3CJ8A

Crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
AMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransfe
publication title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 55
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3cj8A03
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3cj8A02
4.10.180.10 Few Secondary Structures Irregular Black beetle virus capsid protein Black beetle virus capsid protein 3cj8A01
4K6RA 3R5BA 4EA9A 1XATA 5DEMA 2W0VA 3VNPA 1KK5A 2WLCA 3EZOA 3TDTA 5L6SA 1KRUA 2QIAA 3EEVA 3OW5A 4E6TA 3TZXA 1KHRA 3Q1XA 1XHDA 3ECTA 4IHGA 5AFUV 5ADXV 4AA7A 2CUYA 3PMOA 1HM0A 4HZCA 3FOQA 2JFDA 2OI6A 3SBMA 4N6AA 1KRVA 2W0WA 3TV0A 3TISA 2RIJA 3BSYA 3HJJA 3FTTA 3IXCA 5E3QA 4KQLA 2GGOA 2IU8A 2V0KA 3OTMA 1MRLA 4R36A 3R5CA 3VBIA 2QKXA 2WLGA 3VBMA 3FSBA 3I3XA 3FSCA 1MR9A 3I3AA 1THJA 3VBNA 3MC4A 2JF2A 4AC3A 4EA7A 1V67A 2V0JA 1T3DA 2WLFA 2QJ3A 4AAWA 3EG4A 1HM9A 3RGIA 2IUAA 1G97A 4G3PA 3OTZA 3D98A 1YP3A 4KPXA 5E3PA 4HZDA 2IC7A 2AQ9A 3P47A 3FSXA 4EABA 1MLAA 2TDTA 3VBKA 4G87A 2OEFA 4RL1A 4EQYA 3BV8A 1J2ZA 4J09A 2V0HA 3NZ2A 3FS8A 3H0PA 3R3RA 2ICXA 3OU9A 4G3SA 3DK5A 3T57A 2IU9A 4KNRA 3FWWA 2QC3A 3DHOA 1SSQA 3D8VA 2JFKA 3IM8A 3TIOA 4N27A 2C2NA 5DG3A 1QQ0A 3QATA 3EH0A 1S80A 2FKOA 3R1WA 4IHFA 4EGGA 1OCXA 1KRRA 1NM2A 1HM8A 3K89A 3DJ4A 4IHHA 4E79A 2I5KA 3HHDA 3BFPA 4M99A 1KK6A 3GVDA 3SPTA 3SRTA 2ICYA 3VBJA 2G1HA 4QBUA 4M2BA 3TWDA 1KGTA 3BSWA 4MYOA 4M2AA 2OEGA 1QRLA 1KK4A 4E1KA 3G87A 4KNXA 3CJ8A 3TK8A 1KGQA 2V0IA 3KWDA 4KPZA 2H1YA 4J18A 3R97A 1YP4A 3F1XA 3R3IA 3VBPA 3IM9A 3GOSA 4E6UA 3BSSA 4ISXA 1FWYA 2V0LA 2NPOA 4FCEA 2P5ZX 2VD4A 3P1BA 3BRKX 3R0SA 2XATA 4N6BA 3MQGA 2QIVX 1SSTA 3FSYA 4M28A 4MZUA 4E75A 5DZ6A 2G2ZA 3ST8A 2P2OA 4EA8A 1QRGA 1QREA 1G95A 2G2OA 1TDTA 3OUPA 4MFGA 1MR7A 1YP2A 2WLEA 4N69A 3TZWA 1FXJA 4HCQA 4HURA 4DCLA 2OI5A 4R7PA 3VBLA 2GGQA 5U2KA 3KWCA 2WLDA 3HSQA 4HUSA 2VHEA 4G3QA 2Q4JA 3MQHA 5ADXU 5AFUU 2JF3A 1Z90A 3R5AA 4H7OA 3HJVA 1QRFA 4M9CA 4R37A 5DEPA 1HV9A 1QRMA 3PTWA 3R5DA 3C8VA 5E3RA 3BXYA 4M98A 3TZZA 5L6VA 1LXAA 4RR5A 5F42A 1V3WA 4EAAA 5DZ7A 3JQYA 3R8YA 3TQEA 3TZYA 2G2YA 1SSMA 3IGJA 3GUEA 2OI7A 3R2WA 1KQAA 3V4EA 3KWEA
chains in the Genus database with same CATH superfamily
3MAAB 1UL3A 2A6OA 4EO8A 3MXHP 2LU2A 2J8SA 3TZXA 2KG1A 5L9XA 2R4FA 4Q2MA 1DTQB 4JOUA 2W1BA 5HL7Q 3FEZA 3FTTA 1JLCA 1REVB 4CO3A 3T3FA 5ETKA 1JLEB 5L8RC 1ZETA 4TU8A 3D54A 4ZVPB 1TL4A 1R8CA 3PZPA 3BGLA 4M5MA 1WOSA 5IZHA 2Z2MA 3IWXA 2ICYA 1KFSA 2HS4A 4Y2KA 2FYXA 2HLUA 1IR0A 4G6VB 2DB1A 2DO0A 2CQBA 3IM9A 2CQ2A 1LNQA 2HRTA 2CPFA 1NDCA 2OJ3A 4WP3A 2AJ0A 2YWHA 3TAMB 1QSSA 4UUWA 2ZBQA 2H4YB 3VVTA 4C8MA 4O3OA 2WRMA 2VOOA 2NSBA 1TVRB 2YKMB 3ZTSA 1X4BA 3TZYA 4EA9A 3POTB 4RNFA 1V6HA 3QZ7A 1RTJB 4KFBA 2GMHA 4L73A 4IHGA 5JVHQ 2BANB 1HM0A 1FE0A 2CQ0A 1M1GA 3PKMA 1X5TA 2QEXS 5AE1A 3CDEA 1KHWA 3NRBA 1HHQA 2G13A 3I56S 3EVOA 4KKOA 4DL5A 3OVSA 4CLTA 2UXBJ 2CQ4A 2QA4S 3HD1A 2VBXA 3DRXA 1CVJA 3I0RB 2E1MC 1T9YA 3IGVA 1UTAA 1VQYA 4CO4A 1N6QB 1NHKL 4DF8A 3KMSA 1FDBA 4USKA 5L38A 5HJYA 4DSFA 2XS2A 4F4ZA 1TL7B 2L41A 4CLZA 5I3UA 4YQWA 2CQCA 3NMAA 2L9NA 2VD4A 1CJUB 2BKNA 4LR8A 2HGNA 4N76A 1RADB 2GGPB 1RBLA 1XQIA 1AB8A 4YR2A 2OI5A 3UDEA 4IOCQ 2CJ9A 5KFSA 4CO2A 4GVBB 2HVEA 4DG1A 2N82B 4DV0J 2XEXA 1AUDA 1WG4A 2QE5A 3PYEA 3TI0A 2DEJA 2J8AA 1E6VB 3MEEB 5T7LB 4C2MA 1VC0A 3J7A1 5B0EA 3FKBA 1HBUA 1H2UX 4FKYA 5KFCA 2HHSA 3DRRA 1S79A 2RUSA 4X4PA 4OQJA 3HHNB 4EZ6A 3OH1A 1HNZJ 3FFIB 3ZTRA 2VG6B 2FJBB 1L5UA 1N36J 1CULA 3WX8A 4OX9J 2KVIA 2G0JA 4E1KA 2V67A 1IBKJ 4ES3A 4PCQA 3V4IA 1ITPA 2O1PA 1S1UA 1U1RA 2FIUA 5AE2A 1K73T 2OPPA 1H2TZ 2FVPA 3GR0A 1M0SA 1S1XA 4LRCA 4RNNA 5D4LA 4YHHJ 3OSPA 1U1PA 2M70A 4HURA 4QU7A 2KYXA 1N36F 4WCEQ 1P27B 2FZGB 2SXLA 1K1QA 4OX9F 3PTWA 4G1PA 2W9BA 4JI5F 2HPUA 4V1Ak 2RDJA 1IBMJ 1IBKF 4NYZA 2ZUAA 3A12A 1RKIA 1I94J 4MKVA 4MFBB 1DQAA 1OIAA 1D3WA 3QIPA 2YTCA 1UZHA 3N5FA 4F4YA 2I5JA 2KVQE 1JKHA 2LKZA 2V2VA 1P1TA 1Z2LA 4LFAJ 3BEGB 1HW8A 3PVXA 1SCJB 2H65B 2J0WA 2I1RA 2W4CA 2NUHA 4JI0J 5DETA 1IBMF 3IXQA 4F26A 2OEFA 1I94F 2HG4A 3W8PA 2XCAA 1U8SA 3SSSA 3NOCA 4ILRA 3QLHA 4X4QA 3VGSA 2R7XA 2IM3A 5F8GA 4C8NA 5DG8A 1UVJA 5GVQA 1OY6A 3V81A 4F04B 4M2AA 3LP0A 3OFHA 4RPFA 4JI0F 1RWMB 2KYZA 4JI4J 4ZJQA 2E1RA 3PJXA 3VAFA 5C42B 5ETPA 4NASA 1KWMA 4NCGA 4AQYJ 4ETXA 2RF2B 3FCWA 3GJSB 3HKWA 1JB0C 2VODA 2R8IA 3AD8C 4DSKA 3FSIA 4O3RA 4TY8B 3M6XA 3KKFA 1KSPA 3MM7A 2CPIA 4YFUA 2JLEA 5KFRA 3CXCR 4AQYF 1X5PA 1X7VA 1HHSA 3CCLS 3CCSS 3TUZC 3RW7A 2YKPA 1ULRA 5A2QU 5F8HA 4ETZA 3KLGB 1NSPA 3FSCA 1N5QA 3CJ0A 2MSSA 2MGZA 4HHJA 1PC4A 2GQCA 3L4BC 3FUYA 5U47A 1CS4B 3IM8A 1S10A 4A47A 2PI5A 3AD7C 3JB9k 3OXGA 3AOCA 2FD2A 3TK8A 4KGZB 4QYZK 2V94A 1HQUA 1RLCL 2VOPA 4QJVA 3M05A 2EFOA 3TW0A 2BE2B 3MHYA 3BYRA 3JSRA 1Q16B 2GAGC 5D4NA 4DCLA 4O0NA 4PZVA 2WOMB 1WUUA 2D69A 1N5YB 5JUMA 5DEPA 2MKYA 2CZ9A 5RUBA 2IDLA 2RE1A 3R9LA 3RB3A 3TJ8A 3NCRA 2Y1RI 3UCZP 4F4AA 2C2RA 1KN6A 2JLGA 2Z57B 5LXYA 2JVOA 2IU8A 4TYBA 4ZIWA 4NLVA 3K8VA 3BPSP 3MOZA 4NL5A 2NREA 4LF2A 2BKOA 4ICLB 5HBMA 5KT6A 1VK3A 1F3VA 4EMDA 3M6VA 2LEPA 3FCHA 3P96A 3KLFA 2OMOA 2J0QD 3A3OB 3IG1A 2HNYA 3DM2A 3TVZA 3BKFA 2PEBA 4OYXA 4DX8H 2ZH4A 4RUBA 2K1RB 3FEYB 2AX1A 3QAEA 1VK8A 4W92B 3KUGA 4FS1A 2VG7B 2E5IA 4JI6F 4CYUB 1VRQC 4JP8A 4DL3A 1ZS6A 5KFYA 2MQNA 4R37A 4LF5J 3GQAA 5CAAA 4GO7X 2BX6A 2YBVA 4ECTA 5DDPC 2VBWA 3QT6A 4NLDA 3GWCA 1DRZA 1Y11A 2XMAA 3CO9A 3CJ3A 1RTIA 2HVDA 2J0SD 1RT5B 4I67A 3OTMA 1H7WA 1CJVA 2MB0B 3G2XA 4LF5F 2NZ4A 2W2PP 2BJ8A 4OZJA 2NQPA 2QL5B 4EABA 2MZRA 3MM5A 3S1TA 3QSYB 4ERDA 1HFEL 1R6VA 1QAJA 4ANEA 5DG3A 1AT1B 2KKHA 4FP9A 3O1LA 4HR2A 2HVHA 5E3AA 2DHHA 4K5RA 3A8JA 2RUGA 3KYLA 4JI1F 4KGVB 4F3OA 1WC4A 2NXNA 4J7CA 4J18A 3OQ2A 3WC0A 4QYRA 3MM6A 3QFWA 2QT7A 1PO6A 5KOXA 3CJ5A 2AJ4A 3D2WA 4ZVEA 5B0AA 1VGYA 5KG4A 5AXNA 1V3RA 4KSEB 1VBXA 4NLSA 2YNGA 1Z90A 2GW8A 4MK9A 1IJFB 1SJ3P 3C2PA 3A3NB 1FJ7A 3CJRA 3R5BA 2DNLA 4UOHA 2GIRA 4DPOA 1QE1B 4WFZA 4LMZA 1KTQA 4N6AA 2BW7A 2O67A 3CJ2A 2PMHA 3KK1B 3CCMS 2DIVA 1S1WA 2F4VJ 2ZWOA 3ADAC 2KXNB 3HHLA 4RL1A 1JLGA 2QFIA 2OD4A 2DH8A 1KOOA 3SFGA 4Y34A 1B0VA 2CG8A 3PV8A 4JI2F 3SPTA 3WDOA 2LMIA 2ROGA 4U8YA 1VBZA 4BDPA 5F8NA 3TVYA 3OLBA 1LFPA 4ZCLA 8RUCA 4LF8F 2RS2A 2PEHA 1RHMB 4QIWD 3RRGA 2IBKA 1FVSA 1QRGA 4DR2J 3OTEA 2ZWPA 2C3PA 2GA7A 1MWYA 1NK9A 4CM0A 3R2DJ 3OFFA 3IS9B 2VA3A 1RA7A 1VRTB 5SZTA 1X4FA 4P52A 4F2SA 3GG0A 3BO3A 2OSQA 4UY85 1XIQA 1FEEA 5IV4A 1PBAA 1XNRJ 2B9YA 4ZVFA 2NYIA 2XB2D 1B99A 4M8LA 4X65F 1RAFB 3ZZ0A 5HMXA 2W8LA 4OYAA 4IFYB 5GAEI 2F5GA 5J2NB 3I55S 4USJC 2BM0A 2ZH5A 2F8HA 3IBFB 2F9JA 3KLIA 3T5LA 1JJHA 2KRRA 4DPTA 3CCWA 3J7ZT 2HHUA 2KT3A 3QGHA 8ATCB 2BEFA 3ULHA 4E2FB 3CUNA 1QJHA 3KK2A 3V6KA 2EK1A 1C0UA 2DGQA 2AYBA 3A8EA 3FVYA 5KFUA 2NZCA 4LVNP 4DUTA 4M28A 2NXEA 4ZPWR 3K5NA 1ICEB 4C7QA 3TZZA 4K7QA 3TQEA 4EAAA 3TAPA 2AYEA 1TL3B 4N77A 3FDSA 2BDPA 2UUCJ 2HGMA 1BGXT 4E6TA 4ED5A 1VDHA 4QIGA 1EP4B 4IRKA 1EQ0A 4AL7A 3VQSA 1G1XA 2V0KA 2GIFA 2OEKA 3PRBA 3WQPA 1RWKB 1P1LA 3T1AA 4M5DB 4IOBA 1YJ9S 1RDRA 4OZNA 3AJDA 3GIKA 2OEMA 3C46A 2C2OB 2CAJA 3MPWA 3I5BA 1RTHB 1X4DA 3FS8A 1O6XA 1RGVA 2YWKA 3AB4B 4CT9A 3H5XA 2CPXA 1BMQB 4QW9A 1LEOA 1U47A 4OLPA 2H4WB 2N7CA 1Q81T 1VBYA 3KHLA 1X4CA 4FXWA 4EO6A 1H98A 3PIOQ 4QWBA 5KOWA 2VHGA 2R7WA 2B43A 4K4UA 2OPSB 4FCEA 1IKYA 2PC6A 4Q5VA 2BE7D 5DZ6A 4A46A 4PKDB 3T5KA 2J9CA 1RACB 3R1HA 4X66J 3QJJA 4LF1A 3HSQA 3DYAA 3GU0A 4K8RA 1R89A 4DXLA 1RT7A 5D4PA 3OTOJ 1OYDA 3I9ZA 3J7YU 4FYDA 2IRXA 3SCKE 1FWKA 2X1GA 2LXIA 4RLEA 1QAXA 2F8EX 4JV5F 4GKJF 4YMEA 2P6SA 2QKXA 4A8MP 2YKNB 3RJMB 5HMYA 1T3DA 1U26A 3LWLA 1YJRA 2ZH7A 3OTOF 2PT0A 1VJQA 2WVEA 3UN5A 1Y3KA 1BQNA 2RB7A 1WC0A 4N5SA 3MZIA 1RT2A 4B3SJ 1AZSB 4ED2A 2XZWA 3MUTP 1BQMA 3TWDA 4BCAA 2LQ9A 2IM0A 3LGHA 3KFWX 4KH1B 1DLOA 4Z37A 4YB5A 3LTOA 1N0VC 4Q2LA 3R3IA 5KFMA 3BSOA 1IQTA 4ZLPA 2Z58B 4LFCF 2RKIA 4RX6A 1S0NA 2NXJA 4F67A 3M9OB 3T6BA 1VS3A 4M5GA 1DTTA 1WHVA 4CLSA 1BWVA 1FXJA 1X4GA 4WK3A 4UY8T 3NNHA 1S9FA 4OHVA 3C16B 3H98A 4UOGA 3NS5A 3LPEA 4NLXA 1X9WA 4UZCA 1R0CB 3O5TB 2G4BA 4R36A 1FFSB 2A1BA 1JJ2R 3FBEA 2ZBCA 3PEJA 3IRXA 1EAYC 1XJWB 1Q5VA 4ID5B 2YNFA 4WPAA 2ZZMA 4ZP8A 1D0EA 1HKAA 4KV8B 2VC1A 1T03A 3QBCA 1ZAXA 1U6FA 4OHWA 1HQEB 1RWWB 3GVDA 1LQ9A 3VAKA 1T0TV 2MPUA 2WVBA 2WBRA 4CI0B 3EZ5A 3KJNB 2E5LF 2YWFA 3EYZA 3I82A 2V0IA 2GO8A 1LW2B 1HBMB 2Q6CA 1JNZB 4DR7J 1R8BA 2Y9HA 2MLZA 3CE8A 1T11A 4Z7YA 2YWGA 1T05A 3TRGA 4I56A 3Q86A 2UUTA 2WLEA 1CC7A 3KK3B 2N3LA 3OD2A 3KUEA 1KS2A 3JQJA 4YEAA 2KDOA 3UO0A 4QWCA 1HNWF 3DI6B 1VRUB 2OPRB 2RD5C 3G6VA 2BA9A 4B9LA 3AODA 4KYZA 3C19A 4XO0A 4A8SA 4Q45A 4YB6A 3EPIA 3MD3A 4WE1B 4JYAF 3PEHA 2RH3A 4TYAA 5K14A 5KFNA 2GJFA 1M8NA 1S12A 1HMVB 3CSKA 3H2VE 3LP1B 1RWXB 3RGIA 3DLEA 1SIWB 1S49A 4IRCA 4QW8A 1F6TA 3BR8A 3BB5A 2FLNA 4CLYA 4C8YA 4PWWA 2JDJA 2HEKA 3NBPA 3R7NB 4EGGA 3K89A 1XNQF 1NKCA 3CMES 4ZMMA 3GIIA 3BSWA 5A8RA 3ITHA 1ZOTA 5C2CA 4ZHRB 1VQOS 3D1OA 3BF4A 4X62F 1BE4A 4YP3A 2BUNA 1VJWA 3OL6A 3A8KA 3M30B 3D9BA 3OUYB 3MMCB 2FGOA 3D0HE 5LJ3Y 3IP0A 4NZ0A 5ETRA 1JLAA 3BO2A 1T9UA 3DHXA 2UU9J 1T9TA 5ADXU 1TMMA 1SL0A 4F4XA 4KPXA 3ICLA 1RHJB 1L3VA 1UZDA 4NLYA 3FOQA 2GHPA 1DTQA 1AA1B 1R27B 1REVA 3MF5A 2CPZA 4MK8A 3GCWP 3TO8A 2G0IA 2U2FA 3SDEB 1JLEA 1X31C 3D6FB 5LSOA 1NH7A 1YGYA 1MNEA 3BGFA 1F5BA 3AAWB 4ECWA 1FTCA 3GQ8A 4Y3CA 1VMBA 2G1DA 3MUVP 4USUA 3G4SS 2E1AA 5G0RA 1MROB 1Q79A 3AOBA 2KO1A 3P4UB 2XM3A 3W63A 5GMEA 1U45A 5J1PA 4RW7B 4I6WA 4J9PA 2IY5B 3TAQA 1F60B 3TAMA 5A76A 1T9XA 2DRBA 2UVVA 3Q22A 4PG6A 2CJKA 2YKMA 1MWQA 3NXZA 4CLLA 2DR9A 4KJIA 1WDDA 1CPZA 3POTA 1LFWA 1RTJA 2B4OA 4Y65A 2BV3A 4Y28C 2NPIA 3OJSA 3B6BA 3OH3A 3PACA 2LU1A 3HULA 4DF4A 3JSMA 3W62A 3KHGA 3BBCA 1D9DA 2XHCA 2HS0A 2XY6A 2YKQA 5F8JA 1A0OB 1HW9A 3ZTOA 3MM9B 2VUGA 4DR6F 1LWCB 2J6UA 2CNKB 2FB0A 3TJAA 3I0RA 4M63A 4OI1A 1RUSA 1YDLA 2LP4A 2D3ZA 1SKSA 4OFZA 1YTYA 5EDWA 2DVIA 1QDUB 4U6PA 3CVKA 1Z1ZA 2ADCA 3QRRA 2CPJA 1N5SA 1TL7A 5I4MA 1F2HA 4ZPVR 2V8GA 5HMWA 2GIQA 1XC9A 4DSJA 4B02A 3NEKA 1CJUA 2A2CA 2GGPA 2ZD1B 1SQEA 4L74A 3N79A 2ATCB 4U9RA 5KFFA 3B54A 2UV8G 4K4XA 3OLAA 4F0KA 4GVBA 1RE1B 4NPOA 2CNLB 4JI8J 1BLUA 4ZVRB 1J2VA 1SSMA 1S6PB 4CNZA 1QVFR 3LA0A 1XR6A 4Z2XA 1JLBA 2FC9A 2WSCC 4KKOB 2NCKL 2RQMA 4B3RJ 5HROB 2FY8A 3MEEA 3BGOP 2FJEB 4CLUA 4X64J 2ZBPA 2MLXA 2ZITA 1X9MA 3K5PA 3PFEA 2FHMA 2WLFA 1PAEX 5CYQB 3OTZA 1YP3A 4C3KA 2I9SA 4OZ0A 1AW0A 3LOUA 4WBFA 1FFGB 5I3UB 3GQ9A 3W9HA 3H5YA 1H7XA 4TXSA 1ZBTA 1S77D 2BJEA 2IIHA 1KRRA 4X64F 1N52B 3VBJA 3MPDA 1HL6A 4ECUA 3PNIA 2W2OP 2B9WA 1ACMB 3QQCD 5KT3A 1M5VC 3SCJE 1RXOB 1VQSA 2JSXA 2X1AA 1WJ9A 1HWKA 2XATA 2QIVX 2F65A 4DPUA 2P8IA 4KT0C 3DNCA 3E51A 4I0WA 5HQMA 4L3KA 3W2VA 3VR1A 5HVHA 3BYPA 3GPAA 1SJRA 3IR5B 5CA5A 1R8AA 5BJRA 2ZHBA 2ROEA 3U1NA 4WJBA 3PJWA 3CULA 1HBNB 3OW5A 4ED6A 1XHDA 1AFJA 1S6QB 5CZXA 3MCSA 3GV8B 2Z0GA 4QIVA 4PPZA 1OQ6A 4I2QA 2LEAA 2PO4A 3JTOA 1S1TB 3H40A 3I3XA 3TX0A 3H2LA 1THJA 5DDRC 4QZVB 3AA8A 2A3JA 2VFUA 3T9ZA 4G3PA 3AJ2A 3M8QA 3H8YA 1KC8T 5HLFB 2F9DA 3D28A 3V4IB 5GADU 1DAXA 2DHXA 1H6KX 4C98A 3BQ1A 3W9IA 3D3BJ 2A2DA 2JC1A 2FKOA 3WHIA 4GKKF 5LXRA 1S57A 3GJTB 2DPJA 3QT5A 2XI2A 1FWLA 4B9NA 4OI0A 2Q1LA 3FZ2A 4AYBD 2LVWA 3MPUB 5CZVA 1RU2A 2NLWA 1Q5YA 3CGIA 5DJBA 1JLQB 2FJDB 2EKYA 3LALA 1YBTA 2HHQA 5FJ4A 4F4WA 1UMJA 4O3PA 2I5JB 4C8KA 4LJMA 5GMDA 3GQ7A 5LSLA 1K1SA 1UVMA 4DMZA 4PG4A 4DV4J 2Z2ZA 1TUWA 2BACA 2BABA 3NCQA 2V69A 5KFTA 4KO0B 5DO2A 3M9NB 2W0WA 4I4BA 3QIDA 1OJ4A 3CF5Q 3KLGA 3CC2S 2P9CA 1XTZA 1NPRA 1RWPB 2XULA 4HZDA 