3CJ8A

Crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
AMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransfe
total genus 55
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3cj8A03
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3cj8A02
4.10.180.10 Few Secondary Structures Irregular Black beetle virus capsid protein Black beetle virus capsid protein 3cj8A01
3I3XA 1Z90A 4K6RA 2OEFA 2W0WA 3HHDA 3DJ4A 4IHFA 3FSCA 3EG4A 5DEPA 2P2OA 1QRMA 4AA7A 3R3IA 2JF3A 5E3QA 2H1YA 2C2NA 1V67A 4M99A 2IUAA 2OI7A 4G3SA 1KK5A 4KNRA 1T3DA 3FSYA 2G1HA 3H0PA 5DEMA 2WLCA 5ADXU 1YP3A 3TIOA 4AC3A 4EA7A 2W0VA 3BV8A 5DZ6A 4RL1A 1QREA 4HZCA 5F42A 2I5KA 3PTWA 1QRFA 3K89A 3DK5A 3G87A 1XATA 4G87A 2JFKA 3P47A 4HURA 3MC4A 3FS8A 3FWWA 4ISXA 3TZYA 3R97A 3DHOA 3BFPA 3IGJA 2IC7A 1OCXA 5DZ7A 4E6UA 3OTZA 4FCEA 2NPOA 3OTMA 3BSWA 3D8VA 2WLEA 4H7OA 3HJVA 4RR5A 1FWYA 2FKOA 3I3AA 1SSQA 4HUSA 5ADXV 4G3QA 3VBMA 2CUYA 3HJJA 2JFDA 2VD4A 4E79A 2OI5A 1HM0A 3JQYA 4MYOA 3FOQA 1QRLA 3RGIA 3KWCA 1KHRA 2TDTA 4J18A 2IU9A 2P5ZX 3R5AA 1XHDA 3SBMA 2RIJA 4EQYA 3PMOA 3VBKA 4N27A 4R36A 1V3WA 2QKXA 3BXYA 4M98A 3OW5A 1HV9A 2VHEA 4R37A 2QC3A 1SSTA 2OEGA 4M9CA 1THJA 3R0SA 3TK8A 1HM8A 1MRLA 4MFGA 4E75A 4R7PA 1TDTA 3TZZA 3VBNA 3FTTA 2G2OA 4E6TA 3IM9A 1QQ0A 3BRKX 4EABA 3ECTA 3MQHA 4KPZA 2WLGA 3T57A 3QATA 3TWDA 4EAAA 3VBPA 3TZWA 1HM9A 1J2ZA 4N69A 3FSBA 3SRTA 3MQGA 4DCLA 5L6VA 2G2ZA 2XATA 2IU8A 3KWDA 4KNXA 5AFUV 4AAWA 3F1XA 2V0HA 1MR7A 3TISA 3R1WA 3R5BA 1KGTA 2V0KA 1MLAA 1QRGA 3SPTA 5E3RA 4MZUA 1KK6A 5U2KA 3NZ2A 2G2YA 3TDTA 1G97A 4IHGA 3EH0A 4M2BA 4N6AA 3KWEA 2ICYA 1KRUA 2AQ9A 4HZDA 3R3RA 5L6SA 1NM2A 3GVDA 1KRVA 3R5CA 1KRRA 5E3PA 4QBUA 2OI6A 2QIAA 3V4EA 1SSMA 3OU9A 4M2AA 4IHHA 3BSYA 3Q1XA 4EA8A 1YP4A 2V0IA 3R2WA 4J09A 2QJ3A 1LXAA 3IXCA 5AFUU 3HSQA 1KK4A 3TV0A 4HCQA 2GGQA 3C8VA 3EEVA 1FXJA 2Q4JA 3TQEA 2V0LA 1YP2A 2JF2A 1S80A 4E1KA 3VBLA 2GGOA 4EA9A 3TZXA 3ST8A 4KQLA 2WLFA 4KPXA 4M28A 3P1BA 1KGQA 3EZOA 3FSXA 3OUPA 3D98A 3BSSA 4G3PA 3IM8A 1MR9A 2WLDA 1G95A 3R5DA 3R8YA 4EGGA 2V0JA 3GOSA 2QIVX 3CJ8A 1KQAA 5DG3A 3VNPA 3VBIA 2ICXA 4N6BA 3GUEA 3VBJA
chains in the Genus database with same CATH superfamily
