;  2F65 A;  3HVT A;  5KG2 A;  3CCS S;  4KGX B;  3VAM A;  2WBR A;  2ADC A;  2ZBI A;  3CPW R;  1UJ4 A;  1RGV A;  1S9E B;  5HQ8 A;  3NGU A;  1TV6 B;  3KLV A;  1YJU A;  1X4A A;  3SZ2 A;  4ZVH A;  4N47 A;  1ZPV A;  2D3O 1;  2B8Q A;  1H7W A;  2BX6 A;  1JLG A;  4X4O A;  1TEL A;  1U2F A;  4RWX A;  1Z90 A;  1U1Q A;  3DOM B;  2FJW A;  2DY9 A;  1DUR A;  3D1O A;  4E6T A;  3DGV A;  3MED B;  2UVV A;  1SC1 B;  1SC6 A;  2RJZ A;  1YVF A;  1XMQ F;  1GQE A;  2V50 A;  1XC9 A;  2WON B;  2BKO A;  1V5V A;  4J9O A;  1IM6 A;  2VAS A;  3KG1 A;  3KDN A;  2JRS A;  1WKJ A;  1RIS A;  1VCT A;  2HRT A;  4FPI A;  4KHP J;  1R8A A;  1YZ7 A;  5I3U B;  3LGM A;  3MMB B;  3EYZ A;  1CJK B;  2FIU A;  1L3U A;  3M2R A;  2G1D A;  2XNQ A;  4LT6 A;  4DPO A;  5JJB A;  3OPK A;  1LWE A;  1FK9 B;  4LRD A;  1U1M A;  3GPA A;  1MWZ A;  3NNC A;  2UVW A;  3OJU A;  1S59 A;  1Q0N A;  4FDF A;  5KFE A;  4DV2 F;  3C14 B;  1G7C B;  5LJ3 Y;  2NXJ A;  4KGM A;  4YR2 A;  4U8Y A;  3TA0 A;  5K8N A;  3HMJ G;  2DNM A;  3PO5 A;  3IS9 A;  2A0F B;  1RYS A;  4X4U A;  4NA1 A;  2RUS A;  2B7C B;  4AAW A;  1L3K A;  2D1C A;  1O0P A;  5KG7 A;  3CC7 S;  3GJR B;  2KFY A;  2G2Y A;  5EDW A;  1VQ7 S;  1KWM A;  2YKA A;  2KDO A;  4JBC A;  3DJ4 A;  1WOP A;  2CNL B;  1LXJ A;  1RWX B;  4EWT A;  2GGQ A;  3IGV A;  3M2V A;  3DGP B;  4F36 A;  5ADX V;  4UY8 T;  2B5J A;  1BD6 A;  3OTE A;  2QT7 A;  1RTJ A;  4CNY A;  1C2P A;  4ILR A;  3FSI A;  1FWP A;  4QIW D;  3M8Q A;  4TXS A;  1FKO B;  4ECV A;  4U6P A;  2HZV A;  1RAA B;  3H20 A;  5HLF A;  3MTJ A;  3R0S A;  1DZ5 A;  4BLG A;  2FLO A;  1PGZ A;  2A10 A;  1HNV B;  2A3J A;  2AGO A;  4LBP A;  2DCL A;  2JF2 A;  3OBI A;  4DR7 J;  3V4I A;  1RT6 A;  1BGX T;  5K8O A;  4BWM A;  1DY3 A;  1ZAV A;  1XMO F;  5ETS A;  3VQT A;  7FDR A;  1N5V A;  3S7R A;  5ADX U;  1SQF A;  4EO8 A;  3EGV A;  4JUZ A;  2AU0 A;  3FSX A;  3TAN A;  2MQL A;  2CPY A;  3JQM A;  3BGU A;  5F8I A;  4CTA A;  2RKI A;  1UTA A;  4ELU A;  1SSM A;  3HDS A;  3LP2 A;  3NL0 A;  5L1J A;  3P47 A;  5CYM A;  4NLS A;  2HYI B;  4DX8 