3LP0B 1CS4A 3ZFVA 1S97A 4DS4A 1QQ0A 4MK7A 4NCGB 4MIWA 3QWUA 1K0VA 2F40A 4RNHA 4LRBA 2A18A 1XEZA 3R97A 2RS8A 4JUZA 3PY8A 3HKZD 2JWNA 4DR1J 4Q8FA 1RAGB 2ATLA 3OR2A 2WB1D 4R0EA 3M8RA 3PX0A 4NMXA 1L3TA 1VIOA 4PQUB 3O2IA 4DEZA 5KFKA 1SI9A 2O5DA 3VNPA 4Q8EA 2IAJB 3CCZA 2AJ1A 3FBCA 1IKWA 2B8PA 2WSEC 3BSCA 3UNYA 2JJ4D 3UDCA 1K44A 3GFXA 4ICLA 1B7YB 1TZ0A 2WVFA 1U1KA 2GC8A 4WYLA 4CM2A 4CQ1A 2YKAA 2WW8A 1IBCB 1FK9B 3QATA 4TY9A 5HK4A 2RRAA 2Z8QA 1I51B 1HI1A 3T1HJ 2CQGA 2DR5A 4O3SA 2J9EA 3G87A 5KFVA 1LWEA 2K1RA 3AXKA 3CDAA 4CH0S 3E3XA 2V0LA 2FPHX 2R2TA 3KJQB 3EPGA 1EIYB 2VG7A 5IQ6A 2DNZA 4TQSA 4O0IA 1DQ8A 1LW0B 4UOCA 2Q43A 5DM6Q 5D77A 2RMLA 2ZEJA 2V2ZA 5IT9U 3V6JA 4A8QA 4QOTA 1RLDA 1ROFA 2HQFA 1V5IB 3ECTA 5ETLA 1KQSR 1QTMA 1NJWA 3D68A 1RT5A 2DO4A 2H5EA 2HBQB 3FQKA 2K3KA 3IG1B 2W01A 3N5BA 3HFVA 2MMYA 4YB1P 4FYVB 3TA1A 4ANDA 3FWWA 3QWPA 2B5JB 1NH8A 1M5OC 4PEOA 4NI2A 1A7GE 2M7SA 5IXUA 5K20B 5KT2A 4OZLA 1TR0A 2OEGA 4FVMA 5C24A 4X2BA 2VG5A 5IT4A 4CH7A 4N41A 2XS7A 3KNAA 1SC3B 4U8VA 4FXDA 4XPCA 1TDTA 3CCVS 4ELUA 1CQNA 2VDHA 4JI3F 3Q0AA 5D8HB 2KI2A 3GFZA 2JF3A 3R5AA 2MEWA 1HV9A 1RTIB 4C0OC 4MYUA 4CTAB 3KHRA 4K6RA 4DX6A 4ZVTB 1QE1A 1TAQA 4P2FA 3MMBA 2J0XA 1YVFA 4NCAA 2OEJA 4B9VA 3BSYA 4UZBA 4B9UA 1UPMB 4YR0A 2CQIA 3ZZTA 4NLWA 4HH0A 2QJ3A 3EVWA 1TK0A 5D0GA 3M2RB 2YQ3A 1ZM9A 1WOPA 3R3RA 3MM6B 4XIUA 4DCOB 4KY3A 2C1EB 3A1YG 3LUYA 4NWBA 5A8KB 3PW0A 5EN1A 4CRJA 4IR1A 5FIIA 1DFDA 1YK9A 4RUCA 5IT9Y 3GJQB 4OHXA 1U49A 1XMQF 3D1QA 2JNJA 1EHWA 2BOPA 5D78A 3FJ2A 1V3ZA 3IS9A 5KFIA 1NJYA 5L6VA 1QSYA 6FDRA 1QSLA 4HDGA 3VGTA 2Z30B 1S1WB 4TN2A 2R8GA 1F5CA 2JX2A 2FQQB 4NLRA 4AA7A 3HHLB 2ZC3A 1JLGB 3CD0A 2BKPA 2VL1A 1FI4A 5F3TA 2AMCB 5J2NA 2FJAB 3C6UA 4PWDA 1BY9A 4B3TF 3RYLA 1H73A 1BD6A 1ZZFA 1RHKB 3UCGA 4TNOA 4I2PA 3RRHA 3ZZZA 1D8ZA 3AJ1A 2XQCA 2JFKA 1O0PA 3TYTA 3KLHA 3T5JA 3IWNC 3I9V9 1NM2A 4YUDA 1B0PA 3E2EA 1IR1A 1VBKA 1FA0A 4HDHA 4I64A 3NGDA 3JS9A 1KGQA 1WDTA 1NB2A 3I6PA 3M8ZA 5LSRA 4EWTA 1M5PC 2XZTB 2XI3A 3VHQA 3G9CA 1RZMA 3GR1A 2GVZB 1Q82T 4ZK7M 2YX1A 2GGQA 3MI7X 2MQQA 1HNVA 2C3MA 3F73A 1NMEB 2OGUA 2W24A 2BVZA 3BKUA 4TLRA 1TL3A 4DL0C 3JSYA 4DR4J 3MMAB 1NK8A 1U8WA 2E5GA 1D1UA 1EP4A 3R3TA 1CJKA 3VZIA 4MKYA 1VI7A 5ETMA 3Q83A 4H4KA 3DOMB 3IAS9 4J37A 4O44A 1U1NA 4M5DA 2Q79A 4RW4B 1OWXA 1QUPA 4DFKA 1UA0A 1GXLA 2Z4PA 2ZC4A 2GX8A 3GLJA 3TANA 1U1QA 3EZUA 5B0GA 1FRHA 2V50A 1QAIA 4NX9A 3OL9A 4CH1A 2QG9B 1YSJA 4QR1A 4OZ3A 2C22A 2KJVA 3BBFA 4LF9J 4F0MA 2OPSA 4CO1A 4LF6J 4IG0B 2ZKTA 4KQZA 1SSTA 1Z2ZA 4I7FA 1MW7A 4B3OB 2RHQB 3LGNA 1U0HB 2V2KA 3GJRB 1N34J 1UJ5A 4UOFA 1TK8A 4ZCKA 2HIYA 1EKSA 3HHLC 3AB2B 4PXDA 3V4EA 4NA1A 3M6UA 1FRMA 1KK5A 4LF6F 2OFHX 1KRUA 3DHWC 4CLKA 4NLGA 3Q8PB 3ET6A 3CD6S 5EWGA 4HT7A 4HT5A 4RUHA 2UVRA 2ZE2B 2YKNA 2VDIA 2WVCA 1ZM2A 5E33A 1V67A 2IUAA 4MKAA 3F44A 4B17A 1QD1A 3GQCA 2OI2A 3PW4A 1HR0F 4UQTA 3IC1A 2EVZA 1IBLJ 4B08A 4ZP9A 5AJ3J 4UT4A 2LQ8A 4URSA 2MKSA 4KR0B 1S80A 1OCXA 5F3ZA 2HHHF 3UD4P 2OLWA 3OPKA 5J1NA 3UPFA 4O4RA 4XPEA 1FWPA 1FXRA 3CDWA 2NPOA 2CPDA 1RT7B 4KHPJ 3PO5A 2QL7B 1YBUA 4IFVA 2KU7A 2ASLA 2K8GA 2O66A 3AY0A 1RCXB 1U1OA 3R7BB 3OTDA 3NY0A 3FMBA 1KHVA 2AT1B 3L9ZA 1I5OB 2GO9A 1FDDA 4GMKA 1C2PA 2DXDA 4OZ2A 1PJ6A 3R6GB 2CQHA 2QLJB 2VBZA 1UW4A 3PJ9A 5JJBA 4ZLJA 4KHPF 4U7UD 4UQGA 5AFUV 2PFFB 1NB7A 3BM7A 1V9OA 3M32B 3P3DA 1QY7A 1RT2B 4ZPTR 3EVMA 4OYIA 1Q78A 1BQMB 1TFWA 4F25A 1EZZB 2MYFA 2VJUA 2HQ3A 4ID5A 1DLOB 3Q8VA 4KV8A 4PRFA 2VFSA 3EGNA 3TA2A 5HI7A 2RKIB 2B3TB 2OUGA 3UE2A 1YJVA 4QPXA 1MSWD 1DTTB 2R9LA 1VQKS 3VAGA 4ECQA 2VPWB 1HBMA 4C8ZA 1IWAA 2CFXA 3FSYA 2BJ3A 2ZOFA 3UCUP 4CIOA 4J9UE 3KK3A 2VKRA 4IO9Q 4R7PA 3KJFB 1FJEB 1FT8A 2YH0A 1VRUA 3C8VA 2W4DA 4IR9A 3CDUA 1SKRA 1WI6A 5K8MA 3G82B 4RW8B 3PRDA 4WKYA 3EZOA 2DPIA 1CQMA 4WE1A 3G96A 4OYZA 1SV5B 1T03B 4ZVOB 1CG2A 1HMVA 3TUJC 4DV2F 5KT5A 5T14A 3LGMA 4DV5F 2HFNA 4FF2A 1MU2B 3UVJB 3W61A 1ZM4A 4PYDA 3THPA 3D8VA 2J6TA 4IH6A 4JV1A 2DR8A 3VALA 3W9JA 3VCDA 4OYWA 1NJXA 3ILJA 1ZH5A 2B0GA 4L72B 3M30A 3OUYA 3MMCA 2AHOB 4DR5F 2AEJA 1RTDA 5GAEU 4CDIA 2CDQA 3DCAA 1UEUA 3ETMA 1LOUA 5C5JA 5LT5A 5E3RA 1UJ6A 2R8JA 1X5SA 4QWDA 1NDPA 2JOQA 2ZHOA 1GAOA 2CNOB 4R5PA 3PX6A 3RR7A 3BQ0A 1NPKA 3OL8A 4OYBA 2LDYA 2HHTA 5THWA 3P6YC 1HNXF 4A4JA 2JRSA 5L1JA 3NP5A 3NBPB 1IM4A 3SDEA 1TUVA 1KEKA 1MMLA 3VBNA 1LXJA 3DC2A 4YS2A 1NK4A 1NEEA 1TU0B 3HDSA 4ATNA 2H5IB 4J09A 1IXKA 4EGLA 1L3KA 3IGNA 1MROA 4ZPCA 1T3NA 1R0AB 5J1EB 3HHDA 2XC9A 1N88A 2H54B 1T02A 1JLAB 1RT6B 3KWDA 4RW7A 2J7WA 3JAMY 1Q4RA 1YJWS 2RSQA 2DTJA 3GMGA 4O4GA 2HK2A 4AFFA 4MZUA 4PABA 2DR6A 2VZ9A 2F8MA 3H25A 4GC6A 2APOA 3WX4A 5GAGI 2R7SA 3HX9A 2YNIA 4WFNQ 4H7OA 3DMJB 5DLFA 1N33J 2VFTA 1LXAA 3BDEA 2Y0SD 3SMZA 1WKKA 2W7OA 2CUYA 3QGPA 1JJCB 4X4UA 1NJZA 2JZ5A 2E66A 4NCBA 5G0RB 4RBUA 5C7PA 3R5CA 3MM9A 1S7HA 1LWCA 4ZJOA 3D6TB 1N33F 2E9ZA 4LBPA 4O23A 1RWVB 3DLBA 2K3IA 2HBYB 1UFWA 3UD5A 3OFEA 4DR3F 2D7SA 5H9EK 1URRA 1HARA 3GIMA 2V8VA 3PKYA 3T9NA 4KNXA 1YZ7A 4E6UA 4MIBA 4I6YA 3K8WA 4K4YA 3N6NA 3DDKA 3NLCA 2ZD1A 5J2PB 1QTNB 5F8LA 3VQTA 2ZOMA 2UXCF 2ZH8A 3TARA 3HCXA 4RUAA 1Z4UA 2AIRB 5BYRA 4P9SA 2M5YA 1FJGF 3JSMB 3IBCB 1S6PA 2VQFF 2Q66A 1RWOB 4BBYA 3HVWA 5DQGA 2MHNA 2QA4G 5HROA 4IOAQ 1WC5A 4NLUA 2GVDB 2BXJA 5AE3A 1KRVA 5L1KA 1YG0A 5ETNA 3U02A 1Y00A 3Q23A 1PJ7A 2AYMA 1UWAA 5CYQA 3JYTA 1ZAWA 1UP1A 2JC0A 3BS9A 3PM9A 3HI9A 3PG9A 3KHHA 1S0MA 3DGPB 1RAHB 1GT8A 4Y2IA 4NLOA 2OMLA 1S9GA 1FNXH 1ZAVA 2RRNA 2AQ4A 2B8QA 1KK4A 2ASDA 3SCIE 2QIFA 1YJNS 3EX7B 2R8HA 2CIMA 4OI2A 2H5JB 5E5NA 3UR3C 4AUKA 2K06A 1HI0P 3NWGA 2AF6A 3B4DA 1S76D 4Z7CA 1JLBB 4KTQA 1R43A 5E0OA 5C25B 1X0FA 2BBEA 5HANA 1WC6A 4M9CA 4CCHA 2R42A 4LR9A 4FDFA 2EFNA 3W5YA 4ELTA 2KZZA 3NGRA 3EDRB 4G3IA 2RDIA 2HNZB 2QSFA 1HPZB 1HBNA 5KFWA 2QIAA 5CYMA 1S6QA 2GZOA 1NO8A 2XMVA 2U1AA 1YJ7A 2JFDA 2KRBA 4DSLA 1FKPB 4UW2A 1D9AA 2RQKA 7FDRA 3BO4A 3RAMA 3ZTPA 1S1TA 2D9OA 4FXVA 4HKQA 1YHQS 1NPPA 3T5HA 2FHJA 3ZZPA 2MZTA 4JI5J 5HLFA 3A4TA 2OHDA 1WORA 3HO1A 4P72A 4LRFA 4P10A 2DH7A 4L6V3 3ILOA 4Q7AA 4K4TA 4P2SA 5HO4A 1W7WA 1UWBB 2GAHC 5GAHI 2GV1A 3W2VB 3EM1A 3VTIA 3ENQA 1R6YA 3AHPA 3F56A 2D74B 3BSAA 5MAOA 2DKOB 3RB6A 1JLQA 3L7UA 4MTPA 5FD1A 3PO4A 1Q8IA 4OJHA 4DDFA 2WB4A 4HHHA 1KR4A 1QRMA 5KT4A 4KHRA 3CCES 4I2QB 1I3OB 2X3DA 3US5A 4NYPA 4ZVHA 2OI7A 1KQAA 4ZPBA 1MWZA 5B08A 2QMXA 4FZVA 2HMIA 1FD2A 1EQMA 1VQNS 1WC3A 1HHTP 4KO0A 1VQ9S 3HZEA 5DRKA 2V9WA 3M8QB 2KJWA 3LAMA 5A0YB 3PR5B 2V9KA 1M5KC 3TV0A 2IBOA 3AH6A 4KBIA 1Y5IB 3UN3A 3MCMA 2FY1A 2B4PA 4QU6A 2JLFA 3TWZA 4DQSA 3ISZA 2ASYA 1MLAA 1Q7LB 5H9FJ 2R3VA 4E8UA 4LF7F 2C2NA 1FO1A 1G3OA 4JI7J 2R8KA 2DGSA 1HWUA 3J80U 2CWKA 4AXJA 4M94A 2ZH1A 1NK6A 3MFIA 3IR6B 3MQGA 3K7RA 3GCXP 4X4RA 1T3OA 1XERA 3BKTA 3DLKA 4MFGA 4JI7F 4PQUA 4N69A 1FKOB 5KFQA 2UP1A 1WF2A 2VHEA 2B56A 3G8TA 3CD5A 3NOGA 4CO5A 3MECA 3CNQP 2P5VA 1FHTA 1CEZA 2IAJA 1IKXB 4H4MB 2Y8YA 1S9EA 2RILA 3SCLE 5F8IA 1RB0A 3IR7B 1TAUA 5CCMA 2PDAA 2OTJS 3GV5B 3VBIA 4M5LA 3LH2S 3HP6A 1FRJA 4ZIVA 3SZ2A 4RWXA 3CWJA 3RB0A 3DLGB 1NSQA 3C6TB 2YX7A 4RJVA 2D1CA 3AQPA 1CJTB 4NXNJ 5KT7A 4ZVGA 1X0PA 4EU0A 1S6OA 4A8FA 1FK9A 2UVWA 1OSCA 2CZ4A 2IM1A 4IHHA 2WZ1A 3OR2B 1YIJS 2QLXA 2XLIA 1NBEB 4AXIA 2V4RA 4F4KA 1BHNA 1Q7YT 3LQVA 3M2VB 4J9QA 4NXNF 2J76E 1VIXA 1LW0A 2HVIA 2FJVA 4FYXB 1PC5A 4M5IA 1AROP 3FGVA 4WFAQ 4Y2CA 3MUMP 4IYQA 3G86A 1GK8A 1IKWB 3D0GE 4ENOA 1DURA 3AQOA 5IQQA 3GE9A 2BZ2A 3R6LB 4CP5A 2UUAJ 3KUHA 1YWXA 2MJUA 2MQLA 4QQBA 3MEDA 4DCPB 1YBAA 3UW1A 2MZ1A 1YJTA 3W8GA 3TISA 4JI6J 2W4PA 4NYOA 5CXTA 4C48A 4AAWA 1TUGB 4PR6A 3J7Z5 3GP9A 2DIUA 2EBEA 5B0FA 1LWEB 1VLOA 3H0PA 2UUAF 4FF3A 4G3SA 3DK5A 2FVRA 2QC3A 5F0UA 2B5JA 1LWFB 1M5SA 4DUYF 4B3MJ 1KK6A 2HAIA 1Y5NB 4J9VA 4F02A 2R2SA 1QRLA 2ZJQQ 1F0XA 2IFXA 3ELHA 5A2QY 3F0NA 1JMTA 3CDBA 3DRYA 3R2CJ 1VYAA 3CJKB 2N4DA 2I8EA 2E9RX 2B7BB 4QIEA 3T41A 4A8XA 2ZUGA 2CJXB 4B3MF 2Q4JA 1KFDA 2GMJA 1Q53A 2V6AA 2XNQA 1P8GA 4JI1J 4CTAA 3RRKA 5IOLA 3KNGA 2KXFA 4BC9A 2IYIA 2EBGA 1JK9B 3G8SA 1RA6A 3K59A 2CQPA 4DN0A 4EYIB 2I38A 5M2UA 3IN5A 4LIRA 3MD1A 4LF4F 5EWFA 2EFVA 4FNIA 4DS5A 3N9UC 4J5OA 1MRLA 4LRDA 3I4HX 4NI2B 2DT9A 1HM9A 4ZVSB 3M2RA 1IUJA 3PXGa 1DJ0A 5C24B 3CO0P 5L9NA 2VG5B 4DV1F 1WC1A 3CC4S 3C66A 5A8KA 2V5HG 1DZ5A 2OSRA 1DARA 5ETSA 5D3GA 1M1KT 4ES1A 3VV2B 3TR5A 4N7TA 3E01B 1N5VA 1WSVA 1TP7A 3BN4A 2QV6A 1C4AA 2ILYA 3H90A 4DPWA 4PXEA 4FN5A 1RHRB 4ZP6A 2QLFB 4YY3J 5U2KA 2M4MA 3MMBB 4JI2J 3D4JA 4D3GA 3DOKB 4RO0A 1WELA 1WSRA 3LAKA 3HVTA 1V3WA 3R8YA 1GXUA 4AD6A 2XSJB 3WIVA 2V8DA 4LF8J 4ITSA 2HYIB 3M8SA 3DDNA 5E7OB 2FZCB 6AT1B 3L3CA 3FZBA 3PYDA 1NK5A 1UEKA 1U2CA 4YY3F 2UXDF 1R8HA 4LRAA 4J9RA 2JF2A 2LECA 1TKZA 2HBZB 7FD1A 1JXLA 2RU9A 1IR2A 2BM1A 4MYTA 3BV8A 3CB4A 1J5EF 1N0UA 2MKKA 4URQU 4XAKA 2N4CA 1QUVA 3GFHA 2AP6A 3KLVA 4X65J 2WBMA 2HHVA 4MYOA 2XY5A 1XMBA 3G6XA 4RNOA 3RB4A 3CJ8A 3K17A 4J90A 1RT1A 3EMTA 3ZNUA 3TEGA 2W7AA 2L48A 4LQ3A 4LSZB 2XSFA 3TUIC 4OZ5A 6FD1A 3GTYX 2M9KA 3N6LA 3R27A 2GVZA 4DZDA 3PW7A 2KZMA 2ALZA 2ZOGA 1U0SA 4OX6A 1HWJA 1XMOJ 5K8OA 1WG1A 3C6UB 4PWDB 3MMAA 2PA8D 1KQGB 1FRLA 2XWXA 4F0HA 3W2WA 4I2PB 3DOMA 4RZRA 4W90B 3HJJA 3IXCA 2CJBA 4LBIA 3KLHB 2IYGA 3LWMA 4RW4A 2ZDPA 5FLXU 1R8PA 1VC6A 3MC4A 2KHCA 4X4OA 2FZKB 1XMOF 3MWBA 2XYHB 2QYCA 4FBTA 3HM9A 2IRYA 2IVFB 3M8PB 3CJTA 1SH2A 1Y9OA 2BQRA 4HH1A 4IG0A 1HNVB 2D3OR 3D7SB 2ZH3A 2DHAA 1S0OA 4B3OA 1WOOA 1MN7A 1U0HA 4RWWA 1GMVA 3DRSB 3SV3A 2C42A 2R7TA 3PW2A 2MJNA 1CJKB 4PAAA 2VU5A 2HURA 3D1HA 2DNHA 4DPXA 3QT8A 4WP9A 1JXEA 4CWBA 4O44B 4U7UK 2ZJPQ 3OVAA 3DLHA 3V4MA 3Q2SC 4XK8C 4LFBF 1H72C 4CNYA 3SBMA 4HACB 2YNHA 4RW9B 2A6MA 4OV1A 1WI8A 2ZE2A 3C14A 2CNNB 1SH3A 2HLTA 1I1GA 1W2BR 1JLFB 2GS8A 3NL0A 3VVUA 2DGVA 1NRKA 2C3YA 1SC1B 1NK7A 1OY9A 2AX0A 1UAWA 3PYFA 5I3PA 3RTVA 1IWGA 2NPFA 4JV5J 2CVEA 4I7FB 4ER8A 2K7KA 3A8IA 4GKJJ 1KGTA 5ETVA 2VPXB 1BUXA 5GMKa 4M5JA 2BW2A 1QAYA 5IV3A 3CCTA 3VBPA 4N8OA 2XBPA 3KMQA 1NNDA 1NJIT 3W7BA 1WEYA 5KFOA 5K5MA 4EA8A 3LO3A 2GJ2A 4DUZF 4E0DA 3K58A 2WSFC 3MPVA 3FMWA 1HBOB 4KC5A 3ET6B 2QFJA 1T9VA 5FLXY 2G9OA 2CPHA 4K5SA 5DEMA 2HS3A 2CPYA 1NDKA 5T41A 2CYYA 2UZAA 4LFCJ 3CEDA 1SJ1A 5B0BA 1RK8A 3M32A 5I3QA 3D5MA 3CJSA 4RW6A 4UTGA 2CRLA 2B4UA 2D3O1 1SQGA 3NKYA 1J27A 3OXLA 1SH0A 4H4OA 2GFFA 3K5LA 4NXMF 4J9KA 3HSZA 2K2PA 2VD3A 4F8RA 4TQRA 2CADA 5E3CA 1P9QC 2HNDB 4NEYA 5AXMA 4IFVB 5B0CA 3CCUS 4FF1A 2IJNA 3EE3A 4ED8A 3D67A 2IA0A 4EFAC 2V4JA 4YDDB 1C1CB 1PIEA 1YJUA 5DM7Q 4H4KC 2L08A 2DHGA 1N48A 3JTNA 4PG5A 3JQMA 3OR1B 1CLFA 2PA3A 1IKVB 3H2UB 1SC6A 4LBHA 2RT3A 3NGTA 5A6WA 1WTBA 5IFMA 2E5LJ 1S1VB 4IQXA 3G82A 4EI2A 4RW8A 3HHEA 4K4WA 4ZJLA 4DCJB 3S7RA 4QYZJ 1U02A 2LXUA 1U6ZA 1SV5A 4C3LA 3PX4A 1WHYA 3SQOP 3OHAA 2GGOA 2DY1A 1TV6A 3DU5A 4OHYA 1HNWJ 4WU2A 2J6SA 1MU2A 2QTWA 2IC7A 1LKZA 5EX0A 3W1YC 3UVJA 4MT1A 1K47A 2PMWA 1SSQA 1YX2A 2DNNA 1RJJA 4F3QA 2CQ3A 1G6BA 4U95A 1BQXA 4JYAJ 1Q86T 2RQ4A 2HBRB 9ATCB 4WFYA 2I0XA 4AL6A 4WKRA 2DNQA 5KFHA 3OFGA 3UNGC 4EZ9A 2HWHA 2E5HA 2HQCA 4LQ9A 3DN9A 2D41A 1FFWB 4WXWA 2AGPA 4DU8A 3MEGA 1XNQJ 3O6QA 2Y8WA 4P7VA 3Q8RB 2Y1IA 1CC8A 3R1LA 2UXBF 5MLCV 4X62J 2OPQA 4G1QB 4IH5A 3GZ7A 3BGRB 5EWEA 4OZ1A 4ZLLA 2Q3PA 5FDLB 2WTFA 1KQKA 2KFZA 4DLGA 3M4XA 5E3QA 2HVZA 4LT6A 3AA9A 5DGAA 2YKOA 1KLMB 1S48A 5BXIA 2X7IA 3NZ2A 2AD9A 1RYSA 3BDPA 5L39A 3EXYA 3M2UB 2HFZA 3GONA 1R0AA 5J1EA 3CCRS 5ITHA 3E8OA 2G1HA 1RTDB 4DV0F 3M7VA 3OXFA 5KFXA 1RT6A 3VAMA 4ZKAA 2EPIA 2OO4A 2FJWA 1AFIA 2YPZA 2CJAA 2VPZB 2EK6A 2MKCA 5B09A 2JEJA 3NG8A 4Y2MA 1PILA 5ETOA 4DL6A 2H9ZA 1V3SA 3V5RA 4R5PB 2GCFA 3I0SB 1Y7PA 4OX8A 3VBLA 