3B4DA 4PYAA 3BQ2A 1FD2A 3DMJB 2W0WA 2YKMA 3Q23A 4HACB 4DV4F 4I2QA 3EG4A 1SB6A 1FNOA 2OHDA 1U1NA 2KB2A 1P9YA 4C0HA 5BYSA 2NSBA 2DH9A 2G0CA 5IV3A 3SSSA 1SKSA 1D9DA 4AE5A 1K47A 7FD1A 4QR2A 1CS4B 4WIIA 1UPPA 3LTOA 3PRBA 4FZVA 2WB4A 2RRAA 2ZH6A 4CP5A 3KJVB 2ZD1A 4X65F 1KDNA 1KR4A 5U47A 1WELA 1VLOA 1YWXA 3C8YA 1MWZA 4LF7F 3KJQB 2UXBJ 3DGPB 4C8YA 1HI0P 3V6DB 3FEZA 4ZVFA 2HBZB 3N5BA 5F8GA 1X4DA 4F0HA 1NK0A 4KO0A 3WX4A 4JV1A 1L3UA 5A8KB 3MC4A 4LF1A 5HAOA 1SKWA 3DN9A 1BY9A 4JI2J 1T9XA 3OTBA 4NA2A 2VD3A 2R7OA 3BFPA 1UFLA 4I2PA 1HMVB 1U2CA 2YBVA 3VHQA 3OTZA 1NPRA 2OI2A 5KFOA 1H98A 1RWOB 3RB0A 5FDLA 3D8VA 4FVMA 1N5YA 4O4GA 1KVKA 2FVCA 1KLMB 2P9EA 2Z58B 3TA2A 3W5YA 5ADXV 4F3QA 3GQCA 4DR2J 2RDIA 1N48A 4KGVB 4G3QA 3VBMA 2CUYA 2EFGA 5IWAJ 3CC7S 2WAQD 3P45B 1QRLA 1XMQJ 4DPXA 1NPKA 2TDTA 3IBCB 4L72B 3TVKA 3JAMY 1SQGA 1WOOA 3CF5Q 5E33A 1JQGA 2OO4A 1NH8A 1UEVA 3SBMA 3KHRA 2HNYB 3O44A 5HP1A 2KFNA 3NS5A 4ED8A 4ZOSA 1R8HA 2V6AA 4RW6B 1DBDA 4C8ZA 1ZM2A 4KHPJ 4DDFA 3TK8A 1FO1A 1URNA 3SUCA 3H4DA 4ZPAA 3FEYB 1SXLA 1ZBTA 4JV5F 4ELTA 2VONA 2BKOA 4Q0BB 2EKNA 3EJMA 3QSIA 1S57A 2EFNA 5IC4B 2WVFA 1XMOF 4B3MJ 1FVSA 4HT5A 4Y28C 1K1QA 4LREA 5BR8J 4N69A 2WOMB 4OYAA 5K14B 4F36A 3MQGA 3SFGA 4A47A 3QWUA 4QIEA 1NLKL 1RT4B 2C2OB 4HHUA 3LGMA 4NLUA 4ZPDA 3TUZC 2JHEA 3K59A 4A8XA 4CLTA 2ABYA 4ERDA 5KFEA 3UW1A 3RBZA 2V0KA 2XSJB 3DLKB 1QRGA 2LA6A 5KFTA 1VS3A 1TL5A 4F0MA 3VAKA 3L4BC 3PW7A 1NK5A 3MWBA 4ED5A 1DTTB 2FLPA 2AD9A 3S1TA 2C28A 4M2BA 1EHWA 2ZJQQ 1RAAB 4OX8A 1TKTA 4IG0A 2WCXA 2E1PA 4ZLJA 4X4SA 3J81Y 4CIOA 2GGPB 1RTJB 3GV8B 3KWMA 3OU9A 3H25A 4EU0A 4IHHA 4ICLA 5SUHA 2WTFA 4EA8A 3DM2B 2ZHOA 4OZ2A 1I94J 3D1QA 2J6TA 4JI0J 5ETKA 4OFZA 4ZHRA 1REGX 3N6MA 1FXJA 2EBGA 3JTNA 2QV6A 3HHKA 3CMAS 5IXUA 4XDDA 4X4NA 2B9WA 3M8YA 2ZNZA 3AA8A 5DQGA 1VQ6S 1M5KC 5E3AA 4DG1A 5KFNA 1TL1A 2MKYA 2ALYB 2N4DA 2VU5A 2Z4PA 3JSYA 3MM6B 2MSTA 4LFAF 2GHVC 1WTBA 2FJVA 5KT3A 5KT4A 2A18A 2J76E 2A1BA 2V2QA 2V0JA 2VB6A 3CJ8A 2R8GA 2GQCA 3R7SB 4YS2A 1G4CA 1RTIA 2OAUA 4ZLNA 4OX9F 4DV2J 5J2PA 4B3SJ 1GMWA 2BKNA 4WP3A 5AXKA 4DBQA 3LH2S 2ZOFA 3F56A 3I6PA 3JTPA 4WE1B 3ZZTA 4YUDA 1D8YA 1NK9A 1TFWA 2EC0A 3FSCA 4YY3J 3KFWX 2KVQE 5KFQA 1HKAA 4F4WA 4E8UA 1GMVA 3PKMA 2EK1A 1FWLA 3UD5A 3DRYA 1QUPA 1W25A 2F3JA 2AV5A 3MM9B 3V4IA 2LDIA 2PFDA 3QIPA 5KFAA 3CJTA 2BQRA 3DDNA 2MZQA 2DGWA 5E0OA 4PQUA 1T11A 7AT1B 1OY9A 4DN9A 1Y7PA 4KGXB 3W1YC 1YP3A 1TVRB 4LSLB 3UFCX 3SQOP 1Q53A 3R27A 1TL3B 3RR7A 2GC8A 3S6EA 3CCUS 1TK5A 1XATA 2F4FA 2RRBA 1FKOB 1HI1A 5HK4A 4O3RA 1YDLA 3DMJA 