H;  2MY7 A;  3DM2 B;  4NLR A;  1DAX A;  3DMJ A;  1YIT S;  2B51 A;  1RAG B;  2D41 A;  4USH A;  4IO9 Q;  2O1P A;  1QDU B;  4DX5 A;  4R7P A;  4FKX A;  4ED0 A;  1WC4 A;  5EX3 A;  3MM7 B;  3FBB A;  3HSD A;  1X7V A;  3SSR A;  5DS7 A;  3GII A;  2QKX A;  1RAH B;  1IBK J;  3JTP A;  2PFF B;  2J6T A;  1IKV A;  3D67 A;  5C7P A;  2AJ1 A;  4JI8 F;  4JI1 F;  3RBE A;  1N5S A;  3NWG A;  1SPB P;  2W7O A;  1IXK A;  2WB1 D;  2DT9 A;  2OPR B;  5M2P A;  2AIR B;  4RUH A;  2R7U A;  2IVY A;  4RW9 B;  5IQ6 A;  3TAM B;  4JI0 F;  3Q8S B;  2P2C B;  2DD8 S;  2W4P A;  1HNW F;  3PYG A;  1FWL A;  3ENV A;  5D77 A;  5DO2 A;  3JTN A;  2VHE A;  2IIH A;  1TKT B;  2BKP A;  4MAK A;  4QQB A;  4GVB A;  4KYZ A;  2CZ9 A;  4NLQ A;  1H2U X;  2MJU A;  3DNC A;  2DRB A;  2ZM6 J;  2CQH A;  3VBL A;  3ITH B;  3K59 A;  2CQ3 A;  1S0O A;  2J0S D;  2IDL A;  4URQ U;  1T9Y A;  4HAC B;  2M7S A;  1ZPW X;  5HAN A;  4R0J A;  3ZZY A;  1M1G A;  4F4W A;  3TI0 A;  5F0U A;  2K2P A;  2OPP B;  4USW A;  1KEK A;  3U1L A;  4KY3 A;  4J9U E;  3H0P A;  1V9O A;  3B4M A;  3VHQ A;  3AD7 C;  3IWN C;  1NK5 A;  4RBU A;  4OFZ A;  1KON A;  1S9G A;  2C42 A;  4G3I A;  1IQT A;  5FLX U;  4HHJ A;  4HI2 A;  1MMD A;  2ZZN A;  2R8H A;  4ATN A;  4LUB A;  2PEB A;  3DRR A;  3LUY A;  3TZX A;  4LSL A;  3J80 Y;  2PEH A;  1AYE A;  4KHR A;  4WYL A;  2AEF A;  4ZCM A;  2EEY A;  1FRI A;  3PX6 A;  1HBU A;  3MC4 A;  5A8R A;  1P6T A;  2DRD A;  1D9F A;  4NCG B;  4YN3 B;  3CTR A;  1UPM B;  3OGZ A;  2ASD A;  2OSQ A;  1N8R T;  3GB0 A;  1S1T A;  2CRL A;  4P2F A;  3JS9 A;  2W4D A;  4URG A;  2OI5 A;  2JSX A;  4EO6 A;  1R6V A;  2LFV A;  2HGM A;  5D6G A;  1HW9 A;  5CD4 H;  4P10 A;  3R3R A;  3CE8 A;  1Y11 A;  4Q43 A;  1RBA A;  4QWC A;  2V8D A;  2DY1 A;  3MEG A;  5LSR A;  3R1L A;  2DGQ A;  4ZIW A;  1U6F A;  4LR8 A;  4PRF A;  1ZA1 B;  1I51 B;  3OXL A;  1T9W A;  1ICE B;  2VG5 A;  5H1S V;  3HVW A;  2E5L J;  1R8P A;  4UZC A;  3GCX P;  3MPV A;  2FB0 A;  3MMC B;  3CCM S;  2AYB A;  1PBA A;  1B3T A;  4RZR A;  3KJV B;  1YBA A;  2ZBC A;  2DR7 A;  