1SBRA 3QAUA 2IDEA 4DQIA 3DMJA 2DNYA 2WW4A 3RW6A 4IUFA 2M88A 5HQLA 5KFPA 4DV6J 4E98A 1HNZF 1DQ9A 4ZP7A 5CHCB 5DGBA 5HSPA 2HKEA 2EXUA 3PW5A 1Q8LA 4ECZA 2G0CA 2LFVA 4AT1B 1CBKA 2VPYB 3K5MA 3VAIA 4EA7A 1SB6A 4LSLB 3CCJS 2JL9A 4DV6F 4YHHF 2YQ1A 5ETQA 5CQGA 2OP5A 4DI6A 3W65A 5F41A 3FC9A 1NK0A 3V6HA 1XK8A 4O4GB 3EDQB 3QNWB 4QBUA 5KG0A 5KFAA 3QZ8A 4OYOA 2W25A 2F7VA 2MSTA 4OX7A 1IVZA 4DR6J 2YNIB 2YH1A 3HFKA 1W26A 3R0SA 3UFCX 5J2PA 4LUBA 3ZXWA 2EFQA 4IDKB 2VFVA 5I42A 4LFAF 2VICA 4WP8A 2DD8S 2C2ZB 3HJVA 1MG7A 3MMJA 2DXFA 2DNPA 3ZZUA 2B6AB 3AXMA 2PE8A 2F3JA 2HZVA 3LF0A 4F7VA 3M1VA 1SUQB 2OAUA 5KAKA 4D3HA 3RG6A 3GSDA 3ZZRA 2GVDA 2MQOA 4RU2A 4M1KA 3OSNA 2EC0A 3OVBA 1AXQA 1S7IA 1TK5A 1KP6A 2IC3A 2WHOA 3CIZA 5K8PA 2QA2A 4JI4F 2P2CB 2YX4A 3RAQA 3OU9A 3DGPA 1E6YB 2OELA 3HHLD 3PYGA 2DNRA 3R1WA 1H0HB 3DRPA 4P75A 2MY7A 2BYCA 1KVIA 3FRYA 2MY8A 3MURP 3GILA 2V34A 1FDAA 3VZHA 4N6BA 4WZMA 2J7KA 1FESA 4I68A 5IC6B 3HVRA 3VAHA 2OTLS 1XR7A 2C2DA 4OJ3A 5C25A 2KFNA 5AFUU 2HNZA 1HPZA 3QSIA 2PD1A 3SIPB 3JYTB 3EXCX 4M5NA 4NRUA 2B51A 1FKPA 3H20A 2A10A 2PFDA 2VF3A 3CT9A 4USWA 4J9LA 3WZ0A 2IA6A 2HGLA 2XMKA 1SJFA 1JJ4A 4BS2A 1S9GB 3KDOA 2YXLA 3KJVA 1GMWA 2LXFA 1AYEA 1RAJA 1QM9A 3QRQA 1UWBA 3IWLA 3OW2R 3HXMA 4DWIA 2NXCA 4ZVUB 2HQGA 4USTA 5KFLA 1TL1B 2QX0A 3MAHA 4EK2A 3RUBL 4X84A 5L1LA 3OH4A 1ZPVA 1NZAA 3MR7A 2P2OA 2AWZA 2ADBA 1OPIA 2ASJA 5CYMB 1IJEB 1FVQA 3PHTA 4GKKJ 1NDLA 4ECVA 3K5OA 2LCWA 2XY7A 3MR5A 2HWIA 4YB7A 4Q0BA 4C3MA 3EEVA 4HTIA 4WTOB 4DQQA 1KHRA 4DFPA 2LA4A 5A0YA 5HMZA 4HZCA 2L9DA 3DGVA 1FF2A 1CSJA 4EBDA 5E41A 1FXLA 4IG3B 3D98A 1TQLA 1FRIA 2KG0A 2XLKA 1UA1A 2XMJA 3MEKA 4A8OA 1T94A 1WEZA 3TIOA 2H3EB 4DX7A 1F1BB 2FVSA 3DJ4A 3ISND 2HHWA 3SRTA 2V68A 5IT0A 2UV8A 3GYGA 4JBCA 4C8OA 1YP4A 1HD0A 1N56A 2VKZG 1RCOB 1LXNA 2M3DA 4C8LA 5F9LA 1PYSB 1HIYA 3OUPA 2FTRA 1FKOA 2HMIB 1YKWA 2ZH6A 3DLLQ 4F3MA 2EC2A 3HVAA 1TMJA 4ANCA 2XHWA 4RKUC 3UDLA 3GUEA 4FPIA 1WHWA 4H4MA 1IKXA 3DOLA 3FEXB 2WONB 2CVIA 4DQRA 3Q89A 4KE5A 5D6GA 4YDXA 4OHZA 5HAOA 1HQ2A 3PR4A 1KTVA 3DLGA 3W60A 3C6TA 2VH7A 1CJTA 1TKTA 5GAGU 3G8QA 4ZDNA 2ZKUA 4IHFA 4NZ6A 3C15B 3Q8SB 3DDIA 3DLKB 5LMUJ 1X8DA 3RU0A 3M2VA 1VR6A 1ZYQA 1FE4A 2EWHA 1JWWA 3MECB 3CW2C 4GRSA 4HI2A 3SSQA 4NEZA 2EW9A 1UVKA 1S9EB 2IVYA 1VC5A 1RT4B 3O3LA 3MQHA 1M90T 1JNRB 4DLEA 1QRFA 3W5ZA 2F4VF 2QL9B 4NE9C 2KT5A 3BGUA 3JQYA 4ZCIA 3IGJA 5LMUF 1YZ6A 2DK2A 2J9DE 3Q1XA 3GSIA 3BH6B 1RTZA 1Y3JA 4DSIA 2XGQA 5AXLA 4OIXA 1OO0B 3DXSX 2Z2LA 3SFUA 4USIA 2HHPA 3ONQA 3FSBA 3AFGA 3QJLA 1XWLA 4OI6A 3D0IE 3K57A 2QGFB 5G4DA 2B9EA 1KD1T 3I87A 4F50A 4DR2F 3JTPA 4A48A 2CQDA 1C0TA 2VC0A 1LWFA 1O5JA 2IPOB 2BJDA 3Q24A 2KT2A 3CIMA 4OYMA 5CCLA 2IJFA 3GOSA 4S0MA 1XNRF 2Y1LB 3CJKA 4HHUA 2HRYA 2W9CA 3J7AN 5HP1B 2XYPB 2KH9A 2FHKA 3RBXA 3MEDB 2ROPA 4LIWA 1EETA 2OH2A 1GQEA 4A8KA 5HVFA 1B3TA 4HTJA 2EG1A 1GTEA 4ZCMA 1NLKL 3HSGA 1EB0A 5HJXA 2EG2A 2M8DB 1XATA 3JSBA 3TDTA 2XWYA 3LPYA 2RDDA 4C11A 2AV5A 3TVKA 2AZ1A 3HSJA 3PMOA 2KXHA 4AL5A 4OJ1A 2MTLA 3R5JB 2NSCA 1QVGR 2X1FA 3VBMA 4JI3J 3LP2A 4ES2A 3EJMA 2HRUA 3EG4A 1R7IA 3HLUA 2M2BA 1XR5A 3C8YA 4Y6IA 4L3NA 4DV7J 1UEVA 3I5CA 2HIQA 1OY8A 3H59A 1RAOA 1IM6A 3LW5C 4ZLNA 2BJ9A 2DNOA 2FUG9 1HNIB 2DJWA 1U7LA 1M5HA 4U67Q 4PXBA 3V6DB 3F1XA 3NNCA 4DBQA 3E01A 2UUCF 3EUNA 4K2JA 3QT7A 3UQSA 4DV7F 3A3PB 2E7XA 3PCOB 4NRTA 5KFDA 1D9FA 1S99A 2QA1A 5BYQA 3OT9A 1KVKA 2Z2YB 4OYPA 2MLYA 5CABA 2AEFA 1PAUB 2W9AA 3OBIA 1FNMA 3DOKA 3MM8A 1OS5A 5DDQC 2ZVSA 2XSJA 4F36A 1YRXA 1GFWB 3JQKA 1EX8A 1MN9A 2KL8A 1H2VZ 1WKJA 4P71A 3BQ2A 5GAHU 1WD6A 3MCOA 2C28A 2OI6A 1XMQJ 1L3SA 3FBBA 1Q1KA 2JHEA 5L46A 4ZOSA 2HW3A 3PDNA 2R7QA 4FNHA 4X4VA 3G6YA 1TKXB 4MH8A 5D3GB 4NLQA 1RAAB 4DJBA 1F9FA 4X66F 1VQ4S 2IVMA 1RBAA 2GQQA 1H3DA 2K7JA 2CWXA 5D0HA 3NNAA 1JXVA 2X51A 1YI2S 4GVLA 2YPYA 1J5OB 1FERA 3NS7B 1X9SA 4RBTA 3BBBA 2M0GB 4B3TJ 2WAQD 2MHEA 5KFBA 3HVTB 1SQFA 4BHQA 1D8YA 2DY9A 2BRLA 3LANA 3KWCA 4WFXA 3T19A 4QWEA 3M8WA 1VHIA 2DGUA 4LR7A 2KFYA 1X4HA 2HHXA 2HFUA 2VA2A 1KRPA 2W0VA 3H7HB 7AT1B 2AKWB 3M9MB 1TKZB 4B3SF 4XDCA 3H5SA 2W7PA 1T9WA 2F4FA 1N4IA 4K59A 1Y10A 2AYGA 3G71S 4MMOA 3GYNA 4KQLA 4G1IA 2VV5A 3B4MA 4L76A 4R8UB 1OSDA 1Q95G 2ZJRQ 1TELA 4M5HA 3S6EA 5HATA 1WTFA 1KQFB 1Z2FA 1ZZNA 1RT1B 5K8NA 2ICXA 4OJGA 4EBCA 3RBEA 3F41A 1PYTA 3M8PA 4BLGA 2XTJP 5EUHA 1GEHA 3IA0A 3U1LA 1C1BB 4XDDA 4WZQA 3GV7B 4LVOP 1RT3B 2EKNA 1ZM3A 2DEIA 1GNKA 1KOHA 1HYSA 4ECSA 4PUOB 2RQCA 3DRSA 3SQGB 2LQ5A 3PIPQ 3FRZA 2QN6B 1A6LA 1FX4A 3AD9C 3Q8UA 3C3LA 1DBDA 4NLPA 3W2WB 5EHHA 2VASA 1UVNA 1U24A 5K9FA 2J7UA 4K0KJ 4ZPDA 4W98A 4HACA 1Y0HA 4RW9A 3EGWB 5E2QA 3TP2A 1EJ7L 2QLWA 1JLFA 2V8PA 2XMUA 3D6MB 4DX5A 2XO6A 4DR7F 3P47A 3FSXA 4ED3A 2OFGX 4K0KF 1R31A 3T1YJ 3RR8A 1XN9A 3K0JA 2PGCA 2XYGB 2XO7A 4DFJA 2RJZA 3EWGA 3ENAA 4NA2A 2C2KB 2RVJA 4HYKA 4R25A 2ZZTA 2C2EA 3U27A 1GMWD 2ERRA 1HR0J 1KNZA 3ST8A 3QO9A 1RISA 3T1YF 1G95A 3NGSA 1SL1A 1HBOA 5A8WB 3RBZA 4F2RA 5DS7A 3N0VA 2HHHJ 4QWAA 2DGWA 3TX8A 2YNHB 3NGUA 1MMDA 1PCAA 1S4FA 3C14B 1N5TA 4PXCA 5IM0B 2NS1B 3PRVA 1REGX 2MQ8A 1B7FA 4KGKA 5DG9A 3ZZYA 1X4EA 1SXLA 3MR6A 3O44A 3Q2TC 4IKAA 2RIJA 2J9DA 3KTQA 3OL7A 2YWEA 2WLGA 3DLJA 3MAAA 3D66A 3SUCA 3IO1A 4WTYA 1B0TA 2POKA 2R7OA 3L7PA 5KG7A 1PG5B 4EQYA 5J2MB 5J2QB 3P45B 4KNRA 3AT1B 4TU9A 1X4AA 4N27A 2HNDA 1YRTA 2UU9F 1HLWA 1VOMA 2Y3YA 4M2BA 1UVIA 2J5AA 2FHOB 2DGOA 1YITS 3VGUA 1C1CA 4CT8A 1S6UA 3KOAA 4UF4A 2FLOA 3EGZA 3BH7B 3R5GA 2P5ZX 3KLEB 2R2RA 1F9HA 1C4CA 1NCLA 1F3FA 3OR1A 3ILLA 1UJ4A 3MDFA 1IKVA 3FCVA 5KFGA 4LSNB 2HWTA 1VISA 4G65A 3BPDA 2UUWA 1S1VA 2ALYB 2MDAA 4RW6B 5M2RA 3EICA 1UPPA 4GC7A 4XTTA 5L6SA 1HWLA 1GMUA 4ZPAA 4H4OB 1RI7A 4O3NA 2CG4A 1GX5A 1FJCA 1TVRA 2DGTA 1S4EA 4M95A 1JLCB 4JV0A 3PFOA 1MR9A 2V0JA 4ZN1A 3U7JA 3SI8A 2DYAA 1JQGA 2QSWA 3HMJG 2BANA 1V5VA 1TFYA 2V4JB 4PPDA 1W2IA 1PGZA 3S8SA 3RZAA 1S5ZA 2IRUA 2L9WA 5EGYA 5HVGA 1KLNA 1JX4A 2O3DA 4DV2J 3KG4A 1FD8A 1Y4ZB 3SEOA 2EFPA 3CJ4A 4ISXA 2BMBA 2HK3A 3MGJA 3BJYA 4MJKA 4DV5J 3ISNC 1N6QA 3JXOA 4KH0B 3HSDA 2PN6A 4HCQA 3ZC4A 2E9TA 4HUSA 2GJIA 1WF0A 2M8HA 4CZCA 1F2GA 4G1QA 4FVCA 1TV6B 4U7CA 3NWRA 4NLTA 5JVGQ 2DHSA 3BGRA 1R3NA 1RYRA 1G4CA 4KFBB 1SKUB 2VBYA 4DR5J 5FDLA 3RAXA 3P49B 1ELOA 2MKJA 4TU7A 4KGMA 3I3AA 4AC3A 3HJFA 3W5XA 4MIAA 1NHVA 1KLMA 2GHWA 5E3PA 2LDIA 4HL9A 4A8WA 3GG1A 3IFEA 1E6VA 5T7LA 3M2UA 4ED4A 2XS5A 1SIZA 1FTRA 2QLBB 2ZVIA 1UCNA 1HNXJ 4QR0A 2VJVA 3OTBA 2P6TA 4JI8F 3MEGB 1GX6A 5BR8J 1PYOB 2EI5A 2H51B 3FFIA 1NKEA 4P7TA 2E29A 2CJQA 3TEHB 4B3RF 2VG6A 1EARA 2OPQB 1OPZA 3I0SA 2FGCA 1F5AA 3NAIA 4I1TA 1PBUA 2HAFA 1X5OA 3TOQA 2WLDA 2YQ0A 3HT0A 2I2YA 2C3OA 4ED1A 2VFRA 4DG1B 4IRDA 2F63A 5F9NA 5BR8F 1HWIA 1SKWA 3MR3A 1X60A 4IO1A 1GH8A 4WFBQ 2WK4A 4FYWB 1SPBP 3UR0A 1LK5A 3ZNJ1 3H4DA 2RAQA 4ECYA 2GMLA 1HBUB 5JMNA 3DRRB 4LSLA 3UI3A 4MFBA 2LEBA 3BN7A 1G97A 3HHKA 2B7CB 2D3UA 2MZSA 4RBVA 4ECRA 1WF1A 4ECXA 3DU6A 4HI1A 2IMOA 2MKHA 3N6MA 1HM8A 3GIJA 1CULB 3BREA 4X4NA 1NXIA 4NMLA 1VLYA 4WK1A 1S1UB 2N7YA 2OPPB 4ALZA 4C6AA 1Q0NA 2EFGA 4IDKA 2XNRA 1S1XB 5HN0A 1WACA 2BJ1A 4DR3J 1OQ3A 5B7WA 3ENVA 3BR9A 5JXSA 3W66A 3FQLA 3VGVA 5B0DA 3S01A 1PJ5A 2DR7A 2H48B 4TKTA 3I31A 2B6AA 3OH0A 2DNMA 1ZA2B 2W9BB 5C42A 4UUXA 4YOEA 1SUQA 1U6BA 5LMNJ 2RF2A 5EX3A 1NU4A 1G2EA 5KFEA 4PG7A 2I6WA 4LREA 3QIPB 1HI8A 3MTKA 3NS6A 3NGKA 4C97A 2DITA 4WWSA 2ZM6J 2UXCJ 4TY8A 1JKHB 2BE9B 4JB8B 2AU0A 1U48A 4MAKA 5DLGA 2XCPA 3X3UA 1FJGJ 1L0SA 2MKIA 1XBWA 2VQFJ 3OH2A 3H5UA 2TDTA 1RHQB 5LMNF 1VQLS 3SSRA 5KG6A 2NUUG 2HQIA 1E6YA 2BQUA 1K8AT 2IU9A 4EYHB 2V4QA 3QLHB 2ZM6F 1G7CB 4DL4A 5I42B 3V81B 2R7VA 4I6AA 1D09B 1S72S 4B9TA 4KPZA 4DV4F 4KAIA 1DHMA 1EKRA 3MR2A 2W2NP 4ELVA 1FXDA 3M1VB 1HD1A 3TJ9A 5M2PA 4OI3A 2BR0A 1B4SA 3ETOA 4FPRA 4RR5A 3MAQA 2BE2A 4J9SA 1RWNB 3R2WA 2IC3B 1LK7A 4ILMA 2E1CA 3MM7B 3NMRA 2XMMA 2ZH9A 2Z56B 5ETTA 4BWMA 2WOMA 1N5YA 1OYEA 5F0WA 5C2GA 2DNGA 1VQ6S 3M6WA 1NAQA 4I69A 4DU7A 1U1MA 3DRPB 4ED0A 3D6HB 4AE5A 4EBEA 3CMAS 4DR1F 3U1MA 2YY3A 2ZNZA 2MGZB 3P8BB 5LOQA 2JEGA 3N28A 3DHOA 4N56A 1B64A 3P5TL 3OHBA 4P74A 3EGVA 1T8EA 4EEYA 4BWJA 2P9EA 2AGQA 5A6PA 2DRDA 2HZAA 4HVZA 4B9SA 2VB6A 1VFJA 1U25A 3THTA 1TL1A 4WYWA 2ZZNA 1FWYA 1HQUB 5D0RA 5LL6d 4E75A 2HFOA 1EWWA 3MCNA 1U09A 5BYSA 3HD2A 4C9DA 4ZN3A 3UDVA 4DHVA 2R7RA 1VQ7S 3R5DA 2OKQA 2E1PA 1N54B 4QIFA 4Q44A 4J9NA 4CYUA 9RUBA 4GO5X 2QYGA 2VQEJ 3FBFA 1FRXA 4CLWA 3IAM9 3KJVB 3T1HF 3X1LB 5DDOC 4OLOA 5CD4A 3O8WA 4BC7A 4IG3A 1OMSA 5KTQA 3CMQA 4J91A 4PG8A 5HBMB 4G87A 1RWUA 1J2ZA 3ZO7A 2V0HA 2IJRA 1P6TA 1NUEA 5ADZA 3KLFB 2VQEF 3J7YI 3EH0A 2X1BA 2C3UA 4CO0A 3BFPA 2LQBA 2FDNA 4NOHA 4ED7A 2NXUA 3HFZB 1JIHA 2HNYB 3DM2B 5KG2A 4FYYB 2UUBJ 3BSNA 2VONA 2ZDOA 2FLLA 3TA0A 2P9GA 3P1BA 3FNNA 2R7UA 2CA9A 1QLNA 1RP5A 2ACMA 5DG7A 3J81j 4Q0BB 3VF0B 4LF7J 1K9MT 3TZWA 1H74A 2D9PA 3CC7S 3CTRA 3OV7A 4M98A 2XGPA 5F42A 5DZ7A 1BXNA 2VIHA 1NSAA 4KPYA 2UUBF 2WONA 2WLCA 4C0BA 2OIHA 2DH9A 2KM8B 2B9XA 2UVUA 1ZTWA 3Q8YA 1ZPWX 2WCXA 1B70B 1APSA 3OTCA 1S59A 4PWUA 5IC4B 1CJVB 4J9OA 1P9YA 5KG3A 3HZGA 3VAJA 3QGIA 3MM5B 2E5JA 1FNOA 4V19X 4CLFA 2ZFHA 3KK1A 5D15A 3C15A 2PI4A 2FVCA 4ZS6A 4ZVQB 3NAHA 4A8YA 1NKBA 3CCQS 2A0FB 2ZNYA 1URNA 2HFSA 3UWTA 1FEHA 4TLQA 2NYHA 3N01A 2B4VA 2DGXA 2DRAA 1S0VA 2XG8A 3DOLB 2JEFA 1WKLA 2AEMA 1AUSL 1RT4A 4DN9A 2QMUB 1KDNA 1RHUB 1WWHA 4FS2A 1T95A 2YNGB 3UD3P 4YN3B 2CPEA 4NZ7A 1WEXA 1IQZA 1FCAA 1L3UA 3HT3A 5AXKA 4N47A 4Y0FA 2KHDA 2AW0A 3NCPA 1TKTB 3TQ1A 1N32J 1VRTA 3QFHA 1UETA 4Q43A 4K4VA 3QJPA 2E7VA 2FJXA 2AJQA 3I32A 2W2MP 2L3MA 1RABB 3WIUA 3VBKA 2R2UA 4IFYA 1ZA1B 2CXEA 1N32F 1VQPS 3J81U 1NZ8A 1I6JA 5LM7E 3Q8QB 4V19J 2XMTA 1QREA 5HP1A 5DQHA 1K0TA 2X3GA 4DUYJ 2KM8C 2IMWP 1MMNA 1UFKA 1YLXA 4R0JA 2AJFE 4PYAA 1RU1A 5LJ5Y 2F1FA 4L75A 4B9MA 4QR2A 2E44A 5CYJA 3J80Y 3GB0A 2CQ1A 3HK2A 5ADXV 3QYYA 1N4LA 2HFVA 5KG1A 3ZTQA 1SVDA 1C0TB 5H1SV 1WHXA 4JV2A 1IN0A 2XMWA 2KTQA 1KONA 2V0NA 1RBOB 4YR3A 3KDNA 1U4BA 8AT1B 5KG5A 3HF5A 5IS2A 1FDNA 2YWWA 3KLIB 2LQJA 2CJYB 1FKAF 4M99A 2W9CB 3V2UC 1HNIA 1FRKA 4LF4J 4K4ZA 3PHEA 2E7WA 2DBBA 2V63A 3V6DA 2ILZA 1RTHA 3KK2B 3KWMA 4HLBA 1EETB 4DR4F 1C0UB 3DFEA 2C2MB 3QMQA 3IBWA 5CD4H 3OGZA 1W25A 4DV1J 2CKWA 3ENWA 4C11B 3TUPA 2FC8A 2LLZA 4G3QA 3B78A 1F9EB 1TTHB 4J9MA 4DPYA 2G2YA 4KPCA 4M5KA 3KWEA 3LP2B 3UN2A 2OD6A 2NR0A 4WIIA 2AZ3A 2AJ2A 3CJQA 1YRUA 3FK4A 4Y00A 1VCTA 1WNEA 4DSEA 2W2QP 4LF9F 1SJ4P 2LA6A 1TKDA 2Y0BB 3J81Y 3T6JA 4K4SA 3VWSA 1TKXA 2O01C 4USVA 2AQ9A 2ABYA 3MTJA 5F8MA 3QPIA 1TL5A 3L95X 4ZA1A 4RU9A 1N34F 1DY3A 3MFHA 2PSZA 2IM2A 4KGXB 3WBZA 4W4MA 4ZITA 1LV5A 4N8NA 2JEIA 1J5OA 4P6QA 2UXDJ 4OMFG 3KXDA 2MZQA 1LWXA 2ZH2A 3BSSA 4K50A 3MM8B 1AZSA 4FF4A 4HEA9 2ZBIA 3CPWR 1IKYB 3MOJB 1ZTTA 1J5EJ 2HZCA 3K2YA 3R7SB 2ZBRA 3KG0A 1UFLA 1NHUA 4P73A 2DCLA 4IH7A 5H9EJ 3DYAB 1KBRA 3BXYA 3GYXB 5H9FK 2V2QA 4C4WA 2DCUB 4DV3J 3TNVA 1RQ0A 1IBLF 3L09A 5AJ3F 1RKJA 2IHR1 1PKUA 4CLPA 2JVRA 2V8HA 4OL8A 1O51A 1U1LA 1O8BA 3C16A 1GXTA 1KVJA 4R8UA 5SUHA 1M1HA 3WC2A 4ILLA 3RBDA 1Q8BA 2BJ7A 4QCLA 2KB2A 3D3CJ 2DXEA 4DV3F 3QRPA 2Q6BA 3M8YA 1H38A 2YVSA 2W8KA 3T57A 3HPOA 3KG1A 4USHA 1BQNB 2PMZD 4Y2AA 1C1BA 2GNKA 1RAEB 2JH3A 1RT3A 1UW9A 5KFJA 2AGOA 4USMA 3G6ES 4FKXA 3SYZA 4KB7A 1PSDA 4H54A 4DL7A 1HQEA 2DNKA 2FLPA 4PUOA 4PQAA 3SQGA 1U2RA 3GFYA 4KHMA 1VQ5S 4KIAA 3DXBA 1VHFA 2QMWA 4X4TA 2RU3A 2Y1JA 1MR7A 1LW2A 1VQ8S 3P5BP 2COLA 1KKHA 1Y5LB 2BRKA 3SXLA 1N8RT 1SC4B 1GTHA 4OI4A 4C0HA 1A9NB 3DI6A 4WXOA 2OPRA 4FBUA 5D0EA 5D4OA 3JAMU 3I96A 4X4SA 2LYVA 3GIRA 1UKUA 2GHVC 2RHSB 4DQPA 3I4PA 4WU3A 1BWEA 1BC6A 2QRRA 4QPTA 2DISA 3IRXB 3CD7A 1Q8KA 3H4BA 2YNFB 1HYSB 2FVQA 4MKBA 1UVLA 4LFBJ 1SL2A 1YQHA 3B82A 2I5KA 4WF9Q 3LP1A 4WIQA 1SJQA 3W3SA 3MPYA 3ILIA 3THVA 2H1YA 4EUVA 2BQ3A 4URGA 2QZ8A 2RRBA 1U2FA 4TVAB 2M52A 2MQMA 3BZQA 1HA1A 2ZHAA 2CZVC 5KFZA 2G2OA 4P2XA 2RNEA 3ZZOA 1T05B 5A8WA 4DZ6A 1YP2A 4ZHRA 5IWAJ 2MQPA 5GADI 4O3QA 3IMQJ 1RSCA 2HSEB 5IM0A 3QGGA 5HQ8A 3DKDA 1T7PA 4K2XA 3SV4A 3W64A 1FX2A 3I5AA 1NSKL 1R0BG 3IRWP 3AOAA 4P2MA 2MZJA 2N3OA 4U96A 4DUZJ 5IWAF 5K14B 2MXYA 2GQ2A 5DQIA 3DLEB 5J2MA 4DFMA 2XLJA 4ID8A 5J2QA 2FHJD 3H42A 1RAIB 4DL2A 1WG5A 1VQMS 3B8HA 4RNMA 4E79A 3L7OA 3QO9B 2KN4A 5A8RB 3ITHB 4NA3A 2CDRB 3KLEA 4OV6A 3BRKX 3A13A 5AT1B 2HQDA 2XZDB 4NXMJ 3OJUA 2G2ZA 5L1IA 4LSNA 4DOZA 3N4WA 2WVDA 2QO3A 2BOAA 2PIIA 2ACYA 5CH7B 2EEYA 4KRWA 4IQMA