3FWWA 3CMQA 1PYSB 2B6AB 3TUJC 3UDVA 2V34A 5HQLA 4QWEA 4EBEA 1XQIA 3NGDA 2VG7A 4DEZA 2WW8A 3ITHB 4P2XA 2AGOA 4RU2A 1G6BA 3LA0A 2MB0B 4P9SA 3ET6A 3NY0A 1GX5A 2IRUA 1U1OA 2GHWA 3MR5A 5KFPA 3I96A 2OMOA 5F3TA 2HPUA 3OVAA 3KOAA 4A8WA 1QAYA 3KK1A 3ADAC 5EHHA 2L3MA 1Q95G 4IFVA 1KHRA 4G65A 3GILA 3GV7B 4UOFA 2DXFA 3C15B 3ETMA 2WONA 3MEGA 5AXMA 5B08A 2E7VA 1XMOJ 3FBCA 3Q83A 4B3MF 2NXEA 1WF0A 2DITA 2O1PA 3K5OA 2VHEA 2H51B 5IV4A 3D1OA 3KDNA 5FIIA 1THJA 1KQFB 1YIJS 4BHQA 1C4CA 2P5VA 1H38A 3NGRA 4FF2A 3JS9A 2CG4A 4JI4J 1RAOA 4OI3A 1S4FA 1HL6A 1XWLA 2HURA 5A8WA 3KLHA 5GAGU 2FB0A 5CA5A 1OQ6A 3TWDA 4EAAA 3D6FB 3LPYA 3THPA 3CDAA 5L6VA 4ZIWA 2CZ4A 3VALA 4LF2A 3NS6A 3Q8QB 2GIRA 5AFUV 2HGMA 3BSCA 1YBUA 1PIEA 2EFPA 2W25A 4FKXA 3TQ1A 1M0SA 3R5BA 3POTA 4LQ9A 5J1PA 2GVDA 2QLFB 1VGYA 4LIWA 1XIQA 1RT2B 2XSFA 3DYAB 5LSOA 1W2BR 2JJ4D 2AJ0A 2L9NA 4USMA 4TXSA 1G97A 3GIIA 2UUCJ 3SCIE 3KWEA 4OZJA 3I9V9 2IC3B 1ZYQA 4K4UA 2AQ9A 1YVFA 1B7YB 1RWPB 3BPDA 5DDRC 1MWYA 4RUAA 3R5CA 2CQ3A 1RHMB 4XIUA 2E1CA 3QLHA 4FBUA 1H3DA 1HPZB 3ELHA 3EWGA 3K58A 1D1UA 1GFWB 2UUCF 2XLJA 5KFVA 3QGHA 5C42B 4V1Ak 4H54A 3EZUA 2H4WB 2Z30B 1KP6A 2HHPA 3EZ5A 3IG1B 4NCGB 4YFUA 1JLBB 2ZWPA 5EUHA 3T1HJ 2LYVA 2XI2A 1FEHA 3DXBA 1S12A 2UUWA 4O3NA 4ES1A 2CNNB 1D9AA 3ST8A 3PHTA 4FP9A 1XMBA 4KPXA 4JP8A 4RLEA 1UETA 2YNGA 2ZUGA 4ZP9A 1I6JA 1QSSA 3DOLB 1TL7B 3LP2B 4KKOA 2CPEA 1GXTA 4DF8A 2RS8A 4PYDA 1HWLA 2CADA 4F67A 2YNFA 2GV1A 1RSCA 1VK3A 4UY85 3IRXA 1T03A 4J9PA 1WEZA 3BH6B 1CJVB 3NOGA 1KQKA 5HQMA 2ICXA 3SZ2A 1K0TA 1Y5LB 1OPIA 2ZFHA 1FRJA 3I3XA 2HLUA 3LWLA 2XWXA 3EXCX 3ISND 2Z56B 1PBAA 2L41A 3DJ4A 4WU3A 3AJ1A 3V81A 1UVLA 2F9JA 1N54B 2AX0A 4MMOA 4R0JA 4LF6J 3GP9A 2P6SA 3QQCD 4U7CA 3D1HA 1M90T 2ZZTA 4N41A 4NLVA 2BDPA 3HULA 2R8KA 4KNRA 4IRKA 1LFWA 4RPFA 3FRZA 5I3UA 4QIFA 2F65A 2K2PA 4BS2A 3HI9A 2QN6B 1JLAB 2J5AA 4CRJA 3IRXB 5F8MA 5HMYA 5KT2A 3MGJA 2KXNB 1S6OA 5KFCA 2IM2A 3CB4A 3WIUA 4YR0A 1CEZA 4U6PA 1WF2A 1HWIA 5DZ6A 2Y8YA 2HQCA 2XMAA 3DDKA 2XNQA 1TV6B 4J91A 3VAMA 1M1KT 1F5BA 4C3LA 2ZOGA 1ZPWX 4G87A 3PJXA 4M5JA 3NXZA 3OXGA 4WF9Q 2OUGA 3BGLA 3CCVS 4PXCA 2UV8G 5GVQA 1UEUA 2F63A 4N77A 4P7VA 4B08A 1LW2A 1CULA 2B4OA 1RA6A 2DCUB 2C3UA 2ILZA 3KDOA 3EUNA 4RW9A 2XHCA 4GVLA 4QW8A 4NOHA 3A4TA 2LDYA 1WTFA 2DT9A 1HD0A 2D69A 2RUGA 3D3BJ 3HX9A 1YSJA 2NPOA 1TZ0A 4O23A 4RX6A 4B02A 2G4BA 2WLEA 3Q24A 