4DUY F;  1UFK A;  2VU5 A;  4QW8 A;  4M9C A;  1UWB B;  2BW2 A;  4ZJL A;  4M5I A;  2PGC A;  5AE3 A;  3UQS A;  1V3W A;  2WBM A;  3SQG B;  3CUL A;  2FHJ D;  3OT9 A;  4C9D A;  2QJ3 A;  5EHH A;  2XMT A;  4Z2X A;  2OD4 A;  1G6B A;  2ILZ A;  5E5N A;  3MM6 A;  1JLE B;  3WZ0 A;  3Q24 A;  4RU2 A;  2EBG A;  2C2D A;  4KQZ A;  1VS3 A;  3KLF A;  2ZD1 A;  5A2Q U;  4HKQ A;  4ZPA A;  1Q1K A;  3Q86 A;  4ZPV R;  2EKY A;  1VC0 A;  4M5L A;  4LFB J;  5GAD U;  4QIE A;  2IU9 A;  1T95 A;  4C48 A;  3VGV A;  3FGV A;  1YK9 A;  1FRJ A;  4DL3 A;  4PKD B;  1RT3 B;  3S01 A;  2VQE F;  4PXC A;  2YPZ A;  1KN6 A;  1NSP A;  2MY8 A;  4QZV B;  1CC8 A;  4JI5 J;  4RKU C;  2NYI A;  4OX7 A;  3MUV P;  1VQL S;  1H73 A;  5B0E A;  4I4B A;  2Y0B B;  2F3J A;  4DQR A;  1SV5 A;  1E6Y B;  1IBL F;  4CLS A;  1AUD A;  2BV3 A;  2XUL A;  1IBM F;  3M30 B;  2RB7 A;  1N34 J;  3R1W A;  3CCQ S;  4NA3 A;  2VA2 A;  3OL7 A;  3PEJ A;  2MTL A;  1MRO B;  5AJ3 F;  1U47 A;  5GAE U;  4ZLL A;  1EP4 B;  3OH0 A;  4R8U A;  3L4B C;  3UDE A;  1PIL A;  3HKW A;  3C66 A;  3MPU B;  3PHE A;  2RHQ B;  1N56 A;  4Y3C A;  3QFH A;  1HL6 A;  1VOM A;  3EG4 A;  4K8R A;  1E6V A;  2UXB J;  2UV8 A;  4C8Z A;  2DNZ A;  1HNI B;  2MLY A;  5LMU F;  4KPY A;  1TFY A;  3FWW A;  4DV1 F;  1D3W A;  2W2M P;  4TNO A;  1RT4 B;  2RQK A;  2OI2 A;  4IOA Q;  4Q2M A;  2UUB F;  1PKU A;  1HV9 A;  3LGH A;  4K4V A;  1R6Y A;  2SXL A;  1HBN B; 
#chains in the Genus database with same CATH homology
 4J09 A;  4G3P A;  3BSS A;  1QRM A;  1V3W A;  3I3A A;  1NM2 A;  1KRR A;  2RIJ A;  2IUA A;  2V0H A;  3DJ4 A;  3GOS A;  3R5B A;  2IU8 A;  4N27 A;  3VBN A;  3T57 A;  2QJ3 A;  3VBK A;  3P47 A;  4HZC A;  4RR5 A;  1QRE A;  1MLA A;  3OW5 A;  4AA7 A;  4IHG A;  2GGQ A;  4IHH A;  4H7O A;  3EEV A;  2ICY A;  2NPO A;  4KPX A;  5AFU V;  2I5K A;  4N69 A;  4E6U A;  1HM9 A;  4MZU A;  3R5D A;  4G3Q A;  5L6V A;  1KRU A;  1OCX A;  2GGO A;  4HZD A;  1THJ A;  2OI5 A;  1KGQ A;  3GVD A;  3EH0 A;  5E3P A;  2QIV X;  4EAB A;  4EGG A;  1KHR A;  1HM8 A;  3P1B A;  3BXY A;  3SRT A;  