chains in the Genus database with same CATH topology
4K6RA 3R5BA 4EA9A 1XATA 5DEMA 2W0VA 3VNPA 1KK5A 2WLCA 3EZOA 3TDTA 5L6SA 1KRUA 2QIAA 3EEVA 3OW5A 4E6TA 3TZXA 1KHRA 3Q1XA 1XHDA 3ECTA 4IHGA 5AFUV 5ADXV 4AA7A 2CUYA 3PMOA 1HM0A 4HZCA 3FOQA 2JFDA 2OI6A 3SBMA 4N6AA 1KRVA 2W0WA 3TV0A 3TISA 2RIJA 3BSYA 3HJJA 3FTTA 3IXCA 5E3QA 4KQLA 2GGOA 2IU8A 2V0KA 3OTMA 1MRLA 4R36A 3R5CA 3VBIA 2QKXA 2WLGA 3VBMA 3FSBA 3I3XA 3FSCA 1MR9A 3I3AA 1THJA 3VBNA 3MC4A 2JF2A 4AC3A 4EA7A 1V67A 2V0JA 1T3DA 2WLFA 2QJ3A 4AAWA 3EG4A 1HM9A 3RGIA 2IUAA 1G97A 4G3PA 3OTZA 3D98A 1YP3A 4KPXA 5E3PA 4HZDA 2IC7A 2AQ9A 3P47A 3FSXA 4EABA 1MLAA 2TDTA 3VBKA 4G87A 2OEFA 4RL1A 4EQYA 3BV8A 1J2ZA 4J09A 2V0HA 3NZ2A 3FS8A 3H0PA 3R3RA 2ICXA 3OU9A 4G3SA 3DK5A 3T57A 2IU9A 4KNRA 3FWWA 2QC3A 3DHOA 1SSQA 3D8VA 2JFKA 3IM8A 3TIOA 4N27A 2C2NA 5DG3A 1QQ0A 3QATA 3EH0A 1S80A 2FKOA 3R1WA 4IHFA 4EGGA 1OCXA 1KRRA 1NM2A 1HM8A 3K89A 3DJ4A 4IHHA 4E79A 2I5KA 3HHDA 3BFPA 4M99A 1KK6A 3GVDA 3SPTA 3SRTA 2ICYA 3VBJA 2G1HA 4QBUA 4M2BA 3TWDA 1KGTA 3BSWA 4MYOA 4M2AA 2OEGA 1QRLA 1KK4A 4E1KA 3G87A 4KNXA 3CJ8A 3TK8A 1KGQA 2V0IA 3KWDA 4KPZA 2H1YA 4J18A 3R97A 1YP4A 3F1XA 3R3IA 3VBPA 3IM9A 3GOSA 4E6UA 3BSSA 4ISXA 1FWYA 2V0LA 2NPOA 4FCEA 2P5ZX 2VD4A 3P1BA 3BRKX 3R0SA 2XATA 4N6BA 3MQGA 2QIVX 1SSTA 3FSYA 4M28A 4MZUA 4E75A 5DZ6A 2G2ZA 3ST8A 2P2OA 4EA8A 1QRGA 1QREA 1G95A 2G2OA 1TDTA 3OUPA 4MFGA 1MR7A 1YP2A 2WLEA 4N69A 3TZWA 1FXJA 4HCQA 4HURA 4DCLA 2OI5A 4R7PA 3VBLA 2GGQA 5U2KA 3KWCA 2WLDA 3HSQA 4HUSA 2VHEA 4G3QA 2Q4JA 3MQHA 5ADXU 5AFUU 2JF3A 1Z90A 3R5AA 4H7OA 3HJVA 1QRFA 4M9CA 4R37A 5DEPA 1HV9A 1QRMA 3PTWA 3R5DA 3C8VA 5E3RA 3BXYA 4M98A 3TZZA 5L6VA 1LXAA 4RR5A 5F42A 1V3WA 4EAAA 5DZ7A 3JQYA 3R8YA 3TQEA 3TZYA 2G2YA 1SSMA 3IGJA 3GUEA 2OI7A 3R2WA 1KQAA 3V4EA 3KWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6R A;  3R5B A;  4EA9 A;  1XAT A;  5DEM A;  2W0V A;  3VNP A;  1KK5 A;  2WLC A;  3EZO A;  3TDT A;  5L6S A;  1KRU A;  2QIA A;  3EEV A;  3OW5 A;  4E6T A;  3TZX A;  1KHR A;  3Q1X A;  1XHD A;  3ECT A;  4IHG A;  5AFU V;  5ADX V;  4AA7 A;  2CUY A;  3PMO A;  1HM0 A;  4HZC A;  3FOQ A;  2JFD A;  2OI6 A;  3SBM A;  4N6A A;  1KRV A;  2W0W A;  3TV0 A;  3TIS A;  2RIJ A;  3BSY A;  3HJJ A;  3FTT A;  3IXC A;  5E3Q A;  4KQL A;  2GGO A;  2IU8 A;  2V0K A;  3OTM A;  1MRL A;  4R36 A;  3R5C A;  3VBI A;  2QKX A;  2WLG A;  3VBM A;  3FSB A;  3I3X A;  3FSC A;  1MR9 A;  3I3A A;  1THJ A;  3VBN A;  3MC4 A;  2JF2 A;  4AC3 A;  4EA7 A;  1V67 A;  2V0J A;  1T3D A;  2WLF A;  2QJ3 A;  4AAW A;  3EG4 A;  1HM9 A;  3RGI A;  2IUA A;  1G97 A;  4G3P A;  3OTZ A;  3D98 A;  1YP3 A;  4KPX A;  5E3P A;  4HZD A;  2IC7 A;  2AQ9 A;  3P47 A;  3FSX A;  4EAB A;  1MLA A;  2TDT A;  3VBK A;  4G87 A;  2OEF A;  4RL1 A;  4EQY A;  3BV8 A;  1J2Z A;  4J09 A;  2V0H A;  3NZ2 A;  3FS8 A;  3H0P A;  3R3R A;  2ICX A;  3OU9 A;  4G3S A;  3DK5 A;  3T57 A;  2IU9 A;  4KNR A;  3FWW A;  2QC3 A;  3DHO A;  1SSQ A;  3D8V A;  2JFK A;  3IM8 A;  3TIO A;  4N27 A;  2C2N A;  5DG3 A;  1QQ0 A;  3QAT A;  3EH0 A;  1S80 A;  2FKO A;  3R1W A;  4IHF A;  4EGG A;  1OCX A;  1KRR A;  1NM2 A;  1HM8 A;  3K89 A;  3DJ4 A;  4IHH A;  4E79 A;  2I5K A;  3HHD A;  3BFP A;  4M99 A;  1KK6 A;  3GVD A;  3SPT A;  3SRT A;  2ICY A;  3VBJ A;  2G1H A;  4QBU A;  4M2B A;  3TWD A;  1KGT A;  3BSW A;  4MYO A;  4M2A A;  2OEG A;  1QRL A;  1KK4 A;  4E1K A;  3G87 A;  4KNX A;  3CJ8 A;  3TK8 A;  1KGQ A;  2V0I A;  3KWD A;  4KPZ A;  2H1Y A;  4J18 A;  3R97 A;  1YP4 A;  3F1X A;  3R3I A;  3VBP A;  3IM9 A;  3GOS A;  4E6U A;  3BSS A;  4ISX A;  1FWY A;  2V0L A;  2NPO A;  4FCE A;  2P5Z X;  2VD4 A;  3P1B A;  3BRK X;  3R0S A;  2XAT A;  4N6B A;  3MQG A;  2QIV X;  1SST A;  3FSY A;  4M28 A;  4MZU A;  4E75 A;  5DZ6 A;  2G2Z A;  3ST8 A;  2P2O A;  4EA8 A;  1QRG A;  1QRE A;  1G95 A;  2G2O A;  1TDT A;  3OUP A;  4MFG A;  1MR7 A;  1YP2 A;  2WLE A;  4N69 A;  3TZW A;  1FXJ A;  4HCQ A;  4HUR A;  4DCL A;  2OI5 A;  4R7P A;  3VBL A;  2GGQ A;  5U2K A;  3KWC A;  2WLD A;  3HSQ A;  4HUS A;  2VHE A;  4G3Q A;  2Q4J A;  3MQH A;  5ADX U;  5AFU U;  2JF3 A;  1Z90 A;  3R5A A;  4H7O A;  3HJV A;  1QRF A;  4M9C A;  4R37 A;  5DEP A;  1HV9 A;  1QRM A;  3PTW A;  3R5D A;  3C8V A;  5E3R A;  3BXY A;  4M98 A;  3TZZ A;  5L6V A;  1LXA A;  4RR5 A;  5F42 A;  1V3W A;  4EAA A;  5DZ7 A;  3JQY A;  3R8Y A;  3TQE A;  3TZY A;  2G2Y A;  1SSM A;  3IGJ A;  3GUE A;  2OI7 A;  3R2W A;  1KQA A;  3V4E A;  3KWE A; 
#chains in the Genus database with same CATH topology
 3MAA B;  1UL3 A;  2A6O A;  4EO8 A;  3MXH P;  2LU2 A;  2J8S A;  3TZX A;  2KG1 A;  5L9X A;  2R4F A;  4Q2M A;  1DTQ B;  4JOU A;  2W1B A;  5HL7 Q;  3FEZ A;  3FTT A;  1JLC A;  1REV B;  4CO3 A;  3T3F A;  5ETK A;  1JLE B;  5L8R C;  1ZET A;  4TU8 A;  3D54 A;  4ZVP B;  1TL4 A;  1R8C A;  3PZP A;  3BGL A;  4M5M A;  1WOS A;  5IZH A;  2Z2M A;  3IWX A;  2ICY A;  1KFS A;  2HS4 A;  4Y2K A;  2FYX A;  2HLU A;  1IR0 A;  4G6V B;  2DB1 A;  2DO0 A;  2CQB A;  3IM9 A;  2CQ2 A;  1LNQ A;  2HRT A;  2CPF A;  1NDC A;  2OJ3 A;  4WP3 A;  2AJ0 A;  2YWH A;  3TAM B;  1QSS A;  4UUW A;  2ZBQ A;  2H4Y B;  3VVT A;  4C8M A;  4O3O A;  2WRM A;  2VOO A;  2NSB A;  1TVR B;  2YKM B;  3ZTS A;  1X4B A;  3TZY A;  4EA9 A;  3POT B;  4RNF A;  1V6H A;  3QZ7 A;  1RTJ B;  4KFB A;  2GMH A;  4L73 A;  4IHG A;  5JVH Q;  2BAN B;  1HM0 A;  1FE0 A;  2CQ0 A;  1M1G A;  3PKM A;  1X5T A;  2QEX S;  5AE1 A;  3CDE A;  1KHW A;  3NRB A;  1HHQ A;  2G13 A;  3I56 S;  3EVO A;  4KKO A;  4DL5 A;  3OVS A;  4CLT A;  2UXB J;  2CQ4 A;  2QA4 S;  3HD1 A;  2VBX A;  3DRX A;  1CVJ A;  3I0R B;  2E1M C;  1T9Y A;  3IGV A;  1UTA A;  1VQY A;  4CO4 A;  1N6Q B;  1NHK L;  4DF8 A;  3KMS A;  1FDB A;  4USK A;  5L38 A;  5HJY A;  4DSF A;  2XS2 A;  4F4Z A;  1TL7 B;  2L41 A;  4CLZ A;  5I3U A;  4YQW A;  2CQC A;  3NMA A;  2L9N A;  2VD4 A;  1CJU B;  2BKN A;  4LR8 A;  2HGN A;  4N76 A;  1RAD B;  2GGP B;  1RBL A;  1XQI A;  1AB8 A;  4YR2 A;  2OI5 A;  3UDE A;  4IOC Q;  2CJ9 A;  5KFS A;  4CO2 A;  4GVB B;  2HVE A;  4DG1 A;  2N82 B;  4DV0 J;  2XEX A;  1AUD A;  1WG4 A;  2QE5 A;  3PYE A;  3TI0 A;  2DEJ A;  2J8A A;  1E6V B;  3MEE B;  5T7L B;  4C2M A;  1VC0 A;  3J7A 1;  5B0E A;  3FKB A;  1HBU A;  1H2U X;  4FKY A;  5KFC A;  2HHS A;  3DRR A;  1S79 A;  2RUS A;  4X4P A;  4OQJ A;  3HHN B;  4EZ6 A;  3OH1 A;  1HNZ J;  3FFI B;  3ZTR A;  2VG6 B;  2FJB B;  1L5U A;  1N36 J;  1CUL A;  3WX8 A;  4OX9 J;  2KVI A;  2G0J A;  4E1K A;  2V67 A;  1IBK J;  4ES3 A;  4PCQ A;  3V4I A;  1ITP A;  2O1P A;  1S1U A;  1U1R A;  2FIU A;  5AE2 A;  1K73 T;  2OPP A;  1H2T Z;  2FVP A;  3GR0 A;  1M0S A;  1S1X A;  4LRC A;  4RNN A;  5D4L A;  4YHH J;  3OSP A;  1U1P A;  2M70 A;  4HUR A;  4QU7 A;  2KYX A;  1N36 F;  4WCE Q;  1P27 B;  2FZG B;  2SXL A;  1K1Q A;  4OX9 F;  3PTW A;  4G1P A;  2W9B A;  4JI5 F;  2HPU A;  4V1A k;  2RDJ A;  1IBM J;  1IBK F;  4NYZ A;  2ZUA A;  3A12 A;  1RKI A;  1I94 J;  4MKV A;  4MFB B;  1DQA A;  1OIA A;  1D3W A;  3QIP A;  2YTC A;  1UZH A;  3N5F A;  4F4Y A;  2I5J A;  2KVQ E;  1JKH A;  2LKZ A;  2V2V A;  1P1T A;  1Z2L A;  4LFA J;  3BEG B;  1HW8 A;  3PVX A;  1SCJ B;  2H65 B;  2J0W A;  2I1R A;  2W4C A;  2NUH A;  4JI0 J;  5DET A;  1IBM F;  3IXQ A;  4F26 A;  2OEF A;  1I94 F;  2HG4 A;  3W8P A;  2XCA A;  1U8S A;  3SSS A;  3NOC A;  4ILR A;  3QLH A;  4X4Q A;  3VGS A;  2R7X A;  2IM3 A;  5F8G A;  4C8N A;  5DG8 A;  1UVJ A;  5GVQ A;  1OY6 A;  3V81 A;  4F04 B;  4M2A A;  3LP0 A;  3OFH A;  4RPF A;  4JI0 F;  1RWM B;  2KYZ A;  4JI4 J;  4ZJQ A;  2E1R A;  3PJX A;  3VAF A;  5C42 B;  5ETP A;  4NAS A;  1KWM A;  4NCG A;  4AQY J;  4ETX A;  2RF2 B;  3FCW A;  3GJS B;  3HKW A;  1JB0 C;  2VOD A;  2R8I A;  3AD8 C;  4DSK A;  3FSI A;  4O3R A;  4TY8 B;  3M6X A;  3KKF A;  1KSP A;  3MM7 A;  2CPI A;  4YFU A;  2JLE A;  5KFR A;  3CXC R;  4AQY F;  1X5P A;  1X7V A;  1HHS A;  3CCL S;  3CCS S;  3TUZ C;  3RW7 A;  2YKP A;  1ULR A;  5A2Q U;  5F8H A;  4ETZ A;  3KLG B;  1NSP A;  3FSC A;  1N5Q A;  3CJ0 A;  2MSS A;  2MGZ A;  4HHJ A;  1PC4 A;  2GQC A;  3L4B C;  3FUY A;  5U47 A;  1CS4 B;  3IM8 A;  1S10 A;  4A47 A;  2PI5 A;  3AD7 C;  3JB9 k;  3OXG A;  3AOC A;  2FD2 A;  3TK8 A;  4KGZ B;  4QYZ K;  2V94 A;  1HQU A;  1RLC L;  2VOP A;  4QJV A;  3M05 A;  2EFO A;  3TW0 A;  2BE2 B;  3MHY A;  3BYR A;  3JSR A;  1Q16 B;  2GAG C;  5D4N A;  4DCL A;  4O0N A;  4PZV A;  2WOM B;  1WUU A;  2D69 A;  1N5Y B;  5JUM A;  5DEP A;  2MKY A;  2CZ9 A;  5RUB A;  2IDL A;  2RE1 A;  3R9L A;  3RB3 A;  3TJ8 A;  3NCR A;  2Y1R I;  3UCZ P;  4F4A A;  2C2R A;  1KN6 A;  2JLG A;  2Z57 B;  5LXY A;  2JVO A;  2IU8 A;  4TYB A;  4ZIW A;  4NLV A;  3K8V A;  3BPS P;  3MOZ A;  4NL5 A;  2NRE A;  4LF2 A;  2BKO A;  4ICL B;  5HBM A;  5KT6 A;  1VK3 A;  1F3V A;  4EMD A;  3M6V A;  2LEP A;  3FCH A;  3P96 A;  3KLF A;  2OMO A;  2J0Q D;  3A3O B;  3IG1 A;  2HNY A;  3DM2 A;  3TVZ A;  3BKF A;  2PEB A;  4OYX A;  4DX8 H;  2ZH4 A;  4RUB A;  2K1R B;  3FEY B;  2AX1 A;  3QAE A;  1VK8 A;  4W92 B;  3KUG A;  4FS1 A;  2VG7 B;  2E5I A;  4JI6 F;  4CYU B;  1VRQ C;  4JP8 A;  4DL3 A;  1ZS6 A;  5KFY A;  2MQN A;  4R37 A;  4LF5 J;  3GQA A;  5CAA A;  4GO7 X;  2BX6 A;  2YBV A;  4ECT A;  5DDP C;  2VBW A;  3QT6 A;  4NLD A;  3GWC A;  1DRZ A;  1Y11 A;  2XMA A;  3CO9 A;  3CJ3 A;  1RTI A;  2HVD A;  2J0S D;  1RT5 B;  4I67 A;  3OTM A;  1H7W A;  1CJV A;  2MB0 B;  3G2X A;  4LF5 F;  2NZ4 A;  2W2P P;  2BJ8 A;  4OZJ A;  2NQP A;  2QL5 B;  4EAB A;  2MZR A;  3MM5 A;  3S1T A;  3QSY B;  4ERD A;  1HFE L;  1R6V A;  1QAJ A;  4ANE A;  5DG3 A;  1AT1 B;  2KKH A;  4FP9 A;  3O1L A;  4HR2 A;  2HVH A;  5E3A A;  2DHH A;  4K5R A;  3A8J A;  2RUG A;  3KYL A;  4JI1 F;  4KGV B;  4F3O A;  1WC4 A;  2NXN A;  4J7C A;  4J18 A;  3OQ2 A;  3WC0 A;  4QYR A;  3MM6 A;  3QFW A;  2QT7 A;  1PO6 A;  5KOX A;  3CJ5 A;  2AJ4 A;  3D2W A;  4ZVE A;  5B0A A;  1VGY A;  5KG4 A;  5AXN A;  1V3R A;  4KSE B;  1VBX A;  4NLS A;  2YNG A;  1Z90 A;  2GW8 A;  4MK9 A;  1IJF B;  1SJ3 P;  3C2P A;  3A3N B;  1FJ7 A;  3CJR A;  3R5B A;  2DNL A;  4UOH A;  2GIR A;  4DPO A;  1QE1 B;  4WFZ A;  4LMZ A;  1KTQ A;  4N6A A;  2BW7 A;  2O67 A;  3CJ2 A;  2PMH A;  3KK1 B;  3CCM S;  2DIV A;  1S1W A;  2F4V J;  2ZWO A;  3ADA C;  2KXN B;  3HHL A;  4RL1 A;  1JLG A;  2QFI A;  2OD4 A;  2DH8 A;  1KOO A;  3SFG A;  4Y34 A;  1B0V A;  2CG8 A;  3PV8 A;  4JI2 F;  3SPT A;  3WDO A;  2LMI A;  2ROG A;  4U8Y A;  1VBZ A;  4BDP A;  5F8N A;  3TVY A;  3OLB A;  1LFP A;  4ZCL A;  8RUC A;  4LF8 F;  2RS2 A;  2PEH A;  1RHM B;  4QIW D;  3RRG A;  2IBK A;  1FVS A;  1QRG A;  4DR2 J;  3OTE A;  2ZWP A;  2C3P A;  2GA7 A;  1MWY A;  1NK9 A;  4CM0 A;  3R2D J;  3OFF A;  3IS9 B;  2VA3 A;  1RA7 A;  1VRT B;  5SZT A;  1X4F A;  4P52 A;  4F2S A;  3GG0 A;  