1QUVA 4F02A 1PJ7A 2BOAA 1FX4A 5LMUJ 4I7FA 1DQ8A 2E7WA 4WU2A 5C5JA 1JNRB 1RHRB 2JFDA 3C6TB 3FZBA 3O8WA 2YKNA 2AHOB 2MJUA 3JAMU 3FCWA 3M8QB 4P71A 1ZZNA 2UXCF 4Y2IA 3FSIA 1JIHA 2QX0A 4USUA 2Y1LB 2WHOA 3SMZA 3GTYX 1X60A 2FY8A 4ER8A 4ECWA 2LKZA 1ROFA 2RIJA 1O6XA 4UZBA 3NL0A 4JUZA 1HYSB 2U1AA 1WC0A 3OTCA 5DS7A 2Y1JA 4B3SF 4DSIA 1YI2S 1SL2A 1LW0A 5HLFA 3KLGB 3TZZA 4LF5F 2DH7A 3W2VB 4IFYB 2Z8QA 3MD3A 3PR4A 1L3KA 1R89A 1U7LA 1JLAA 3KHGA 1GXUA 2OPSA 3EE3A 3GIMA 4CO2A 4I67A 4DCLA 3OXLA 5C24A 3WIVA 4AFFA 2GFFA 3PYEA 2G2ZA 4DV5J 1V3SA 4OYBA 1NJYA 4MK7A 4DR5J 3EPIA 1HMVA 5DRKA 4BWJA 4BC9A 5DETA 3MPVA 2BE9B 1DFDA 4OHZA 3N6NA 3G8SA 3SPTA 3SSRA 6FDRA 3THVA 2IJFA 3NCPA 2F9DA 3LALA 2WONB 1S79A 3BZQA 2ICYA 5DDQC 2HHHF 2ALZA 2AW0A 1SC1B 5HBMB 4PPZA 1FDAA 2BJ7A 4OV6A 2BV3A 3MOJB 4PXEA 1E6VA 1S1WA 3CCLS 2GMHA 4XAKA 1JLGB 1RAIB 5C24B 4NLQA 4NX9A 2AU0A 1SCJB 5FLXU 3PIOQ 2JRSA 2GX8A 2YX4A 3ET6B 1KK4A 2UUAJ 4HCQA 2AEJA 1VIOA 5CD4A 4NYPA 2GJ2A 3Q8VA 4KPCA 3T5JA 2EFVA 3OR2B 2H5EA 4ZLLA 1N32J 3A12A 3HFZB 1I51B 2HMIA 4DZ6A 4WPAA 4WIQA 1RT6A 1VQOS 1GNKA 1F5AA 2V8PA 2E5JA 2RKIA 1XR6A 3V6JA 2X1GA 3D66A 3NOCA 2XYHB 4ZPBA 3MF5A 2D3OR 2KZMA 1HWJA 2ZWOA 1G95A 4OI1A 4EGGA 1AUSL 1RTZA 2FDNA 3MEEA 2BYCA 2BE2B 5ETLA 1HNXF 2ZE2A 1YJRA 3L7OA 1M5PC 1SQFA 4YR3A 5L1JA 3OD2A 1CQMA 2W8KA 5GADI 1Q5VA 2UUBF 1Z90A 4K6RA 2VQEF 4OLOA 3K2YA 4NLSA 5I3PA 3PEJA 3MFHA 4CCHA 3I31A 3UD4P 2UXDF 5IWAF 3PV8A 2QO3A 4PR6A 1KC8T 1GXLA 2AP6A 2IRXA 2PA8D 3A3NB 4WFNQ 3I0RB 4G3SA 3HVTB 5AE2A 2KM8B 4J9QA 5D4PA 4QYZK 2W9CB 3FUYA 4Q45A 2W2PP 3KKFA 3H0PA 2WLCA 3UN2A 4GKJF 3MR3A 1D09B 4U67Q 4WFBQ 4PUOB 3G8TA 4X2BA 3PTWA 3OW2R 2DHHA 3AT1B 5IS2A 5C2GA 4RNMA 1VQ7S 1HNWJ 4ZJOA 4R8UB 2ZKTA 4TQSA 2JFKA 4KPYA 3LANA 2MPUA 3ZXWA 2ZBCA 1QSYA 4DR7J 4DQIA 3A8EA 4CH7A 4LF9J 4LF7J 3CD6S 2OH2A 3R97A 3PRVA 3FNNA 5C42A 3PO5A 3HT0A 4E6UA 4KRWA 1P1TA 4LF8F 3M2RA 2ACMA 1QTMA 3BSWA 4TLRA 4H7OA 3OL6A 4WKRA 4XK8C 2QRRA 1NZAA 5B0GA 4RNNA 4YEAA 1JK9B 1NSAA 2FUG9 2KO1A 4HR2A 1XNRF 4YDDB 1WKJA 2Z2ZA 3H98A 4F8RA 2IVYA 1JJHA 2NYHA 4CTAB 2Y0BB 3I56S 1REVB 3FVYA 4GO5X 2J9EA 2FLNA 3QO9B 4F7VA 4OJ3A 4K4VA 4CI0B 5A76A 1N5QA 2DIVA 1VRTB 2CJKA 1FRXA 3DI6B 3MMCA 4DL5A 2V8HA 1HW8A 3J80U 2U2FA 4FNIA 1TVRA 1ZZFA 3CO9A 2R7UA 3RRGA 1SUQA 5LJ5Y 2MQQA 2JL9A 4NPOA 2YKOA 2LQ8A 5E5NA 5L1KA 4Z37A 3A8KA 4JI3F 3S8SA 4NL5A 2D3UA 2DNNA 