5ADX V;  3TZY A;  3FSB A;  1SSQ A;  3HJV A;  2OI7 A;  4M99 A;  1XHD A;  3HJJ A;  3SPT A;  1G97 A;  3R3R A;  3TK8 A;  2QC3 A;  1KRV A;  2TDT A;  4R7P A;  3NZ2 A;  3VBL A;  3HHD A;  4AC3 A;  5L6S A;  1KK5 A;  2Q4J A;  3R2W A;  3TIS A;  3FOQ A;  4IHF A;  2WLG A;  3BSY A;  3EZO A;  3I3X A;  4ISX A;  4E79 A;  1KQA A;  3TQE A;  2ICX A;  4R37 A;  3OU9 A;  2VD4 A;  3BRK X;  2XAT A;  3FTT A;  3R5C A;  3BSW A;  4FCE A;  4MYO A;  4EA7 A;  4RL1 A;  1QQ0 A;  3EG4 A;  1XAT A;  1KK4 A;  2OEF A;  2WLC A;  3FSC A;  3IGJ A;  3QAT A;  1YP3 A;  2QKX A;  1LXA A;  2P2O A;  3DK5 A;  2IU9 A;  3KWC A;  4G3S A;  3MQH A;  1T3D A;  3IM8 A;  2V0K A;  2W0V A;  3FSY A;  4K6R A;  2WLE A;  4M2B A;  2W0W A;  2V0L A;  3R0S A;  1HM0 A;  2QIA A;  3R8Y A;  2V0I A;  3H0P A;  4G87 A;  1TDT A;  2JFD A;  4HUS A;  5DEP A;  3TZW A;  4KQL A;  4KPZ A;  2H1Y A;  5DZ7 A;  2IC7 A;  3V4E A;  3R3I A;  5U2K A;  1FWY A;  2JF2 A;  3JQY A;  3D8V A;  1YP4 A;  2G1H A;  3IXC A;  1V67 A;  3HSQ A;  1MR7 A;  3CJ8 A;  4N6B A;  4EAA A;  3GUE A;  3FWW A;  3OTZ A;  2JF3 A;  4KNX A;  4E75 A;  2JFK A;  3G87 A;  4HCQ A;  3KWD A;  2G2Z A;  3BFP A;  2OEG A;  1FXJ A;  3TDT A;  4MFG A;  2AQ9 A;  3SBM A;  3OTM A;  3PTW A;  3RGI A;  3FS8 A;  4M98 A;  5E3R A;  2P5Z X;  5AFU U;  2CUY A;  1Z90 A;  4J18 A;  3K89 A;  3IM9 A;  3VNP A;  1MRL A;  4QBU A;  4M2A A;  3TIO A;  3VBI A;  3D98 A;  3VBJ A;  5ADX U;  3TZX A;  2V0J A;  3MC4 A;  4E1K A;  5DZ6 A;  2WLD A;  2FKO A;  3KWE A;  3MQG A;  3ST8 A;  3TV0 A;  4E6T A;  3Q1X A;  2C2N A;  1G95 A;  4AAW A;  1KGT A;  1QRG A;  3VBM A;  4DCL A;  4KNR A;  3R1W A;  2G2O A;  1S80 A;  5E3Q A;  4R36 A;  1MR9 A;  5F42 A;  4N6A A;  3FSX A;  1HV9 A;  3R5A A;  4M9C A;  4M28 A;  1SST A;  5DG3 A;  1J2Z A;  3VBP A;  3OUP A;  1QRF A;  4HUR A;  4EA8 A;  3R97 A;  1KK6 A;  3F1X A;  4EA9 A;  3BV8 A;  5DEM A;  2G2Y A;  2WLF A;  2OI6 A;  3TWD A;  3PMO A;  3DHO A;  1QRL A;  3TZZ A;  1YP2 A;  3C8V A;  3ECT A;  4EQY A;  2VHE A;  1SSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...