3BO3 A;  2OSQ A;  4UY8 5;  1XIQ A;  1FEE A;  5IV4 A;  1PBA A;  1XNR J;  2B9Y A;  4ZVF A;  2NYI A;  2XB2 D;  1B99 A;  4M8L A;  4X65 F;  1RAF B;  3ZZ0 A;  5HMX A;  2W8L A;  4OYA A;  4IFY B;  5GAE I;  2F5G A;  5J2N B;  3I55 S;  4USJ C;  2BM0 A;  2ZH5 A;  2F8H A;  3IBF B;  2F9J A;  3KLI A;  3T5L A;  1JJH A;  2KRR A;  4DPT A;  3CCW A;  3J7Z T;  2HHU A;  2KT3 A;  3QGH A;  8ATC B;  2BEF A;  3ULH A;  4E2F B;  3CUN A;  1QJH A;  3KK2 A;  3V6K A;  2EK1 A;  1C0U A;  2DGQ A;  2AYB A;  3A8E A;  3FVY A;  5KFU A;  2NZC A;  4LVN P;  4DUT A;  4M28 A;  2NXE A;  4ZPW R;  3K5N A;  1ICE B;  4C7Q A;  3TZZ A;  4K7Q A;  3TQE A;  4EAA A;  3TAP A;  2AYE A;  1TL3 B;  4N77 A;  3FDS A;  2BDP A;  2UUC J;  2HGM A;  1BGX T;  4E6T A;  4ED5 A;  1VDH A;  4QIG A;  1EP4 B;  4IRK A;  1EQ0 A;  4AL7 A;  3VQS A;  1G1X A;  2V0K A;  2GIF A;  2OEK A;  3PRB A;  3WQP A;  1RWK B;  1P1L A;  3T1A A;  4M5D B;  4IOB A;  1YJ9 S;  1RDR A;  4OZN A;  3AJD A;  3GIK A;  2OEM A;  3C46 A;  2C2O B;  2CAJ A;  3MPW A;  3I5B A;  1RTH B;  1X4D A;  3FS8 A;  1O6X A;  1RGV A;  2YWK A;  3AB4 B;  4CT9 A;  3H5X A;  2CPX A;  1BMQ B;  4QW9 A;  1LEO A;  1U47 A;  4OLP A;  2H4W B;  2N7C A;  1Q81 T;  1VBY A;  3KHL A;  1X4C A;  4FXW A;  4EO6 A;  1H98 A;  3PIO Q;  4QWB A;  5KOW A;  2VHG A;  2R7W A;  2B43 A;  4K4U A;  2OPS B;  4FCE A;  1IKY A;  2PC6 A;  4Q5V A;  2BE7 D;  5DZ6 A;  4A46 A;  4PKD B;  3T5K A;  2J9C A;  1RAC B;  3R1H A;  4X66 J;  3QJJ A;  4LF1 A;  3HSQ A;  3DYA A;  3GU0 A;  4K8R A;  1R89 A;  4DXL A;  1RT7 A;  5D4P A;  3OTO J;  1OYD A;  3I9Z A;  3J7Y U;  4FYD A;  2IRX A;  3SCK E;  1FWK A;  2X1G A;  2LXI A;  4RLE A;  1QAX A;  2F8E X;  4JV5 F;  4GKJ F;  4YME A;  2P6S A;  2QKX A;  4A8M P;  2YKN B;  3RJM B;  5HMY A;  1T3D A;  1U26 A;  3LWL A;  1YJR A;  2ZH7 A;  3OTO F;  2PT0 A;  1VJQ A;  2WVE A;  3UN5 A;  1Y3K A;  1BQN A;  2RB7 A;  1WC0 A;  4N5S A;  3MZI A;  1RT2 A;  4B3S J;  1AZS B;  4ED2 A;  2XZW A;  3MUT P;  1BQM A;  3TWD A;  4BCA A;  2LQ9 A;  2IM0 A;  3LGH A;  3KFW X;  4KH1 B;  1DLO A;  4Z37 A;  4YB5 A;  3LTO A;  1N0V C;  4Q2L A;  3R3I A;  5KFM A;  3BSO A;  1IQT A;  4ZLP A;  2Z58 B;  4LFC F;  2RKI A;  4RX6 A;  1S0N A;  2NXJ A;  4F67 A;  3M9O B;  3T6B A;  1VS3 A;  4M5G A;  1DTT A;  1WHV A;  4CLS A;  1BWV A;  1FXJ A;  1X4G A;  4WK3 A;  4UY8 T;  3NNH A;  1S9F A;  4OHV A;  3C16 B;  3H98 A;  4UOG A;  3NS5 A;  3LPE A;  4NLX A;  1X9W A;  4UZC A;  1R0C B;  3O5T B;  2G4B A;  4R36 A;  1FFS B;  2A1B A;  1JJ2 R;  3FBE A;  2ZBC A;  3PEJ A;  3IRX A;  1EAY C;  1XJW B;  1Q5V A;  4ID5 B;  2YNF A;  4WPA A;  2ZZM A;  4ZP8 A;  1D0E A;  1HKA A;  4KV8 B;  2VC1 A;  1T03 A;  3QBC A;  1ZAX A;  1U6F A;  4OHW A;  1HQE B;  1RWW B;  3GVD A;  1LQ9 A;  3VAK A;  1T0T V;  2MPU A;  2WVB A;  2WBR A;  4CI0 B;  3EZ5 A;  3KJN B;  2E5L F;  2YWF A;  3EYZ A;  3I82 A;  2V0I A;  2GO8 A;  1LW2 B;  1HBM B;  2Q6C A;  1JNZ B;  4DR7 J;  1R8B A;  2Y9H A;  2MLZ A;  3CE8 A;  1T11 A;  4Z7Y A;  2YWG A;  1T05 A;  3TRG A;  4I56 A;  3Q86 A;  2UUT A;  2WLE A;  1CC7 A;  3KK3 B;  2N3L A;  3OD2 A;  3KUE A;  1KS2 A;  3JQJ A;  4YEA A;  2KDO A;  3UO0 A;  4QWC A;  1HNW F;  3DI6 B;  1VRU B;  2OPR B;  2RD5 C;  3G6V A;  2BA9 A;  4B9L A;  3AOD A;  4KYZ A;  3C19 A;  4XO0 A;  4A8S A;  4Q45 A;  4YB6 A;  3EPI A;  3MD3 A;  4WE1 B;  4JYA F;  3PEH A;  2RH3 A;  4TYA A;  5K14 A;  5KFN A;  2GJF A;  1M8N A;  1S12 A;  1HMV B;  3CSK A;  3H2V E;  3LP1 B;  1RWX B;  3RGI A;  3DLE A;  1SIW B;  1S49 A;  4IRC A;  4QW8 A;  1F6T A;  3BR8 A;  3BB5 A;  2FLN A;  4CLY A;  4C8Y A;  4PWW A;  2JDJ A;  2HEK A;  3NBP A;  3R7N B;  4EGG A;  3K89 A;  1XNQ F;  1NKC A;  3CME S;  4ZMM A;  3GII A;  3BSW A;  5A8R A;  3ITH A;  1ZOT A;  5C2C A;  4ZHR B;  1VQO S;  3D1O A;  3BF4 A;  4X62 F;  1BE4 A;  4YP3 A;  2BUN A;  1VJW A;  3OL6 A;  3A8K A;  3M30 B;  3D9B A;  3OUY B;  3MMC B;  2FGO A;  3D0H E;  5LJ3 Y;  3IP0 A;  4NZ0 A;  5ETR A;  1JLA A;  3BO2 A;  1T9U A;  3DHX A;  2UU9 J;  1T9T A;  5ADX U;  1TMM A;  1SL0 A;  4F4X A;  4KPX A;  3ICL A;  1RHJ B;  1L3V A;  1UZD A;  4NLY A;  3FOQ A;  2GHP A;  1DTQ A;  1AA1 B;  1R27 B;  1REV A;  3MF5 A;  2CPZ A;  4MK8 A;  3GCW P;  3TO8 A;  2G0I A;  2U2F A;  3SDE B;  1JLE A;  1X31 C;  3D6F B;  5LSO A;  1NH7 A;  1YGY A;  1MNE A;  3BGF A;  1F5B A;  3AAW B;  4ECW A;  1FTC A;  3GQ8 A;  4Y3C A;  1VMB A;  2G1D A;  3MUV P;  4USU A;  3G4S S;  2E1A A;  5G0R A;  1MRO B;  1Q79 A;  3AOB A;  2KO1 A;  3P4U B;  2XM3 A;  3W63 A;  5GME A;  1U45 A;  5J1P A;  4RW7 B;  4I6W A;  4J9P A;  2IY5 B;  3TAQ A;  1F60 B;  3TAM A;  5A76 A;  1T9X A;  2DRB A;  2UVV A;  3Q22 A;  4PG6 A;  2CJK A;  2YKM A;  1MWQ A;  3NXZ A;  4CLL A;  2DR9 A;  4KJI A;  1WDD A;  1CPZ A;  3POT A;  1LFW A;  1RTJ A;  2B4O A;  4Y65 A;  2BV3 A;  4Y28 C;  2NPI A;  3OJS A;  3B6B A;  3OH3 A;  3PAC A;  2LU1 A;  3HUL A;  4DF4 A;  3JSM A;  3W62 A;  3KHG A;  3BBC A;  1D9D A;  2XHC A;  2HS0 A;  2XY6 A;  2YKQ A;  5F8J A;  1A0O B;  1HW9 A;  3ZTO A;  3MM9 B;  2VUG A;  4DR6 F;  1LWC B;  2J6U A;  2CNK B;  2FB0 A;  3TJA A;  3I0R A;  4M63 A;  4OI1 A;  1RUS A;  1YDL A;  2LP4 A;  2D3Z A;  1SKS A;  4OFZ A;  1YTY A;  5EDW A;  2DVI A;  1QDU B;  4U6P A;  3CVK A;  1Z1Z A;  2ADC A;  3QRR A;  2CPJ A;  1N5S A;  1TL7 A;  5I4M A;  1F2H A;  4ZPV R;  2V8G A;  5HMW A;  2GIQ A;  1XC9 A;  4DSJ A;  4B02 A;  3NEK A;  1CJU A;  2A2C A;  2GGP A;  2ZD1 B;  1SQE A;  4L74 A;  3N79 A;  2ATC B;  4U9R A;  5KFF A;  3B54 A;  2UV8 G;  4K4X A;  3OLA A;  4F0K A;  4GVB A;  1RE1 B;  4NPO A;  2CNL B;  4JI8 J;  1BLU A;  4ZVR B;  1J2V A;  1SSM A;  1S6P B;  4CNZ A;  1QVF R;  3LA0 A;  1XR6 A;  4Z2X A;  1JLB A;  2FC9 A;  2WSC C;  4KKO B;  2NCK L;  2RQM A;  4B3R J;  5HRO B;  2FY8 A;  3MEE A;  3BGO P;  2FJE B;  4CLU A;  4X64 J;  2ZBP A;  2MLX A;  2ZIT A;  1X9M A;  3K5P A;  3PFE A;  2FHM A;  2WLF A;  1PAE X;  5CYQ B;  3OTZ A;  1YP3 A;  4C3K A;  2I9S A;  4OZ0 A;  1AW0 A;  3LOU A;  4WBF A;  1FFG B;  5I3U B;  3GQ9 A;  3W9H A;  3H5Y A;  1H7X A;  4TXS A;  1ZBT A;  1S77 D;  2BJE A;  2IIH A;  1KRR A;  4X64 F;  1N52 B;  3VBJ A;  3MPD A;  1HL6 A;  4ECU A;  3PNI A;  2W2O P;  2B9W A;  1ACM B;  3QQC D;  5KT3 A;  1M5V C;  3SCJ E;  1RXO B;  1VQS A;  2JSX A;  2X1A A;  1WJ9 A;  1HWK A;  2XAT A;  2QIV X;  2F65 A;  4DPU A;  2P8I A;  4KT0 C;  3DNC A;  3E51 A;  4I0W A;  5HQM A;  4L3K A;  3W2V A;  3VR1 A;  5HVH A;  3BYP A;  3GPA A;  1SJR A;  3IR5 B;  5CA5 A;  1R8A A;  5BJR A;  2ZHB A;  2ROE A;  3U1N A;  4WJB A;  3PJW A;  3CUL A;  1HBN B;  3OW5 A;  4ED6 A;  1XHD A;  1AFJ A;  1S6Q B;  5CZX A;  3MCS A;  3GV8 B;  2Z0G A;  4QIV A;  4PPZ A;  1OQ6 A;  4I2Q A;  2LEA A;  2PO4 A;  3JTO A;  1S1T B;  3H40 A;  3I3X A;  3TX0 A;  3H2L A;  1THJ A;  5DDR C;  4QZV B;  3AA8 A;  2A3J A;  2VFU A;  3T9Z A;  4G3P A;  3AJ2 A;  3M8Q A;  3H8Y A;  1KC8 T;  5HLF B;  2F9D A;  3D28 A;  3V4I B;  5GAD U;  1DAX A;  2DHX A;  1H6K X;  4C98 A;  3BQ1 A;  3W9I A;  3D3B J;  2A2D A;  2JC1 A;  2FKO A;  3WHI A;  4GKK F;  5LXR A;  1S57 A;  3GJT B;  2DPJ A;  3QT5 A;  2XI2 A;  1FWL A;  4B9N A;  4OI0 A;  2Q1L A;  3FZ2 A;  4AYB D;  2LVW A;  3MPU B;  5CZV A;  1RU2 A;  2NLW A;  1Q5Y A;  3CGI A;  5DJB A;  1JLQ B;  2FJD B;  2EKY A;  3LAL A;  1YBT A;  2HHQ A;  5FJ4 A;  4F4W A;  1UMJ A;  4O3P A;  2I5J B;  4C8K A;  4LJM A;  5GMD A;  3GQ7 A;  5LSL A;  1K1S A;  1UVM A;  4DMZ A;  4PG4 A;  4DV4 J;  2Z2Z A;  1TUW A;  2BAC A;  2BAB A;  3NCQ A;  2V69 A;  5KFT A;  4KO0 B;  5DO2 A;  3M9N B;  2W0W A;  4I4B A;  3QID A;  1OJ4 A;  3CF5 Q;  3KLG A;  3CC2 S;  2P9C A;  1XTZ A;  1NPR A;  1RWP B;  2XUL A;  4HZD A;  3LP0 B;  1CS4 A;  3ZFV A;  1S97 A;  4DS4 A;  1QQ0 A;  4MK7 A;  4NCG B;  4MIW A;  3QWU A;  1K0V A;  2F40 A;  4RNH A;  4LRB A;  2A18 A;  1XEZ A;  3R97 A;  2RS8 A;  4JUZ A;  3PY8 A;  3HKZ D;  2JWN A;  4DR1 J;  4Q8F A;  1RAG B;  2ATL A;  3OR2 A;  2WB1 D;  4R0E A;  3M8R A;  3PX0 A;  4NMX A;  1L3T A;  1VIO A;  4PQU B;  3O2I A;  4DEZ A;  5KFK A;  1SI9 A;  2O5D A;  3VNP A;  4Q8E A;  2IAJ B;  3CCZ A;  2AJ1 A;  3FBC A;  1IKW A;  2B8P A;  2WSE C;  3BSC A;  3UNY A;  2JJ4 D;  3UDC A;  1K44 A;  3GFX A;  4ICL A;  1B7Y B;  1TZ0 A;  2WVF A;  1U1K A;  2GC8 A;  4WYL A;  4CM2 A;  4CQ1 A;  2YKA A;  2WW8 A;  1IBC B;  1FK9 B;  3QAT A;  4TY9 A;  5HK4 A;  2RRA A;  2Z8Q A;  1I51 B;  1HI1 A;  3T1H J;  2CQG A;  2DR5 A;  4O3S A;  2J9E A;  3G87 A;  5KFV A;  1LWE A;  2K1R A;  3AXK A;  3CDA A;  4CH0 S;  3E3X A;  2V0L A;  2FPH X;  2R2T A;  3KJQ B;  3EPG A;  1EIY B;  2VG7 A;  5IQ6 A;  2DNZ A;  4TQS A;  4O0I A;  1DQ8 A;  1LW0 B;  4UOC A;  2Q43 A;  5DM6 Q;  5D77 A;  2RML A;  2ZEJ A;  2V2Z A;  5IT9 U;  3V6J A;  4A8Q A;  4QOT A;  1RLD A;  1ROF A;  2HQF A;  1V5I B;  3ECT A;  5ETL A;  1KQS R;  1QTM A;  1NJW A;  3D68 A;  1RT5 A;  2DO4 A;  2H5E A;  2HBQ B;  3FQK A;  2K3K A;  3IG1 B;  2W01 A;  3N5B A;  3HFV A;  2MMY A;  4YB1 P;  4FYV B;  3TA1 A;  4AND A;  3FWW A;  3QWP A;  2B5J B;  1NH8 A;  1M5O C;  4PEO A;  4NI2 A;  1A7G E;  2M7S A;  5IXU A;  5K20 B;  5KT2 A;  4OZL A;  1TR0 A;  2OEG A;  4FVM A;  5C24 A;  4X2B A;  2VG5 A;  5IT4 A;  4CH7 A;  4N41 A;  2XS7 A;  3KNA A;  1SC3 B;  4U8V A;  4FXD A;  4XPC A;  1TDT A;  3CCV S;  4ELU A;  1CQN A;  2VDH A;  4JI3 F;  3Q0A A;  5D8H B;  2KI2 A;  3GFZ A;  2JF3 A;  3R5A A;  2MEW A;  1HV9 A;  1RTI B;  4C0O C;  4MYU A;  4CTA B;  3KHR A;  4K6R A;  4DX6 A;  4ZVT B;  1QE1 A;  1TAQ A;  4P2F A;  3MMB A;  2J0X A;  1YVF A;  4NCA A;  2OEJ A;  4B9V A;  3BSY A;  4UZB A;  4B9U A;  1UPM B;  4YR0 A;  2CQI A;  3ZZT A;  4NLW A;  4HH0 A;  2QJ3 A;  3EVW A;  1TK0 A;  5D0G A;  3M2R B;  2YQ3 A;  1ZM9 A;  1WOP A;  3R3R A;  3MM6 B;  4XIU A;  4DCO B;  4KY3 A;  2C1E B;  3A1Y G;  3LUY A;  4NWB A;  5A8K B;  3PW0 A;  5EN1 A;  4CRJ A;  4IR1 A;  5FII A;  1DFD A;  1YK9 A;  4RUC A;  5IT9 Y;  3GJQ B;  4OHX A;  1U49 A;  1XMQ F;  3D1Q A;  2JNJ A;  1EHW A;  2BOP A;  5D78 A;  3FJ2 A;  1V3Z A;  3IS9 A;  5KFI A;  1NJY A;  5L6V A;  1QSY A;  6FDR A;  1QSL A;  4HDG A;  3VGT A;  2Z30 B;  1S1W B;  4TN2 A;  2R8G A;  1F5C A;  2JX2 A;  2FQQ B;  4NLR A;  4AA7 A;  3HHL B;  2ZC3 A;  1JLG B;  3CD0 A;  2BKP A;  2VL1 A;  1FI4 A;  5F3T A;  2AMC B;  5J2N A;  2FJA B;  3C6U A;  4PWD A;  1BY9 A;  4B3T F;  3RYL A;  1H73 A;  1BD6 A;  1ZZF A;  1RHK B;  3UCG A;  4TNO A;  4I2P A;  3RRH A;  3ZZZ A;  1D8Z A;  3AJ1 A;  2XQC A;  2JFK A;  1O0P A;  3TYT A;  3KLH A;  3T5J A;  3IWN C;  3I9V 9;  1NM2 A;  4YUD A;  1B0P A;  3E2E A;  1IR1 A;  1VBK A;  1FA0 A;  4HDH A;  4I64 A;  3NGD A;  3JS9 A;  1KGQ A;  1WDT A;  1NB2 A;  3I6P A;  3M8Z A;  5LSR A;  4EWT A;  1M5P C;  2XZT B;  2XI3 A;  3VHQ A;  3G9C A;  1RZM A;  3GR1 A;  2GVZ B;  1Q82 T;  4ZK7 M;  2YX1 A;  2GGQ A;  3MI7 X;  2MQQ A;  1HNV A;  2C3M A;  3F73 A;  1NME B;  2OGU A;  2W24 A;  2BVZ A;  3BKU A;  4TLR A;  1TL3 A;  4DL0 C;  3JSY A;  4DR4 J;  3MMA B;  1NK8 A;  1U8W A;  2E5G A;  1D1U A;  1EP4 A;  3R3T A;  1CJK A;  3VZI A;  4MKY A;  1VI7 A;  5ETM A;  3Q83 A;  4H4K A;  3DOM B;  3IAS 9;  4J37 A;  4O44 A;  1U1N A;  4M5D A;  2Q79 A;  4RW4 B;  1OWX A;  1QUP A;  4DFK A;  1UA0 A;  1GXL A;  2Z4P A;  2ZC4 A;  2GX8 A;  3GLJ A;  3TAN A;  1U1Q A;  3EZU A;  5B0G A;  1FRH A;  2V50 A;  1QAI A;  4NX9 A;  3OL9 A;  4CH1 A;  2QG9 B;  1YSJ A;  4QR1 A;  4OZ3 A;  2C22 A;  2KJV A;  3BBF A;  4LF9 J;  4F0M A;  2OPS A;  4CO1 A;  4LF6 J;  4IG0 B;  2ZKT A;  4KQZ A;  1SST A;  1Z2Z A;  4I7F A;  1MW7 A;  4B3O B;  2RHQ B;  3LGN A;  1U0H B;  2V2K A;  