1BHNA 2DR7A 1FXLA 2X51A 1F1BB 2C42A 2F4VJ 1M1GA 4HL9A 1S0MA 2MKIA 2OTJS 1SKUB 4NA1A 3MAAB 4PABA 5DG7A 5L39A 4X4QA 3N79A 2GAHC 1S9GB 2XGPA 2OD4A 1KQSR 1BD6A 2FHJA 2HLTA 2K3KA 4ES3A 4KY3A 2GA7A 5F8HA 3CO0P 5LM7E 3FMWA 5HP1B 2XC9A 1ZPVA 3VAIA 1NK4A 1L3SA 3GR0A 3GR1A 4NI2A 5LXRA 2UU9J 3VV2B 1RAFB 2DRAA 4J7CA 4M1KA 4B3OA 1RWNB 5L6SA 2BRKA 3DLHA 3M1VB 4KSEB 1HBMA 2AYMA 2DHAA 4CLPA 2D9OA 2QIAA 1FE0A 1SSMA 3CCQS 4J9OA 1BGXT 2CZ9A 1GH8A 4IFYA 2HS3A 3KLIA 2PMHA 2KVIA 2B6AA 1KLMA 1MN7A 4ZLPA 3KLGA 4DR4J 2DR5A 2BUNA 1J5OA 1CPZA 4C97A 1IKXA 1JXVA 3LP0B 4WXOA 4P2MA 5HATA 4NASA 1R6VA 4C8NA 3RAQA 4DR7F 3TJ9A 2HVIA 1LWEB 3V4MA 3LAKA 1RAGB 1YJTA 3MFIA 2FPHX 4FXVA 4IG3B 4RUHA 2ZZMA 4BC7A 2YWWA 5F9LA 2GJIA 3PYDA 1RP5A 2YPZA 3LF0A 4YB1P 1NKBA 1H0HB 4PWUA 4YN3B 4ZVRB 2ATLA 3K0JA 5JVHQ 4LF4F 3NAIA 3ILLA 4G3PA 4PG8A 5JUMA 3NNHA 2GMLA 2ZBRA 4FS2A 5B0EA 3KK1B 1X4CA 3M6UA 1YBAA 4LRBA 4AQYJ 2V2KA 1QM9A 3N01A 3VNPA 1RT3B 2R7XA 1X4FA 2CVIA 2F4VF 5F0UA 2W9CA 3QT7A 3O6QA 1VIXA 2F1FA 1S1TB 3OFGA 4DFPA 4DL0C 2PD1A 3DRRA 3D68A 3MR7A 3ZTOA 2AMCB 2W2QP 2HS4A 3T19A 1SQEA 5HMXA 3KLEA 4DLEA 3RAXA 2XMWA 3M2VA 2VG5A 2HNZA 3KUGA 4ED6A 2Y1RI 2C2NA 4ECUA 3PEHA 2P2CB 3MR6A 4EK2A 1NHUA 4ETXA 2M52A 3I5BA 2IVMA 4Y2MA 5FJ4A 1CQNA 2EBEA 4MK9A 3L09A 3OQ2A 2G1HA 3MM7B 4N5SA 1TK8A 3JXOA 2NS1B 1N5TA 1TU0B 4U7UK 1E6YB 1TL3A 3MPDA 1QVGR 2I5JA 2RB7A 3IS9A 4H4MA 2R7VA 4EBDA 1S1UA 3DU5A 4Z2XA 3KHLA 1VHFA 2G9OA 1YRTA 2OKQA 3LO3A 5G4DA 3W63A 3P3DA 2I5KA 1N32F 1IWGA 2MY7A 3HFVA 2MHEA 3SV4A 2NYIA 5IT4A 1J5EF 4ZHRB 1QD1A 2XZTB 2F5GA 4ZVOB 4TQRA 3QSYB 3DKDA 5B0BA 1RISA 1OYDA 3M2VB 1SL0A 1U0SA 2FZCB 3GQAA 4S0MA 2KJVA 2PI4A 5ETVA 5GMDA 3Q8YA 1U0HA 4FYYB 3RRHA 2HWHA 1T03B 1UVJA 1PAUB 1NB2A 1QJHA 5D78A 2IIHA 5K8NA 2HVDA 2XO7A 1DLOB 1HBNB 2IHR1 2LVWA 3U27A 1SJRA 1BWVA 3R5JB 2G0JA 3J7ZT 4U7UD 1U47A 1URRA 1LFPA 5HBMA 2J9DE 2VBZA 3I32A 1HBUB 3RZAA 2VJUA 1X31C 3W62A 2EFQA 1JLBA 5LL6d 3HT3A 5I42B 3M9NB 2RSQA 4R36A 1S59A 5A0YA 3PIPQ 4F4AA 2X7IA 4DU7A 3NWRA 3KYLA 4KB7A 1VBKA 2HHUA 1TDTA 5D77A 2JWNA 2C3YA 2KRBA 3CULA 2FGCA 5DO2A 1FTCA 3RJMB 5HVGA 1PGZA 3M6VA 3MQHA 2JSXA 4YR2A 2ASJA 5CYMA 1S97A 2FQQB 2XMJA 1ZA1B 4L75A 4NLYA 4C48A 2VICA 2HS0A 3HDSA 4N7TA 2ADCA 4ZVUB 2IU8A 3UO0A 2EFOA 2MLXA 2HKEA 3MTJA 3KLFA 1NKCA 3EGWB 2QL7B 2RDJA 3TJAA 1IKYA 1MMLA 5L1IA 2Z57B 3IXQA 1BE4A 1H2VZ 1HNVA 1RTHA 4CTAA 3MAHA 2B5JB 3PO4A 4JI5F 1RQ0A 3T9ZA 1S1VB 4UOGA 2IMWP 1TKXA 2RAQA 3OLAA 4FF3A 5HJYA 5IT9Y 1Q8KA 3I4PA 3GFZA 4DCPB 1T9UA 2V0NA 3UNGC 1KRVA 1PC4A 3AD8C 1RT1B 3DOKB 2BANB 4Y34A 3OBIA 5D4NA 1S7HA 3QGGA 4FKYA 2JEIA 1MSWD 3Q1XA 4Y6IA 4QPXA 4WFZA 3ZZ0A 4EI2A 1HR0F 1WDDA 4K4YA 2VJVA 4YB5A 5HMZA 4I56A 1YLXA 4CH0S 3HXMA 5DM7Q 1UA1A 4NLPA 1MNEA 3OTEA 4HKQA 4ZVPB 1YJ7A 4MFBA 2JF2A 3DXSX 4DPYA 2JLEA 3GFXA 4IH5A 4CYUA 4EA9A 2A2CA 3ZTRA 3TZXA 3J81U 1NK6A 2ROEA 1RBOB 2FJDB 4EBCA 1NSPA 2AKWB 3T5HA 3EVOA 1CJKA 3H5YA 2BANA 1IKXB 3LP0A 2CQIA 1N8RT 2DEJA 2YVSA 5L1LA 3C2PA 4KFBA 1S10A 1SJFA 1IM4A 2M3DA 2PE8A 3AD7C 4JI6F 3VBIA 4WTYA 3M1VA 3KLFB 2P6TA 4G1QB 2IA0A 2BJ3A 1WWHA 2CZVC 2LCWA 1NXIA 3C66A 1HNVB 1RTHB 4Q2MA 4C0BA 3JSMB 3D6MB 2E5LF 2H54B 5DEPA 1RA7A 2KHCA 5GMEA 4Y00A 1F0XA 2XQCA 4OYIA 2B9XA 2AF6A 4F3OA 1NNDA 5E3QA 4B9UA 4M5IA 3J7Z5 2RT3A 1RACB 3D28A 1RKJA 2OI7A 1FF2A 2V4RA 1T3DA 2JEJA 3HZEA 3M8QA 1HHQA 3DOMB 3IMQJ 2FJXA 3KNGA 3MEDA 2CQ2A 4TYAA 2VQFJ 1QE1B 5EX0A 2ZH9A 4ZMMA 2VKRA 1P27B 3OSPA 2ZH8A 1QTNB 4CLYA 1AFJA 1NPPA 4LRCA 3QT5A 4P74A 1GTHA 2XY6A 3W60A 1A7GE 1RCOB 4A8MP 3R7BB 3PKYA 3FC9A 3DLLQ 3T1AA 4JI8F 2V9WA 3K7RA 2DO4A 2C2DA 1RT3A 1S6PB 2FJAB 2JOQA 1WF1A 4DN0A 2A0FB 4TY8A 1SPBP 3X3UA 1N33J 3D6HB 1QSLA 3KMSA 2ZHBA 3CJKB 4RW4B 3ZZOA 1HPZA 2ZH7A 2HBRB 2PI5A 2OI5A 3I5AA 1RABB 2VKZG 3OT9A 3RAMA 4ZVQB 5DLFA 1NU4A 2BACA 2J0QD 4CQ1A 2QLXA 2AYEA 2QG9B 3ONQA 1NDCA 2CJAA 2EW9A 2O5DA 2RKIB 3B8HA 3IFEA 1X0PA 2RF2A 1RT2A 3BM7A 4NLTA 2CWKA 3W8PA 3G71S 4R37A 2XTJP 3HHLC 2ZH4A 2OPPB 1T8EA 4IKAA 4JI7F 4MFGA 3QJLA 1RLDA 3R5GA 1JB0C 4NWBA 3OUYA 1VQPS 3DLGA 1QAJA 5ETQA 5KG0A 4WCEQ 4RUCA 3DRSA 1FCAA 3VBPA 1XTZA 1HM9A 5HN0A 3FSBA 3DRPB 5B0CA 3V5RA 1FFSB 3RRKA 3DCAA 4HEA9 4TYBA 1BQNB 2QZ8A 3Q8RB 1AB8A 2FLOA 4ZCIA 3K5LA 1DTTA 3G82A 1TAQA 4YHHF 2CPHA 1PC5A 3BSNA 2GW8A 3ENQA 2IFXA 3R1WA 2Q3PA 2ZDOA 5ETTA 2BR0A 1BQMB 2HK3A 4ILMA 2FTRA 1HLWA 5U2KA 2E1MC 1EP4B 1HBOA 4UY8T 3IG1A 3EH0A 1IVZA 3QYYA 3AQOA 2GVZB 5C2CA 1FJ7A 1NM2A 1FJEB 1B99A 1YKWA 3HHNB 4QBUA 2AJQA 2OI6A 3QGIA 2DB1A 1Y5IB 5HO4A 4QCLA 2AJ1A 1R27B 2RNEA 1X8DA 3A3PB 4CM2A 4NLDA 3PRDA 3MXHP 2ZH3A 1CJUA 3ITHA 1VRTA 3EEVA 1NH7A 1RLCL 1VQYA 1WHXA 4ZN1A 5J2NA 2V0LA 5H9EK 2Y9HA 1WI8A 2LFVA 3W64A 4AL5A 4PAAA 3RB6A 2BABA 1TFYA 4E1KA 1BXNA 1NAQA 3BQ1A 2P9GA 3DDIA 4CO1A 4JI3J 2WLFA 1IQZA 