3GJR B;  1N34 J;  1UJ5 A;  4UOF A;  1TK8 A;  4ZCK A;  2HIY A;  1EKS A;  3HHL C;  3AB2 B;  4PXD A;  3V4E A;  4NA1 A;  3M6U A;  1FRM A;  1KK5 A;  4LF6 F;  2OFH X;  1KRU A;  3DHW C;  4CLK A;  4NLG A;  3Q8P B;  3ET6 A;  3CD6 S;  5EWG A;  4HT7 A;  4HT5 A;  4RUH A;  2UVR A;  2ZE2 B;  2YKN A;  2VDI A;  2WVC A;  1ZM2 A;  5E33 A;  1V67 A;  2IUA A;  4MKA A;  3F44 A;  4B17 A;  1QD1 A;  3GQC A;  2OI2 A;  3PW4 A;  1HR0 F;  4UQT A;  3IC1 A;  2EVZ A;  1IBL J;  4B08 A;  4ZP9 A;  5AJ3 J;  4UT4 A;  2LQ8 A;  4URS A;  2MKS A;  4KR0 B;  1S80 A;  1OCX A;  5F3Z A;  2HHH F;  3UD4 P;  2OLW A;  3OPK A;  5J1N A;  3UPF A;  4O4R A;  4XPE A;  1FWP A;  1FXR A;  3CDW A;  2NPO A;  2CPD A;  1RT7 B;  4KHP J;  3PO5 A;  2QL7 B;  1YBU A;  4IFV A;  2KU7 A;  2ASL A;  2K8G A;  2O66 A;  3AY0 A;  1RCX B;  1U1O A;  3R7B B;  3OTD A;  3NY0 A;  3FMB A;  1KHV A;  2AT1 B;  3L9Z A;  1I5O B;  2GO9 A;  1FDD A;  4GMK A;  1C2P A;  2DXD A;  4OZ2 A;  1PJ6 A;  3R6G B;  2CQH A;  2QLJ B;  2VBZ A;  1UW4 A;  3PJ9 A;  5JJB A;  4ZLJ A;  4KHP F;  4U7U D;  4UQG A;  5AFU V;  2PFF B;  1NB7 A;  3BM7 A;  1V9O A;  3M32 B;  3P3D A;  1QY7 A;  1RT2 B;  4ZPT R;  3EVM A;  4OYI A;  1Q78 A;  1BQM B;  1TFW A;  4F25 A;  1EZZ B;  2MYF A;  2VJU A;  2HQ3 A;  4ID5 A;  1DLO B;  3Q8V A;  4KV8 A;  4PRF A;  2VFS A;  3EGN A;  3TA2 A;  5HI7 A;  2RKI B;  2B3T B;  2OUG A;  3UE2 A;  1YJV A;  4QPX A;  1MSW D;  1DTT B;  2R9L A;  1VQK S;  3VAG A;  4ECQ A;  2VPW B;  1HBM A;  4C8Z A;  1IWA A;  2CFX A;  3FSY A;  2BJ3 A;  2ZOF A;  3UCU P;  4CIO A;  4J9U E;  3KK3 A;  2VKR A;  4IO9 Q;  4R7P A;  3KJF B;  1FJE B;  1FT8 A;  2YH0 A;  1VRU A;  3C8V A;  2W4D A;  4IR9 A;  3CDU A;  1SKR A;  1WI6 A;  5K8M A;  3G82 B;  4RW8 B;  3PRD A;  4WKY A;  3EZO A;  2DPI A;  1CQM A;  4WE1 A;  3G96 A;  4OYZ A;  1SV5 B;  1T03 B;  4ZVO B;  1CG2 A;  1HMV A;  3TUJ C;  4DV2 F;  5KT5 A;  5T14 A;  3LGM A;  4DV5 F;  2HFN A;  4FF2 A;  1MU2 B;  3UVJ B;  3W61 A;  1ZM4 A;  4PYD A;  3THP A;  3D8V A;  2J6T A;  4IH6 A;  4JV1 A;  2DR8 A;  3VAL A;  3W9J A;  3VCD A;  4OYW A;  1NJX A;  3ILJ A;  1ZH5 A;  2B0G A;  4L72 B;  3M30 A;  3OUY A;  3MMC A;  2AHO B;  4DR5 F;  2AEJ A;  1RTD A;  5GAE U;  4CDI A;  2CDQ A;  3DCA A;  1UEU A;  3ETM A;  1LOU A;  5C5J A;  5LT5 A;  5E3R A;  1UJ6 A;  2R8J A;  1X5S A;  4QWD A;  1NDP A;  2JOQ A;  2ZHO A;  1GAO A;  2CNO B;  4R5P A;  3PX6 A;  3RR7 A;  3BQ0 A;  1NPK A;  3OL8 A;  4OYB A;  2LDY A;  2HHT A;  5THW A;  3P6Y C;  1HNX F;  4A4J A;  2JRS A;  5L1J A;  3NP5 A;  3NBP B;  1IM4 A;  3SDE A;  1TUV A;  1KEK A;  1MML A;  3VBN A;  1LXJ A;  3DC2 A;  4YS2 A;  1NK4 A;  1NEE A;  1TU0 B;  3HDS A;  4ATN A;  2H5I B;  4J09 A;  1IXK A;  4EGL A;  1L3K A;  3IGN A;  1MRO A;  4ZPC A;  1T3N A;  1R0A B;  5J1E B;  3HHD A;  2XC9 A;  1N88 A;  2H54 B;  1T02 A;  1JLA B;  1RT6 B;  3KWD A;  4RW7 A;  2J7W A;  3JAM Y;  1Q4R A;  1YJW S;  2RSQ A;  2DTJ A;  3GMG A;  4O4G A;  2HK2 A;  4AFF A;  4MZU A;  4PAB A;  2DR6 A;  2VZ9 A;  2F8M A;  3H25 A;  4GC6 A;  2APO A;  3WX4 A;  5GAG I;  2R7S A;  3HX9 A;  2YNI A;  4WFN Q;  4H7O A;  3DMJ B;  5DLF A;  1N33 J;  2VFT A;  1LXA A;  3BDE A;  2Y0S D;  3SMZ A;  1WKK A;  2W7O A;  2CUY A;  3QGP A;  1JJC B;  4X4U A;  1NJZ A;  2JZ5 A;  2E66 A;  4NCB A;  5G0R B;  4RBU A;  5C7P A;  3R5C A;  3MM9 A;  1S7H A;  1LWC A;  4ZJO A;  3D6T B;  1N33 F;  2E9Z A;  4LBP A;  4O23 A;  1RWV B;  3DLB A;  2K3I A;  2HBY B;  1UFW A;  3UD5 A;  3OFE A;  4DR3 F;  2D7S A;  5H9E K;  1URR A;  1HAR A;  3GIM A;  2V8V A;  3PKY A;  3T9N A;  4KNX A;  1YZ7 A;  4E6U A;  4MIB A;  4I6Y A;  3K8W A;  4K4Y A;  3N6N A;  3DDK A;  3NLC A;  2ZD1 A;  5J2P B;  1QTN B;  5F8L A;  3VQT A;  2ZOM A;  2UXC F;  2ZH8 A;  3TAR A;  3HCX A;  4RUA A;  1Z4U A;  2AIR B;  5BYR A;  4P9S A;  2M5Y A;  1FJG F;  3JSM B;  3IBC B;  1S6P A;  2VQF F;  2Q66 A;  1RWO B;  4BBY A;  3HVW A;  5DQG A;  2MHN A;  2QA4 G;  5HRO A;  4IOA Q;  1WC5 A;  4NLU A;  2GVD B;  2BXJ A;  5AE3 A;  1KRV A;  5L1K A;  1YG0 A;  5ETN A;  3U02 A;  1Y00 A;  3Q23 A;  1PJ7 A;  2AYM A;  1UWA A;  5CYQ A;  3JYT A;  1ZAW A;  1UP1 A;  2JC0 A;  3BS9 A;  3PM9 A;  3HI9 A;  3PG9 A;  3KHH A;  1S0M A;  3DGP B;  1RAH B;  1GT8 A;  4Y2I A;  4NLO A;  2OML A;  1S9G A;  1FNX H;  1ZAV A;  2RRN A;  2AQ4 A;  2B8Q A;  1KK4 A;  2ASD A;  3SCI E;  2QIF A;  1YJN S;  3EX7 B;  2R8H A;  2CIM A;  4OI2 A;  2H5J B;  5E5N A;  3UR3 C;  4AUK A;  2K06 A;  1HI0 P;  3NWG A;  2AF6 A;  3B4D A;  1S76 D;  4Z7C A;  1JLB B;  4KTQ A;  1R43 A;  5E0O A;  5C25 B;  1X0F A;  2BBE A;  5HAN A;  1WC6 A;  4M9C A;  4CCH A;  2R42 A;  4LR9 A;  4FDF A;  2EFN A;  3W5Y A;  4ELT A;  2KZZ A;  3NGR A;  3EDR B;  4G3I A;  2RDI A;  2HNZ B;  2QSF A;  1HPZ B;  1HBN A;  5KFW A;  2QIA A;  5CYM A;  1S6Q A;  2GZO A;  1NO8 A;  2XMV A;  2U1A A;  1YJ7 A;  2JFD A;  2KRB A;  4DSL A;  1FKP B;  4UW2 A;  1D9A A;  2RQK A;  7FDR A;  3BO4 A;  3RAM A;  3ZTP A;  1S1T A;  2D9O A;  4FXV A;  4HKQ A;  1YHQ S;  1NPP A;  3T5H A;  2FHJ A;  3ZZP A;  2MZT A;  4JI5 J;  5HLF A;  3A4T A;  2OHD A;  1WOR A;  3HO1 A;  4P72 A;  4LRF A;  4P10 A;  2DH7 A;  4L6V 3;  3ILO A;  4Q7A A;  4K4T A;  4P2S A;  5HO4 A;  1W7W A;  1UWB B;  2GAH C;  5GAH I;  2GV1 A;  3W2V B;  3EM1 A;  3VTI A;  3ENQ A;  1R6Y A;  3AHP A;  3F56 A;  2D74 B;  3BSA A;  5MAO A;  2DKO B;  3RB6 A;  1JLQ A;  3L7U A;  4MTP A;  5FD1 A;  3PO4 A;  1Q8I A;  4OJH A;  4DDF A;  2WB4 A;  4HHH A;  1KR4 A;  1QRM A;  5KT4 A;  4KHR A;  3CCE S;  4I2Q B;  1I3O B;  2X3D A;  3US5 A;  4NYP A;  4ZVH A;  2OI7 A;  1KQA A;  4ZPB A;  1MWZ A;  5B08 A;  2QMX A;  4FZV A;  2HMI A;  1FD2 A;  1EQM A;  1VQN S;  1WC3 A;  1HHT P;  4KO0 A;  1VQ9 S;  3HZE A;  5DRK A;  2V9W A;  3M8Q B;  2KJW A;  3LAM A;  5A0Y B;  3PR5 B;  2V9K A;  1M5K C;  3TV0 A;  2IBO A;  3AH6 A;  4KBI A;  1Y5I B;  3UN3 A;  3MCM A;  2FY1 A;  2B4P A;  4QU6 A;  2JLF A;  3TWZ A;  4DQS A;  3ISZ A;  2ASY A;  1MLA A;  1Q7L B;  5H9F J;  2R3V A;  4E8U A;  4LF7 F;  2C2N A;  1FO1 A;  1G3O A;  4JI7 J;  2R8K A;  2DGS A;  1HWU A;  3J80 U;  2CWK A;  4AXJ A;  4M94 A;  2ZH1 A;  1NK6 A;  3MFI A;  3IR6 B;  3MQG A;  3K7R A;  3GCX P;  4X4R A;  1T3O A;  1XER A;  3BKT A;  3DLK A;  4MFG A;  4JI7 F;  4PQU A;  4N69 A;  1FKO B;  5KFQ A;  2UP1 A;  1WF2 A;  2VHE A;  2B56 A;  3G8T A;  3CD5 A;  3NOG A;  4CO5 A;  3MEC A;  3CNQ P;  2P5V A;  1FHT A;  1CEZ A;  2IAJ A;  1IKX B;  4H4M B;  2Y8Y A;  1S9E A;  2RIL A;  3SCL E;  5F8I A;  1RB0 A;  3IR7 B;  1TAU A;  5CCM A;  2PDA A;  2OTJ S;  3GV5 B;  3VBI A;  4M5L A;  3LH2 S;  3HP6 A;  1FRJ A;  4ZIV A;  3SZ2 A;  4RWX A;  3CWJ A;  3RB0 A;  3DLG B;  1NSQ A;  3C6T B;  2YX7 A;  4RJV A;  2D1C A;  3AQP A;  1CJT B;  4NXN J;  5KT7 A;  4ZVG A;  1X0P A;  4EU0 A;  1S6O A;  4A8F A;  1FK9 A;  2UVW A;  1OSC A;  2CZ4 A;  2IM1 A;  4IHH A;  2WZ1 A;  3OR2 B;  1YIJ S;  2QLX A;  2XLI A;  1NBE B;  4AXI A;  2V4R A;  4F4K A;  1BHN A;  1Q7Y T;  3LQV A;  3M2V B;  4J9Q A;  4NXN F;  2J76 E;  1VIX A;  1LW0 A;  2HVI A;  2FJV A;  4FYX B;  1PC5 A;  4M5I A;  1ARO P;  3FGV A;  4WFA Q;  4Y2C A;  3MUM P;  4IYQ A;  3G86 A;  1GK8 A;  1IKW B;  3D0G E;  4ENO A;  1DUR A;  3AQO A;  5IQQ A;  3GE9 A;  2BZ2 A;  3R6L B;  4CP5 A;  2UUA J;  3KUH A;  1YWX A;  2MJU A;  2MQL A;  4QQB A;  3MED A;  4DCP B;  1YBA A;  3UW1 A;  2MZ1 A;  1YJT A;  3W8G A;  3TIS A;  4JI6 J;  2W4P A;  4NYO A;  5CXT A;  4C48 A;  4AAW A;  1TUG B;  4PR6 A;  3J7Z 5;  3GP9 A;  2DIU A;  2EBE A;  5B0F A;  1LWE B;  1VLO A;  3H0P A;  2UUA F;  4FF3 A;  4G3S A;  3DK5 A;  2FVR A;  2QC3 A;  5F0U A;  2B5J A;  1LWF B;  1M5S A;  4DUY F;  4B3M J;  1KK6 A;  2HAI A;  1Y5N B;  4J9V A;  4F02 A;  2R2S A;  1QRL A;  2ZJQ Q;  1F0X A;  2IFX A;  3ELH A;  5A2Q Y;  3F0N A;  1JMT A;  3CDB A;  3DRY A;  3R2C J;  1VYA A;  3CJK B;  2N4D A;  2I8E A;  2E9R X;  2B7B B;  4QIE A;  3T41 A;  4A8X A;  2ZUG A;  2CJX B;  4B3M F;  2Q4J A;  1KFD A;  2GMJ A;  1Q53 A;  2V6A A;  2XNQ A;  1P8G A;  4JI1 J;  4CTA A;  3RRK A;  5IOL A;  3KNG A;  2KXF A;  4BC9 A;  2IYI A;  2EBG A;  1JK9 B;  3G8S A;  1RA6 A;  3K59 A;  2CQP A;  4DN0 A;  4EYI B;  2I38 A;  5M2U A;  3IN5 A;  4LIR A;  3MD1 A;  4LF4 F;  5EWF A;  2EFV A;  4FNI A;  4DS5 A;  3N9U C;  4J5O A;  1MRL A;  4LRD A;  3I4H X;  4NI2 B;  2DT9 A;  1HM9 A;  4ZVS B;  3M2R A;  1IUJ A;  3PXG a;  1DJ0 A;  5C24 B;  3CO0 P;  5L9N A;  2VG5 B;  4DV1 F;  1WC1 A;  3CC4 S;  3C66 A;  5A8K A;  2V5H G;  1DZ5 A;  2OSR A;  1DAR A;  5ETS A;  5D3G A;  1M1K T;  4ES1 A;  3VV2 B;  3TR5 A;  4N7T A;  3E01 B;  1N5V A;  1WSV A;  1TP7 A;  3BN4 A;  2QV6 A;  1C4A A;  2ILY A;  3H90 A;  4DPW A;  4PXE A;  4FN5 A;  1RHR B;  4ZP6 A;  2QLF B;  4YY3 J;  5U2K A;  2M4M A;  3MMB B;  4JI2 J;  3D4J A;  4D3G A;  3DOK B;  4RO0 A;  1WEL A;  1WSR A;  3LAK A;  3HVT A;  1V3W A;  3R8Y A;  1GXU A;  4AD6 A;  2XSJ B;  3WIV A;  2V8D A;  4LF8 J;  4ITS A;  2HYI B;  3M8S A;  3DDN A;  5E7O B;  2FZC B;  6AT1 B;  3L3C A;  3FZB A;  3PYD A;  1NK5 A;  1UEK A;  1U2C A;  4YY3 F;  2UXD F;  1R8H A;  4LRA A;  4J9R A;  2JF2 A;  2LEC A;  1TKZ A;  2HBZ B;  7FD1 A;  1JXL A;  2RU9 A;  1IR2 A;  2BM1 A;  4MYT A;  3BV8 A;  3CB4 A;  1J5E F;  1N0U A;  2MKK A;  4URQ U;  4XAK A;  2N4C A;  1QUV A;  3GFH A;  2AP6 A;  3KLV A;  4X65 J;  2WBM A;  2HHV A;  4MYO A;  2XY5 A;  1XMB A;  3G6X A;  4RNO A;  3RB4 A;  3CJ8 A;  3K17 A;  4J90 A;  1RT1 A;  3EMT A;  3ZNU A;  3TEG A;  2W7A A;  2L48 A;  4LQ3 A;  4LSZ B;  2XSF A;  3TUI C;  4OZ5 A;  6FD1 A;  3GTY X;  2M9K A;  3N6L A;  3R27 A;  2GVZ A;  4DZD A;  3PW7 A;  2KZM A;  2ALZ A;  2ZOG A;  1U0S A;  4OX6 A;  1HWJ A;  1XMO J;  5K8O A;  1WG1 A;  3C6U B;  4PWD B;  3MMA A;  2PA8 D;  1KQG B;  1FRL A;  2XWX A;  4F0H A;  3W2W A;  4I2P B;  3DOM A;  4RZR A;  4W90 B;  3HJJ A;  3IXC A;  2CJB A;  4LBI A;  3KLH B;  2IYG A;  3LWM A;  4RW4 A;  2ZDP A;  5FLX U;  1R8P A;  1VC6 A;  3MC4 A;  2KHC A;  4X4O A;  2FZK B;  1XMO F;  3MWB A;  2XYH B;  2QYC A;  4FBT A;  3HM9 A;  2IRY A;  2IVF B;  3M8P B;  3CJT A;  1SH2 A;  1Y9O A;  2BQR A;  4HH1 A;  4IG0 A;  1HNV B;  2D3O R;  3D7S B;  2ZH3 A;  2DHA A;  1S0O A;  4B3O A;  1WOO A;  1MN7 A;  1U0H A;  4RWW A;  1GMV A;  3DRS B;  3SV3 A;  2C42 A;  2R7T A;  3PW2 A;  2MJN A;  1CJK B;  4PAA A;  2VU5 A;  2HUR A;  3D1H A;  2DNH A;  4DPX A;  3QT8 A;  4WP9 A;  1JXE A;  4CWB A;  4O44 B;  4U7U K;  2ZJP Q;  3OVA A;  3DLH A;  3V4M A;  3Q2S C;  4XK8 C;  4LFB F;  1H72 C;  4CNY A;  3SBM A;  4HAC B;  2YNH A;  4RW9 B;  2A6M A;  4OV1 A;  1WI8 A;  2ZE2 A;  3C14 A;  2CNN B;  1SH3 A;  2HLT A;  1I1G A;  1W2B R;  1JLF B;  2GS8 A;  3NL0 A;  3VVU A;  2DGV A;  1NRK A;  2C3Y A;  1SC1 B;  1NK7 A;  1OY9 A;  2AX0 A;  1UAW A;  3PYF A;  5I3P A;  3RTV A;  1IWG A;  2NPF A;  4JV5 J;  2CVE A;  4I7F B;  4ER8 A;  2K7K A;  3A8I A;  4GKJ J;  1KGT A;  5ETV A;  2VPX B;  1BUX A;  5GMK a;  4M5J A;  2BW2 A;  1QAY A;  5IV3 A;  3CCT A;  3VBP A;  4N8O A;  2XBP A;  3KMQ A;  1NND A;  1NJI T;  3W7B A;  1WEY A;  5KFO A;  5K5M A;  4EA8 A;  3LO3 A;  2GJ2 A;  4DUZ F;  4E0D A;  3K58 A;  2WSF C;  3MPV A;  3FMW A;  1HBO B;  4KC5 A;  3ET6 B;  2QFJ A;  1T9V A;  5FLX Y;  2G9O A;  2CPH A;  4K5S A;  5DEM A;  2HS3 A;  2CPY A;  1NDK A;  5T41 A;  2CYY A;  2UZA A;  4LFC J;  3CED A;  1SJ1 A;  5B0B A;  1RK8 A;  3M32 A;  5I3Q A;  3D5M A;  3CJS A;  4RW6 A;  4UTG A;  2CRL A;  2B4U A;  2D3O 1;  1SQG A;  3NKY A;  1J27 A;  3OXL A;  1SH0 A;  4H4O A;  2GFF A;  3K5L A;  4NXM F;  4J9K A;  3HSZ A;  2K2P A;  2VD3 A;  4F8R A;  4TQR A;  2CAD A;  5E3C A;  1P9Q C;  2HND B;  4NEY A;  5AXM A;  4IFV B;  5B0C A;  3CCU S;  4FF1 A;  2IJN A;  3EE3 A;  4ED8 A;  3D67 A;  2IA0 A;  4EFA C;  2V4J A;  4YDD B;  1C1C B;  1PIE A;  1YJU A;  5DM7 Q;  4H4K C;  2L08 A;  2DHG A;  1N48 A;  3JTN A;  4PG5 A;  3JQM A;  3OR1 B;  1CLF A;  2PA3 A;  1IKV B;  3H2U B;  1SC6 A;  4LBH A;  2RT3 A;  3NGT A;  5A6W A;  1WTB A;  5IFM A;  2E5L J;  1S1V B;  4IQX A;  3G82 A;  4EI2 A;  4RW8 A;  3HHE A;  4K4W A;  4ZJL A;  4DCJ B;  3S7R A;  4QYZ J;  1U02 A;  2LXU A;  1U6Z A;  1SV5 A;  4C3L A;  3PX4 A;  1WHY A;  3SQO P;  3OHA A;  2GGO A;  2DY1 A;  1TV6 A;  3DU5 A;  4OHY A;  1HNW J;  4WU2 A;  2J6S A;  1MU2 A;  2QTW A;  2IC7 A;  1LKZ A;  5EX0 A;  3W1Y C;  3UVJ A;  4MT1 A;  1K47 A;  2PMW A;  1SSQ A;  1YX2 A;  2DNN A;  1RJJ A;  4F3Q A;  2CQ3 A;  1G6B A;  4U95 A;  1BQX A;  4JYA J;  1Q86 T;  2RQ4 A;  2HBR B;  9ATC B;  4WFY A;  2I0X A;  4AL6 A;  4WKR A;  2DNQ A;  5KFH A;  3OFG A;  3UNG C;  4EZ9 A;  2HWH A;  2E5H A;  2HQC A;  4LQ9 A;  3DN9 A;  2D41 A;  1FFW B;  4WXW A;  2AGP A;  4DU8 A;  3MEG A;  1XNQ J;  3O6Q A;  2Y8W A;  4P7V A;  3Q8R B;  2Y1I A;  1CC8 A;  3R1L A;  2UXB F;  5MLC V;  4X62 J;  2OPQ A;  4G1Q B;  4IH5 A;  3GZ7 A;  3BGR B;  5EWE A;  4OZ1 A;  4ZLL A;  2Q3P A;  5FDL B;  2WTF A;  1KQK A;  2KFZ A;  4DLG A;  3M4X A;  5E3Q A;  2HVZ A;  4LT6 A;  3AA9 A;  5DGA A;  2YKO A;  1KLM B;  1S48 A;  5BXI A;  2X7I A;  3NZ2 A;  2AD9 A;  1RYS A;  3BDP A;  5L39 A;  3EXY A;  3M2U B;  2HFZ A;  3GON A;  1R0A A;  5J1E A;  3CCR S;  5ITH A;  3E8O A;  2G1H A;  1RTD B;  4DV0 F;  3M7V A;  3OXF A;  5KFX A;  1RT6 A;  3VAM A;  4ZKA A;  2EPI A;  2OO4 A;  2FJW A;  1AFI A;  2YPZ A;  2CJA A;  2VPZ B;  2EK6 A;  2MKC A;  5B09 A;  2JEJ A;  3NG8 A;  4Y2M A;  1PIL A;  5ETO A;  4DL6 A;  2H9Z A;  1V3S A;  3V5R A;  4R5P B;  2GCF A;  3I0S B;  1Y7P A;  4OX8 A;  3VBL A;  1SBR A;  3QAU A;  2IDE A;  4DQI A;  3DMJ A;  2DNY A;  2WW4 A;  3RW6 A;  4IUF A;  2M88 A;  5HQL A;  5KFP A;  4DV6 J;  4E98 A;  1HNZ F;  1DQ9 A;  4ZP7 A;  5CHC B;  5DGB A;  5HSP A;  2HKE A;  2EXU A;  3PW5 A;  1Q8L A;  4ECZ A;  2G0C A;  2LFV A;  4AT1 B;  1CBK A;  2VPY B;  3K5M A;  3VAI A;  4EA7 A;  1SB6 A;  4LSL B;  3CCJ S;  2JL9 A;  4DV6 F;  4YHH F;  2YQ1 A;  5ETQ A;  5CQG A;  2OP5 A;  4DI6 A;  3W65 A;  5F41 A;  3FC9 A;  1NK0 A;  3V6H A;  1XK8 A;  4O4G B;  3EDQ B;  3QNW B;  4QBU A;  5KG0 A;  5KFA A;  3QZ8 A;  4OYO A;  2W25 A;  2F7V A;  2MST A;  4OX7 A;  1IVZ A;  4DR6 J;  2YNI B;  2YH1 A;  3HFK A;  1W26 A;  3R0S A;  3UFC X;  5J2P A;  4LUB A;  3ZXW A;  2EFQ A;  4IDK B;  2VFV A;  5I42 A;  4LFA F;  2VIC A;  4WP8 A;  2DD8 S;  2C2Z B;  3HJV A;  1MG7 A;  3MMJ A;  2DXF A;  2DNP A;  3ZZU A;  2B6A B;  3AXM A;  2PE8 A;  2F3J A;  2HZV A;  3LF0 A;  4F7V A;  3M1V A;  1SUQ B;  2OAU A;  5KAK A;  4D3H A;  3RG6 A;  3GSD A;  3ZZR A;  2GVD A;  2MQO A;  4RU2 A;  4M1K A;  3OSN A;  2EC0 A;  3OVB A;  1AXQ A;  1S7I A;  1TK5 A;  1KP6 A;  2IC3 A;  2WHO A;  3CIZ A;  5K8P A;  2QA2 A;  4JI4 F;  2P2C B;  2YX4 A;  3RAQ A;  3OU9 A;  3DGP A;  1E6Y B;  2OEL A;  3HHL D;  3PYG A;  2DNR A;  3R1W A;  1H0H B;  3DRP A;  4P75 A;  2MY7 A;  2BYC A;  1KVI A;  3FRY A;  2MY8 A;  3MUR P;  3GIL A;  2V34 A;  1FDA A;  3VZH A;  4N6B A;  4WZM A;  2J7K A;  1FES A;  4I68 A;  5IC6 B;  3HVR A;  3VAH A;  2OTL S;  1XR7 A;  2C2D A;  4OJ3 A;  5C25 A;  2KFN A;  5AFU U;  2HNZ A;  1HPZ A;  3QSI A;  2PD1 A;  3SIP B;  3JYT B;  3EXC X;  4M5N A;  4NRU A;  2B51 A;  1FKP A;  3H20 A;  2A10 A;  2PFD A;  2VF3 A;  3CT9 A;  4USW A;  4J9L A;  3WZ0 A;  2IA6 A;  2HGL A;  2XMK A;  1SJF A;  1JJ4 A;  4BS2 A;  1S9G B;  3KDO A;  2YXL A;  3KJV A;  1GMW A;  2LXF A;  1AYE A;  1RAJ A;  1QM9 A;  3QRQ A;  1UWB A;  3IWL A;  3OW2 R;  3HXM A;  4DWI A;  2NXC A;  4ZVU B;  2HQG A;  4UST A;  5KFL A;  1TL1 B;  2QX0 A;  3MAH A;  4EK2 A;  3RUB L;  4X84 A;  5L1L A;  3OH4 A;  1ZPV A;  1NZA A;  3MR7 A;  2P2O A;  2AWZ A;  2ADB A;  1OPI A;  2ASJ A;  5CYM B;  1IJE B;  1FVQ A;  3PHT A;  4GKK J;  1NDL A;  4ECV A;  3K5O A;  2LCW A;  2XY7 A;  3MR5 A;  2HWI A;  4YB7 A;  4Q0B A;  4C3M A;  3EEV A;  4HTI A;  4WTO B;  4DQQ A;  1KHR A;  4DFP A;  2LA4 A;  5A0Y A;  5HMZ A;  4HZC A;  2L9D A;  3DGV A;  1FF2 A;  1CSJ A;  4EBD A;  5E41 A;  1FXL A;  4IG3 B;  3D98 A;  1TQL A;  1FRI A;  2KG0 A;  2XLK A;  1UA1 A;  2XMJ A;  3MEK A;  4A8O A;  1T94 A;  1WEZ A;  3TIO A;  2H3E B;  4DX7 A;  1F1B B;  2FVS A;  3DJ4 A;  3ISN D;  2HHW A;  3SRT A;  2V68 A;  5IT0 A;  2UV8 A;  3GYG A;  4JBC A;  4C8O A;  1YP4 A;  1HD0 A;  1N56 A;  2VKZ G;  1RCO B;  1LXN A;  2M3D A;  4C8L A;  5F9L A;  1PYS B;  1HIY A;  3OUP A;  2FTR A;  1FKO A;  2HMI B;  1YKW A;  2ZH6 A;  3DLL Q;  4F3M A;  2EC2 A;  3HVA A;  1TMJ A;  4ANC A;  2XHW A;  4RKU C;  3UDL A;  3GUE A;  4FPI A;  1WHW A;  4H4M A;  1IKX A;  3DOL A;  3FEX B;  2WON B;  2CVI A;  4DQR A;  3Q89 A;  4KE5 A;  5D6G A;  4YDX A;  4OHZ A;  5HAO A;  1HQ2 A;  3PR4 A;  1KTV A;  3DLG A;  3W60 A;  3C6T A;  2VH7 A;  1CJT A;  1TKT A;  5GAG U;  3G8Q A;  4ZDN A;  2ZKU A;  4IHF A;  4NZ6 A;  3C15 B;  3Q8S B;  3DDI A;  3DLK B;  5LMU J;  1X8D A;  3RU0 A;  3M2V A;  1VR6 A;  1ZYQ A;  1FE4 A;  2EWH A;  1JWW A;  3MEC B;  3CW2 C;  4GRS A;  4HI2 A;  3SSQ A;  4NEZ A;  2EW9 A;  1UVK A;  1S9E B;  2IVY A;  1VC5 A;  1RT4 B;  3O3L A;  3MQH A;  1M90 T;  1JNR B;  4DLE A;  1QRF A;  3W5Z A;  2F4V F;  2QL9 B;  4NE9 C;  2KT5 A;  3BGU A;  3JQY A;  4ZCI A;  3IGJ A;  5LMU F;  1YZ6 A;  2DK2 A;  2J9D E;  3Q1X A;  3GSI A;  3BH6 B;  1RTZ A;  1Y3J A;  4DSI A;  2XGQ A;  5AXL A;  4OIX A;  1OO0 B;  3DXS X;  2Z2L A;  3SFU A;  4USI A;  2HHP A;  3ONQ A;  3FSB A;  3AFG A;  3QJL A;  1XWL A;  4OI6 A;  3D0I E;  3K57 A;  2QGF B;  5G4D A;  2B9E A;  1KD1 T;  3I87 A;  4F50 A;  4DR2 F;  3JTP A;  4A48 A;  2CQD A;  1C0T A;  2VC0 A;  1LWF A;  1O5J A;  2IPO B;  2BJD A;  3Q24 A;  2KT2 A;  3CIM A;  4OYM A;  5CCL A;  2IJF A;  3GOS A;  4S0M A;  1XNR F;  2Y1L B;  3CJK A;  4HHU A;  2HRY A;  2W9C A;  3J7A N;  5HP1 B;  2XYP B;  2KH9 A;  2FHK A;  3RBX A;  3MED B;  2ROP A;  4LIW A;  1EET A;  2OH2 A;  1GQE A;  4A8K A;  5HVF A;  1B3T A;  4HTJ A;  2EG1 A;  1GTE A;  4ZCM A;  1NLK L;  3HSG A;  1EB0 A;  5HJX A;  2EG2 A;  2M8D B;  1XAT A;  3JSB A;  3TDT A;  2XWY A;  3LPY A;  2RDD A;  4C11 A;  2AV5 A;  3TVK A;  2AZ1 A;  3HSJ A;  3PMO A;  2KXH A;  4AL5 A;  4OJ1 A;  2MTL A;  3R5J B;  2NSC A;  1QVG R;  2X1F A;  3VBM A;  4JI3 J;  3LP2 A;  4ES2 A;  3EJM A;  2HRU A;  3EG4 A;  1R7I A;  3HLU A;  2M2B A;  1XR5 A;  3C8Y A;  4Y6I A;  4L3N A;  4DV7 J;  1UEV A;  3I5C A;  2HIQ A;  1OY8 A;  3H59 A;  1RAO A;  1IM6 A;  3LW5 C;  4ZLN A;  2BJ9 A;  2DNO A;  2FUG 9;  1HNI B;  2DJW A;  1U7L A;  1M5H A;  4U67 Q;  4PXB A;  3V6D B;  3F1X A;  3NNC A;  4DBQ A;  3E01 A;  2UUC F;  3EUN A;  4K2J A;  3QT7 A;  3UQS A;  4DV7 F;  3A3P B;  2E7X A;  3PCO B;  4NRT A;  5KFD A;  1D9F A;  1S99 A;  2QA1 A;  5BYQ A;  3OT9 A;  1KVK A;  2Z2Y B;  4OYP A;  2MLY A;  5CAB A;  2AEF A;  1PAU B;  2W9A A;  3OBI A;  1FNM A;  3DOK A;  3MM8 A;  1OS5 A;  5DDQ C;  2ZVS A;  2XSJ A;  4F36 A;  1YRX A;  1GFW B;  3JQK A;  1EX8 A;  1MN9 A;  2KL8 A;  1H2V Z;  1WKJ A;  4P71 A;  3BQ2 A;  5GAH U;  1WD6 A;  3MCO A;  2C28 A;  2OI6 A;  1XMQ J;  1L3S A;  3FBB A;  1Q1K A;  2JHE A;  5L46 A;  4ZOS A;  2HW3 A;  3PDN A;  2R7Q A;  4FNH A;  4X4V A;  3G6Y A;  1TKX B;  4MH8 A;  5D3G B;  4NLQ A;  1RAA B;  4DJB A;  1F9F A;  4X66 F;  1VQ4 S;  2IVM A;  1RBA A;  2GQQ A;  1H3D A;  2K7J A;  2CWX A;  5D0H A;  3NNA A;  1JXV A;  2X51 A;  1YI2 S;  4GVL A;  2YPY A;  1J5O B;  1FER A;  3NS7 B;  1X9S A;  4RBT A;  3BBB A;  2M0G B;  4B3T J;  2WAQ D;  2MHE A;  5KFB A;  3HVT B;  1SQF A;  4BHQ A;  1D8Y A;  2DY9 A;  2BRL A;  3LAN A;  3KWC A;  4WFX A;  3T19 A;  4QWE A;  3M8W A;  1VHI A;  2DGU A;  4LR7 A;  2KFY A;  1X4H A;  2HHX A;  2HFU A;  2VA2 A;  1KRP A;  2W0V A;  3H7H B;  7AT1 B;  2AKW B;  3M9M B;  1TKZ B;  4B3S F;  4XDC A;  3H5S A;  2W7P A;  1T9W A;  2F4F A;  1N4I A;  4K59 A;  1Y10 A;  2AYG A;  3G71 S;  4MMO A;  3GYN A;  4KQL A;  4G1I A;  2VV5 A;  3B4M A;  4L76 A;  4R8U B;  1OSD A;  1Q95 G;  2ZJR Q;  1TEL A;  4M5H A;  3S6E A;  5HAT A;  1WTF A;  1KQF B;  1Z2F A;  1ZZN A;  1RT1 B;  5K8N A;  2ICX A;  4OJG A;  4EBC A;  3RBE A;  3F41 A;  1PYT A;  3M8P A;  4BLG A;  2XTJ P;  5EUH A;  1GEH A;  3IA0 A;  3U1L A;  1C1B B;  4XDD A;  4WZQ A;  3GV7 B;  4LVO P;  1RT3 B;  2EKN A;  1ZM3 A;  2DEI A;  1GNK A;  1KOH A;  1HYS A;  4ECS A;  4PUO B;  2RQC A;  3DRS A;  3SQG B;  2LQ5 A;  3PIP Q;  3FRZ A;  2QN6 B;  1A6L A;  1FX4 A;  3AD9 C;  3Q8U A;  3C3L A;  1DBD A;  4NLP A;  3W2W B;  5EHH A;  2VAS A;  1UVN A;  1U24 A;  5K9F A;  2J7U A;  4K0K J;  4ZPD A;  4W98 A;  4HAC A;  1Y0H A;  4RW9 A;  3EGW B;  5E2Q A;  3TP2 A;  1EJ7 L;  2QLW A;  1JLF A;  2V8P A;  2XMU A;  3D6M B;  4DX5 A;  2XO6 A;  4DR7 F;  3P47 A;  3FSX A;  4ED3 A;  2OFG X;  4K0K F;  1R31 A;  3T1Y J;  3RR8 A;  1XN9 A;  3K0J A;  2PGC A;  2XYG B;  2XO7 A;  4DFJ A;  2RJZ A;  3EWG A;  3ENA A;  4NA2 A;  2C2K B;  2RVJ A;  4HYK A;  4R25 A;  2ZZT A;  2C2E A;  3U27 A;  1GMW D;  2ERR A;  1HR0 J;  1KNZ A;  3ST8 A;  3QO9 A;  1RIS A;  3T1Y F;  1G95 A;  3NGS A;  1SL1 A;  1HBO A;  5A8W B;  3RBZ A;  4F2R A;  5DS7 A;  3N0V A;  2HHH J;  4QWA A;  2DGW A;  3TX8 A;  2YNH B;  3NGU A;  1MMD A;  1PCA A;  1S4F A;  3C14 B;  1N5T A;  4PXC A;  5IM0 B;  2NS1 B;  3PRV A;  1REG X;  2MQ8 A;  1B7F A;  4KGK A;  5DG9 A;  3ZZY A;  1X4E A;  1SXL A;  3MR6 A;  3O44 A;  3Q2T C;  4IKA A;  2RIJ A;  2J9D A;  3KTQ A;  3OL7 A;  2YWE A;  2WLG A;  3DLJ A;  3MAA A;  3D66 A;  3SUC A;  3IO1 A;  4WTY A;  1B0T A;  2POK A;  2R7O A;  3L7P A;  5KG7 A;  1PG5 B;  4EQY A;  5J2M B;  5J2Q B;  3P45 B;  4KNR A;  3AT1 B;  4TU9 A;  1X4A A;  4N27 A;  2HND A;  1YRT A;  2UU9 F;  1HLW A;  1VOM A;  2Y3Y A;  4M2B A;  1UVI A;  2J5A A;  2FHO B;  2DGO A;  1YIT S;  3VGU A;  1C1C A;  4CT8 A;  1S6U A;  3KOA A;  4UF4 A;  2FLO A;  3EGZ A;  3BH7 B;  3R5G A;  2P5Z X;  3KLE B;  2R2R A;  1F9H A;  1C4C A;  1NCL A;  1F3F A;  3OR1 A;  3ILL A;  1UJ4 A;  3MDF A;  1IKV A;  3FCV A;  5KFG A;  4LSN B;  2HWT A;  1VIS A;  4G65 A;  3BPD A;  2UUW A;  1S1V A;  2ALY B;  2MDA A;  4RW6 B;  5M2R A;  3EIC A;  1UPP A;  4GC7 A;  4XTT A;  5L6S A;  1HWL A;  1GMU A;  4ZPA A;  4H4O B;  1RI7 A;  4O3N A;  2CG4 A;  1GX5 A;  1FJC A;  1TVR A;  2DGT A;  1S4E A;  4M95 A;  1JLC B;  4JV0 A;  3PFO A;  1MR9 A;  2V0J A;  4ZN1 A;  3U7J A;  3SI8 A;  2DYA A;  1JQG A;  2QSW A;  3HMJ G;  2BAN A;  1V5V A;  1TFY A;  2V4J B;  4PPD A;  1W2I A;  1PGZ A;  3S8S A;  3RZA A;  1S5Z A;  2IRU A;  2L9W A;  5EGY A;  5HVG A;  1KLN A;  1JX4 A;  2O3D A;  4DV2 J;  3KG4 A;  1FD8 A;  1Y4Z B;  3SEO A;  2EFP A;  3CJ4 A;  4ISX A;  2BMB A;  2HK3 A;  3MGJ A;  3BJY A;  4MJK A;  4DV5 J;  3ISN C;  1N6Q A;  3JXO A;  4KH0 B;  3HSD A;  2PN6 A;  4HCQ A;  3ZC4 A;  2E9T A;  4HUS A;  2GJI A;  1WF0 A;  2M8H A;  4CZC A;  1F2G A;  4G1Q A;  4FVC A;  1TV6 B;  4U7C A;  3NWR A;  4NLT A;  5JVG Q;  2DHS A;  3BGR A;  1R3N A;  1RYR A;  1G4C A;  4KFB B;  1SKU B;  2VBY A;  4DR5 J;  5FDL A;  3RAX A;  3P49 B;  1ELO A;  2MKJ A;  4TU7 A;  4KGM A;  3I3A A;  4AC3 A;  3HJF A;  3W5X A;  4MIA A;  1NHV A;  1KLM A;  2GHW A;  5E3P A;  2LDI A;  4HL9 A;  4A8W A;  3GG1 A;  3IFE A;  1E6V A;  5T7L A;  3M2U A;  4ED4 A;  2XS5 A;  1SIZ A;  1FTR A;  2QLB B;  2ZVI A;  1UCN A;  1HNX J;  4QR0 A;  2VJV A;  3OTB A;  2P6T A;  4JI8 F;  3MEG B;  1GX6 A;  5BR8 