5CABA 3HP6A 2KZZA 3MEKA 4TU7A 4UTGA 3KK2A 2W9BB 1BUXA 1YJNS 3BKTA 3UDLA 4X4TA 1KHVA 3NLCA 1IBLJ 1SL1A 3IN5A 4B9SA 1VJWA 2COLA 2KT5A 3R8YA 3NP5A 3UI3A 2DNHA 1M1HA 3H40A 3BJYA 4DSJA 2HVHA 4GKKF 1HHSA 2AZ1A 4OLPA 2VFTA 5IM0B 3IBWA 1XJWB 1NO8A 3S01A 4WK3A 2EWHA 3GCWP 4X64F 3W3SA 2Z2YB 1IJFB 1C1CB 1Y00A 2ZKUA 1JKHB 4I0WA 4NE9C 1R0CB 2JNJA 4J37A 3PX0A 1FJGJ 1QRMA 3RB3A 1IBLF 1HNWF 3I87A 1NCLA 2XS5A 2NSCA 4URGA 1DHMA 2MZJA 2XEXA 3G6VA 5L38A 1LW2B 2ZC3A 2IUAA 2N3LA 4IFVB 3QWPA 4ATNA 1Y9OA 2MZSA 4UZCA 1U49A 2Q66A 1RDRA 4KV8A 1C0TB 2W2MP 5H9FJ 1Q79A 4LFAJ 4F50A 5ADZA 3D0HE 2QA4G 3BSAA 3NGUA 1JLQA 4K5SA 1Q78A 4O3PA 5KG5A 1VQ9S 5D8HB 4IYQA 1JJCB 1U8SA 5F42A 3DI6A 3UR0A 3D2WA 4PRFA 3GG0A 3TUPA 1R8BA 4NMLA 4X4UA 4USKA 2H4YB 2Z2MA 1FJCA 2QGFB 3FRYA 4I2QB 5DDOC 4WP8A 3PYFA 2M4MA 4FN5A 5H1SV 4JI0F 4ECZA 3CIZA 2AJFE 2XMVA 3RU0A 5IQ6A 2R9LA 4DQRA 2W7AA 3IGJA 3F73A 2ZH5A 1Q0NA 4GKJJ 6FD1A 4C8KA 1S1XB 5HSPA 4FCEA 3TR5A 1F9HA 1WG5A 4FBTA 1SH3A 1RZMA 2QE5A 1FWYA 1MROA 3T3FA 3DHWC 1S1UB 2D1CA 2HWIA 3A13A 3E8OA 3M8PB 2CPYA 2W2NP 2DGSA 3OGZA 1LWFB 2DNLA 3PZPA 4DXLA 4C6AA 3OL7A 3JQYA 2MTLA 1N6QA 4F2SA 3DYAA 2UXDJ 1U09A 2HNDB 2L9WA 2DCLA 1FD8A 3GJRB 4TY8B 2VG5B 3TVZA 3GLJA 1VC0A 2DISA 1JMTA 2MQLA 3KLEB 1VBXA 3TX0A 3BXYA 4FDFA 4OMFG 9ATCB 1LK5A 2HGLA 3M32A 3UD3P 3E2EA 1CJTB 4FYXB 1V3ZA 3FDSA 3PW4A 1S9FA 4QYZJ 2CKWA 2FZGB 3IM9A 1WSRA 2N7YA 4O0NA 4CNYA 1AUDA 2J6SA 4EABA 4PWDA 1RB0A 3EVWA 3CIMA 3WC0A 4F0KA 1XC9A 4B17A 1W7WA 2VPWB 3L9ZA 2CQHA 3PCOB 3CJQA 2RQ4A 4TLQA 1LXJA 2J0XA 3DLGB 4RW7A 1VCTA 1S4EA 5F41A 5HJXA 4LFBJ 1MG7A 1SV5B 2NXUA 2V63A 4AXJA 1O51A 3F41A 4DOZA 1JXLA 2OMLA 1WJ9A 2UUAF 3GIRA 1KTQA 3CTRA 5KFMA 3BGRA 1VMBA 5DDPC 2RS2A 5IT9U 3QPIA 1S7IA 1QLNA 1MWQA 3ILJA 2E9TA 2YKQA 2H9ZA 4CT9A 3POTB 4C8OA 1EQ0A 3R3RA 4QIGA 4CLLA 3SV3A 3KNAA 4QWBA 4H4MB 4KJIA 2HHVA 2C3PA 4M2AA 1IR1A 3K8WA 4IOCQ 1T9WA 4KAIA 1YP4A 2V0IA 3H20A 2QEXS 3AJ2A 1S9EB 5AFUU 2B9EA 2B8QA 2IDEA 4F4ZA 1ZS6A 2FVPA 2ZUAA 2VQFF 4UF4A 1NJZA 4JI4F 2J7UA 3ZZPA 1XR7A 1WG4A 2IM3A 2M8HA 4E2FB 4DR5F 5K20B 4I2PB 2DVIA 4J9UE 3PW5A 3MURP 1RWUA 1S76D 2IVFB 2CA9A 2L08A 1FDNA 3EGZA 1EB0A 3QAUA 4OHYA 4CLUA 3MHYA 4IDKA 4USWA 1ELOA 3MAQA 4X65J 3P1BA 1WI6A 2V50A 1RT7B 4YB6A 2XWYA 4DX8H 5DGBA 1PAEX 4ECYA 2DNZA 4LF5J 2WOMA 5K14A 2HQDA 1RKIA 5A2QU 2IYIA 1OSDA 2VFRA 2CNLB 1SUQB 4JI6J 1Z1ZA 1H74A 