J;  1PYO B;  2EI5 A;  2H51 B;  3FFI A;  1NKE A;  4P7T A;  2E29 A;  2CJQ A;  3TEH B;  4B3R F;  2VG6 A;  1EAR A;  2OPQ B;  1OPZ A;  3I0S A;  2FGC A;  1F5A A;  3NAI A;  4I1T A;  1PBU A;  2HAF A;  1X5O A;  3TOQ A;  2WLD A;  2YQ0 A;  3HT0 A;  2I2Y A;  2C3O A;  4ED1 A;  2VFR A;  4DG1 B;  4IRD A;  2F63 A;  5F9N A;  5BR8 F;  1HWI A;  1SKW A;  3MR3 A;  1X60 A;  4IO1 A;  1GH8 A;  4WFB Q;  2WK4 A;  4FYW B;  1SPB P;  3UR0 A;  1LK5 A;  3ZNJ 1;  3H4D A;  2RAQ A;  4ECY A;  2GML A;  1HBU B;  5JMN A;  3DRR B;  4LSL A;  3UI3 A;  4MFB A;  2LEB A;  3BN7 A;  1G97 A;  3HHK A;  2B7C B;  2D3U A;  2MZS A;  4RBV A;  4ECR A;  1WF1 A;  4ECX A;  3DU6 A;  4HI1 A;  2IMO A;  2MKH A;  3N6M A;  1HM8 A;  3GIJ A;  1CUL B;  3BRE A;  4X4N A;  1NXI A;  4NML A;  1VLY A;  4WK1 A;  1S1U B;  2N7Y A;  2OPP B;  4ALZ A;  4C6A A;  1Q0N A;  2EFG A;  4IDK A;  2XNR A;  1S1X B;  5HN0 A;  1WAC A;  2BJ1 A;  4DR3 J;  1OQ3 A;  5B7W A;  3ENV A;  3BR9 A;  5JXS A;  3W66 A;  3FQL A;  3VGV A;  5B0D A;  3S01 A;  1PJ5 A;  2DR7 A;  2H48 B;  4TKT A;  3I31 A;  2B6A A;  3OH0 A;  2DNM A;  1ZA2 B;  2W9B B;  5C42 A;  4UUX A;  4YOE A;  1SUQ A;  1U6B A;  5LMN J;  2RF2 A;  5EX3 A;  1NU4 A;  1G2E A;  5KFE A;  4PG7 A;  2I6W A;  4LRE A;  3QIP B;  1HI8 A;  3MTK A;  3NS6 A;  3NGK A;  4C97 A;  2DIT A;  4WWS A;  2ZM6 J;  2UXC J;  4TY8 A;  1JKH B;  2BE9 B;  4JB8 B;  2AU0 A;  1U48 A;  4MAK A;  5DLG A;  2XCP A;  3X3U A;  1FJG J;  1L0S A;  2MKI A;  1XBW A;  2VQF J;  3OH2 A;  3H5U A;  2TDT A;  1RHQ B;  5LMN F;  1VQL S;  3SSR A;  5KG6 A;  2NUU G;  2HQI A;  1E6Y A;  2BQU A;  1K8A T;  2IU9 A;  4EYH B;  2V4Q A;  3QLH B;  2ZM6 F;  1G7C B;  4DL4 A;  5I42 B;  3V81 B;  2R7V A;  4I6A A;  1D09 B;  1S72 S;  4B9T A;  4KPZ A;  4DV4 F;  4KAI A;  1DHM A;  1EKR A;  3MR2 A;  2W2N P;  4ELV A;  1FXD A;  3M1V B;  1HD1 A;  3TJ9 A;  5M2P A;  4OI3 A;  2BR0 A;  1B4S A;  3ETO A;  4FPR A;  4RR5 A;  3MAQ A;  2BE2 A;  4J9S A;  1RWN B;  3R2W A;  2IC3 B;  1LK7 A;  4ILM A;  2E1C A;  3MM7 B;  3NMR A;  2XMM A;  2ZH9 A;  2Z56 B;  5ETT A;  4BWM A;  2WOM A;  1N5Y A;  1OYE A;  5F0W A;  5C2G A;  2DNG A;  1VQ6 S;  3M6W A;  1NAQ A;  4I69 A;  4DU7 A;  1U1M A;  3DRP B;  4ED0 A;  3D6H B;  4AE5 A;  4EBE A;  3CMA S;  4DR1 F;  3U1M A;  2YY3 A;  2ZNZ A;  2MGZ B;  3P8B B;  5LOQ A;  2JEG A;  3N28 A;  3DHO A;  4N56 A;  1B64 A;  3P5T L;  3OHB A;  4P74 A;  3EGV A;  1T8E A;  4EEY A;  4BWJ A;  2P9E A;  2AGQ A;  5A6P A;  2DRD A;  2HZA A;  4HVZ A;  4B9S A;  2VB6 A;  1VFJ A;  1U25 A;  3THT A;  1TL1 A;  4WYW A;  2ZZN A;  1FWY A;  1HQU B;  5D0R A;  5LL6 d;  4E75 A;  2HFO A;  1EWW A;  3MCN A;  1U09 A;  5BYS A;  3HD2 A;  4C9D A;  4ZN3 A;  3UDV A;  4DHV A;  2R7R A;  1VQ7 S;  3R5D A;  2OKQ A;  2E1P A;  1N54 B;  4QIF A;  4Q44 A;  4J9N A;  4CYU A;  9RUB A;  4GO5 X;  2QYG A;  2VQE J;  3FBF A;  1FRX A;  4CLW A;  3IAM 9;  3KJV B;  3T1H F;  3X1L B;  5DDO C;  4OLO A;  5CD4 A;  3O8W A;  4BC7 A;  4IG3 A;  1OMS A;  5KTQ A;  3CMQ A;  4J91 A;  4PG8 A;  5HBM B;  4G87 A;  1RWU A;  1J2Z A;  3ZO7 A;  2V0H A;  2IJR A;  1P6T A;  1NUE A;  5ADZ A;  3KLF B;  2VQE F;  3J7Y I;  3EH0 A;  2X1B A;  2C3U A;  4CO0 A;  3BFP A;  2LQB A;  2FDN A;  4NOH A;  4ED7 A;  2NXU A;  3HFZ B;  1JIH A;  2HNY B;  3DM2 B;  5KG2 A;  4FYY B;  2UUB J;  3BSN A;  2VON A;  2ZDO A;  2FLL A;  3TA0 A;  2P9G A;  3P1B A;  3FNN A;  2R7U A;  2CA9 A;  1QLN A;  1RP5 A;  2ACM A;  5DG7 A;  3J81 j;  4Q0B B;  3VF0 B;  4LF7 J;  1K9M T;  3TZW A;  1H74 A;  2D9P A;  3CC7 S;  3CTR A;  3OV7 A;  4M98 A;  2XGP A;  5F42 A;  5DZ7 A;  1BXN A;  2VIH A;  1NSA A;  4KPY A;  2UUB F;  2WON A;  2WLC A;  4C0B A;  2OIH A;  2DH9 A;  2KM8 B;  2B9X A;  2UVU A;  1ZTW A;  3Q8Y A;  1ZPW X;  2WCX A;  1B70 B;  1APS A;  3OTC A;  1S59 A;  4PWU A;  5IC4 B;  1CJV B;  4J9O A;  1P9Y A;  5KG3 A;  3HZG A;  3VAJ A;  3QGI A;  3MM5 B;  2E5J A;  1FNO A;  4V19 X;  4CLF A;  2ZFH A;  3KK1 A;  5D15 A;  3C15 A;  2PI4 A;  2FVC A;  4ZS6 A;  4ZVQ B;  3NAH A;  4A8Y A;  1NKB A;  3CCQ S;  2A0F B;  2ZNY A;  1URN A;  2HFS A;  3UWT A;  1FEH A;  4TLQ A;  2NYH A;  3N01 A;  2B4V A;  2DGX A;  2DRA A;  1S0V A;  2XG8 A;  3DOL B;  2JEF A;  1WKL A;  2AEM A;  1AUS L;  1RT4 A;  4DN9 A;  2QMU B;  1KDN A;  1RHU B;  1WWH A;  4FS2 A;  1T95 A;  2YNG B;  3UD3 P;  4YN3 B;  2CPE A;  4NZ7 A;  1WEX A;  1IQZ A;  1FCA A;  1L3U A;  3HT3 A;  5AXK A;  4N47 A;  4Y0F A;  2KHD A;  2AW0 A;  3NCP A;  1TKT B;  3TQ1 A;  1N32 J;  1VRT A;  3QFH A;  1UET A;  4Q43 A;  4K4V A;  3QJP A;  2E7V A;  2FJX A;  2AJQ A;  3I32 A;  2W2M P;  2L3M A;  1RAB B;  3WIU A;  3VBK A;  2R2U A;  4IFY A;  1ZA1 B;  2CXE A;  1N32 F;  1VQP S;  3J81 U;  1NZ8 A;  1I6J A;  5LM7 E;  3Q8Q B;  4V19 J;  2XMT A;  1QRE A;  5HP1 A;  5DQH A;  1K0T A;  2X3G A;  4DUY J;  2KM8 C;  2IMW P;  1MMN A;  1UFK A;  1YLX A;  4R0J A;  2AJF E;  4PYA A;  1RU1 A;  5LJ5 Y;  2F1F A;  4L75 A;  4B9M A;  4QR2 A;  2E44 A;  5CYJ A;  3J80 Y;  3GB0 A;  2CQ1 A;  3HK2 A;  5ADX V;  3QYY A;  1N4L A;  2HFV A;  5KG1 A;  3ZTQ A;  1SVD A;  1C0T B;  5H1S V;  1WHX A;  4JV2 A;  1IN0 A;  2XMW A;  2KTQ A;  1KON A;  2V0N A;  1RBO B;  4YR3 A;  3KDN A;  1U4B A;  8AT1 B;  5KG5 A;  3HF5 A;  5IS2 A;  1FDN A;  2YWW A;  3KLI B;  2LQJ A;  2CJY B;  1FKA F;  4M99 A;  2W9C B;  3V2U C;  1HNI A;  1FRK A;  4LF4 J;  4K4Z A;  3PHE A;  2E7W A;  2DBB A;  2V63 A;  3V6D A;  2ILZ A;  1RTH A;  3KK2 B;  3KWM A;  4HLB A;  1EET B;  4DR4 F;  1C0U B;  3DFE A;  2C2M B;  3QMQ A;  3IBW A;  5CD4 H;  3OGZ A;  1W25 A;  4DV1 J;  2CKW A;  3ENW A;  4C11 B;  3TUP A;  2FC8 A;  2LLZ A;  4G3Q A;  3B78 A;  1F9E B;  1TTH B;  4J9M A;  4DPY A;  2G2Y A;  4KPC A;  4M5K A;  3KWE A;  3LP2 B;  3UN2 A;  2OD6 A;  2NR0 A;  4WII A;  2AZ3 A;  2AJ2 A;  3CJQ A;  1YRU A;  3FK4 A;  4Y00 A;  1VCT A;  1WNE A;  4DSE A;  2W2Q P;  4LF9 F;  1SJ4 P;  2LA6 A;  1TKD A;  2Y0B B;  3J81 Y;  3T6J A;  4K4S A;  3VWS A;  1TKX A;  2O01 C;  4USV A;  2AQ9 A;  2ABY A;  3MTJ A;  5F8M A;  3QPI A;  1TL5 A;  3L95 X;  4ZA1 A;  4RU9 A;  1N34 F;  1DY3 A;  3MFH A;  2PSZ A;  2IM2 A;  4KGX B;  3WBZ A;  4W4M A;  4ZIT A;  1LV5 A;  4N8N A;  2JEI A;  1J5O A;  4P6Q A;  2UXD J;  4OMF G;  3KXD A;  2MZQ A;  1LWX A;  2ZH2 A;  3BSS A;  4K50 A;  3MM8 B;  1AZS A;  4FF4 A;  4HEA 9;  2ZBI A;  3CPW R;  1IKY B;  3MOJ B;  1ZTT A;  1J5E J;  2HZC A;  3K2Y A;  3R7S B;  2ZBR A;  3KG0 A;  1UFL A;  1NHU A;  4P73 A;  2DCL A;  4IH7 A;  5H9E J;  3DYA B;  1KBR A;  3BXY A;  3GYX B;  5H9F K;  2V2Q A;  4C4W A;  2DCU B;  4DV3 J;  3TNV A;  1RQ0 A;  1IBL F;  3L09 A;  5AJ3 F;  1RKJ A;  2IHR 1;  1PKU A;  4CLP A;  2JVR A;  2V8H A;  4OL8 A;  1O51 A;  1U1L A;  1O8B A;  3C16 A;  1GXT A;  1KVJ A;  4R8U A;  5SUH A;  1M1H A;  3WC2 A;  4ILL A;  3RBD A;  1Q8B A;  2BJ7 A;  4QCL A;  2KB2 A;  3D3C J;  2DXE A;  4DV3 F;  3QRP A;  2Q6B A;  3M8Y A;  1H38 A;  2YVS A;  2W8K A;  3T57 A;  3HPO A;  3KG1 A;  4USH A;  1BQN B;  2PMZ D;  4Y2A A;  1C1B A;  2GNK A;  1RAE B;  2JH3 A;  1RT3 A;  1UW9 A;  5KFJ A;  2AGO A;  4USM A;  3G6E S;  4FKX A;  3SYZ A;  4KB7 A;  1PSD A;  4H54 A;  4DL7 A;  1HQE A;  2DNK A;  2FLP A;  4PUO A;  4PQA A;  3SQG A;  1U2R A;  3GFY A;  4KHM A;  1VQ5 S;  4KIA A;  3DXB A;  1VHF A;  2QMW A;  4X4T A;  2RU3 A;  2Y1J A;  1MR7 A;  1LW2 A;  1VQ8 S;  3P5B P;  2COL A;  1KKH A;  1Y5L B;  2BRK A;  3SXL A;  1N8R T;  1SC4 B;  1GTH A;  4OI4 A;  4C0H A;  1A9N B;  3DI6 A;  4WXO A;  2OPR A;  4FBU A;  5D0E A;  5D4O A;  3JAM U;  3I96 A;  4X4S A;  2LYV A;  3GIR A;  1UKU A;  2GHV C;  2RHS B;  4DQP A;  3I4P A;  4WU3 A;  1BWE A;  1BC6 A;  2QRR A;  4QPT A;  2DIS A;  3IRX B;  3CD7 A;  1Q8K A;  3H4B A;  2YNF B;  1HYS B;  2FVQ A;  4MKB A;  1UVL A;  4LFB J;  1SL2 A;  1YQH A;  3B82 A;  2I5K A;  4WF9 Q;  3LP1 A;  4WIQ A;  1SJQ A;  3W3S A;  3MPY A;  3ILI A;  3THV A;  2H1Y A;  4EUV A;  2BQ3 A;  4URG A;  2QZ8 A;  2RRB A;  1U2F A;  4TVA B;  2M52 A;  2MQM A;  3BZQ A;  1HA1 A;  2ZHA A;  2CZV C;  5KFZ A;  2G2O A;  4P2X A;  2RNE A;  3ZZO A;  1T05 B;  5A8W A;  4DZ6 A;  1YP2 A;  4ZHR A;  5IWA J;  2MQP A;  5GAD I;  4O3Q A;  3IMQ J;  1RSC A;  2HSE B;  5IM0 A;  3QGG A;  5HQ8 A;  3DKD A;  1T7P A;  4K2X A;  3SV4 A;  3W64 A;  1FX2 A;  3I5A A;  1NSK L;  1R0B G;  3IRW P;  3AOA A;  4P2M A;  2MZJ A;  2N3O A;  4U96 A;  4DUZ J;  5IWA F;  5K14 B;  2MXY A;  2GQ2 A;  5DQI A;  3DLE B;  5J2M A;  4DFM A;  2XLJ A;  4ID8 A;  5J2Q A;  2FHJ D;  3H42 A;  1RAI B;  4DL2 A;  1WG5 A;  1VQM S;  3B8H A;  4RNM A;  4E79 A;  3L7O A;  3QO9 B;  2KN4 A;  5A8R B;  3ITH B;  4NA3 A;  2CDR B;  3KLE A;  4OV6 A;  3BRK X;  3A13 A;  5AT1 B;  2HQD A;  2XZD B;  4NXM J;  3OJU A;  2G2Z A;  5L1I A;  4LSN A;  4DOZ A;  3N4W A;  2WVD A;  2QO3 A;  2BOA A;  2PII A;  2ACY A;  5CH7 B;  2EEY A;  4KRW A;  4IQM A; 
#chains in the Genus database with same CATH homology
 4K6R A;  3R5B A;  4EA9 A;  1XAT A;  5DEM A;  2W0V A;  3VNP A;  1KK5 A;  2WLC A;  3EZO A;  3TDT A;  5L6S A;  1KRU A;  2QIA A;  3EEV A;  3OW5 A;  4E6T A;  3TZX A;  1KHR A;  3Q1X A;  1XHD A;  3ECT A;  4IHG A;  5AFU V;  5ADX V;  4AA7 A;  2CUY A;  3PMO A;  1HM0 A;  4HZC A;  3FOQ A;  2JFD A;  2OI6 A;  3SBM A;  4N6A A;  1KRV A;  2W0W A;  3TV0 A;  3TIS A;  2RIJ A;  3BSY A;  3HJJ A;  3FTT A;  3IXC A;  5E3Q A;  4KQL A;  2GGO A;  2IU8 A;  2V0K A;  3OTM A;  1MRL A;  4R36 A;  3R5C A;  3VBI A;  2QKX A;  2WLG A;  3VBM A;  3FSB A;  3I3X A;  3FSC A;  1MR9 A;  3I3A A;  1THJ A;  3VBN A;  3MC4 A;  2JF2 A;  4AC3 A;  4EA7 A;  1V67 A;  2V0J A;  1T3D A;  2WLF A;  2QJ3 A;  4AAW A;  3EG4 A;  1HM9 A;  3RGI A;  2IUA A;  1G97 A;  4G3P A;  3OTZ A;  3D98 A;  1YP3 A;  4KPX A;  5E3P A;  4HZD A;  2IC7 A;  2AQ9 A;  3P47 A;  3FSX A;  4EAB A;  1MLA A;  2TDT A;  3VBK A;  4G87 A;  2OEF A;  4RL1 A;  4EQY A;  3BV8 A;  1J2Z A;  4J09 A;  2V0H A;  3NZ2 A;  3FS8 A;  3H0P A;  3R3R A;  2ICX A;  3OU9 A;  4G3S A;  3DK5 A;  3T57 A;  2IU9 A;  4KNR A;  3FWW A;  2QC3 A;  3DHO A;  1SSQ A;  3D8V A;  2JFK A;  3IM8 A;  3TIO A;  4N27 A;  2C2N A;  5DG3 A;  1QQ0 A;  3QAT A;  3EH0 A;  1S80 A;  2FKO A;  3R1W A;  4IHF A;  4EGG A;  1OCX A;  1KRR A;  1NM2 A;  1HM8 A;  3K89 A;  3DJ4 A;  4IHH A;  4E79 A;  2I5K A;  3HHD A;  3BFP A;  4M99 A;  1KK6 A;  3GVD A;  3SPT A;  3SRT A;  2ICY A;  3VBJ A;  2G1H A;  4QBU A;  4M2B A;  3TWD A;  1KGT A;  3BSW A;  4MYO A;  4M2A A;  2OEG A;  1QRL A;  1KK4 A;  4E1K A;  3G87 A;  4KNX A;  3CJ8 A;  3TK8 A;  1KGQ A;  2V0I A;  3KWD A;  4KPZ A;  2H1Y A;  4J18 A;  3R97 A;  1YP4 A;  3F1X A;  3R3I A;  3VBP A;  3IM9 A;  3GOS A;  4E6U A;  3BSS A;  4ISX A;  1FWY A;  2V0L A;  2NPO A;  4FCE A;  2P5Z X;  2VD4 A;  3P1B A;  3BRK X;  3R0S A;  2XAT A;  4N6B A;  3MQG A;  2QIV X;  1SST A;  3FSY A;  4M28 A;  4MZU A;  4E75 A;  5DZ6 A;  2G2Z A;  3ST8 A;  2P2O A;  4EA8 A;  1QRG A;  1QRE A;  1G95 A;  2G2O A;  1TDT A;  3OUP A;  4MFG A;  1MR7 A;  1YP2 A;  2WLE A;  4N69 A;  3TZW A;  1FXJ A;  4HCQ A;  4HUR A;  4DCL A;  2OI5 A;  4R7P A;  3VBL A;  2GGQ A;  5U2K A;  3KWC A;  2WLD A;  3HSQ A;  4HUS A;  2VHE A;  4G3Q A;  2Q4J A;  3MQH A;  5ADX U;  5AFU U;  2JF3 A;  1Z90 A;  3R5A A;  4H7O A;  3HJV A;  1QRF A;  4M9C A;  4R37 A;  5DEP A;  1HV9 A;  1QRM A;  3PTW A;  3R5D A;  3C8V A;  5E3R A;  3BXY A;  4M98 A;  3TZZ A;  5L6V A;  1LXA A;  4RR5 A;  5F42 A;  1V3W A;  4EAA A;  5DZ7 A;  3JQY A;  3R8Y A;  3TQE A;  3TZY A;  2G2Y A;  1SSM A;  3IGJ A;  3GUE A;  2OI7 A;  3R2W A;  1KQA A;  3V4E A;  3KWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...