2H3EB 1OPZA 1TUGB 2WB1D 1RT5A 2LQBA 4RW9B 3UQSA 1MMDA 4P72A 5KFJA 2DRBA 3SCLE 3AD9C 1B0PA 1FK9A 3O2IA 3PFOA 2YKAA 2B4VA 4ECRA 4IH7A 5L9XA 2HVEA 5D3GB 1ZAWA 1H2TZ 4DI6A 5HMWA 4DPTA 5LMUF 4TKTA 4GKKJ 1AW0A 4RU9A 2D9PA 2V5HG 1C1BA 1TMJA 4KIAA 3VAHA 2LU1A 2PC6A 3CJ5A 1OY8A 2FC9A 2LEPA 5KFLA 1UWAA 3A8JA 4X62J 4A48A 4DWIA 1AA1B 3H5SA 2JH3A 4DR1J 2D3O1 2WVEA 3TANA 1FXDA 2Z2LA 5KG4A 1IJEB 2GO9A 3JTOA 4KV8B 1RWMB 2OJ3A 1I1GA 2NCKL 2R2TA 1UW4A 1AZSB 2OSQA 4LVOP 1N4LA 3PVXA 2R7RA 2OTLS 1U26A 3PDNA 1CJVA 4WYWA 3C6TA 3ZTPA 4YY3F 2V4QA 2L48A 1PSDA 4OYOA 5K9FA 1N34F 4DR3F 3PJWA 1X9SA 1JKHA 1FKPA 1GMWD 3HJVA 4K2JA 1CG2A 2CIMA 4DV3F 2E9RX 1SSQA 5CCLA 2OPQB 2V9KA 2YNIB 1EJ7L 4K7QA 2WVDA 1R8PA 4B9TA 4E79A 4LF6F 3HHLA 3M30B 2KFYA 3GU0A 3H2UB 3JQMA 2W4CA 2IU9A 2YWKA 5A2QY 4P6QA 1FNXH 1Q81T 1OWXA 2L9DA 2NXCA 3TUIC 2VG7B 1GT8A 4JI1J 3JB9k 5HI7A 2V4JB 3IAM9 4RW8B 2IDLA 3QO9A 2W01A 1U2FA 4GVBA 5B0AA 3M8ZA 2RUSA 4TNOA 4QWDA 2KG0A 1NK7A 2M8DB 4M9CA 2YKMB 5M2RA 4CLWA 2FHMA 3BQ0A 4DSLA 3Q86A 2RJZA 4JB8B 2G2OA 2W4DA 2BM0A 3VQSA 2OSRA 3QLHB 5KT7A 4RUBA 1Y5NB 1K1SA 3BEGB 4UUXA 1I94F 2ROGA 3FCVA 2KL8A 4LSLA 1RGVA 2BZ2A 4MYTA 5HROA 2A6OA 1RYRA 2I5JB 3IS9B 3N0VA 3FFIB 4LR9A 4DV1J 4IQXA 4OZLA 2VG6B 3G6XA 2HAIA 5K5MA 1VBYA 1MR7A 4QZVB 3TISA 2GVDB 4MTPA 3G6ES 1KGTA 1MLAA 2Y8WA 1BC6A 3WDOA 3CJRA 1RJJA 1Z2LA 4MZUA 2DNMA 1F2HA 4CLSA 1NJXA 1SV5A 2HHXA 3NZ2A 1DURA 4JBCA 4PPDA 5I42A 1TUVA 4RWXA 3DU6A 2AGPA 2HSEB 1FT8A 1S1TA 2O01C 3CW2C 4I64A 3SI8A 2J0WA 3GVDA 2DR6A 3OV7A 1KRRA 5FDLB 3D0GE 3G82B 2F8MA 5AXNA 1BQNA 1KS2A 5DM6Q 4NCBA 1S6QB 3VAFA 3EMTA 2ZM6J 3HSZA 2QJ3A 3CCMS 4J09A 5F8JA 2DHSA 3D9BA 2DY9A 3HSGA 3BR9A 3I0RA 3SDEA 2B51A 5HQ8A 2V68A 3AQPA 2CPXA 2Q4JA 3HMJG 3OUYB 2LMIA 2LQ9A 4ECSA 8RUCA 1ULRA 2OP5A 2OPPA 1JLCA 5E2QA 1SKRA 3PXGa 4QWAA 4IOBA 2HEKA 1QE1A 3BYPA 3UN5A 4W90B 4JV0A 4C8MA 3IM8A 1M8NA 1RTDB 3G6YA 1QDUB 1S6UA 3IWLA 4EMDA 1Q5YA 1XMQF 1U6FA 3CJ4A 3OH3A 3NWGA 3HFKA 4CO0A 3RB4A 2Q1LA 3A1YG 2E9ZA 3MM7A 2YNHA 2CFXA 2W9AA 1VFJA 2MSSA 4RBTA 4PWWA 2J9CA 5AE3A 4WFAQ 2R2SA 2VODA 2CQ1A 2VBWA 5D0RA 1X4AA 1FXRA 2QA1A 2V94A 1C2PA 4AA7A 1S6PA 1UEKA 4FYWB 5KFXA 5E41A 3PR5B 1WDTA 3TNVA 4KH1B 1IKVB 4OYMA 1S49A 3GSIA 1FK9B 3CD7A 4F26A 4JI2F 3KK3B 2XSJA 1U6BA 5GAHU 4XPCA 3UWTA 5B7WA 1RT5B 3HVRA 1TELA 1U1LA 3CCJS 5F3ZA 3Q0AA 4X66J 3T41A 4H4KA 3MECA 3IC1A 2HG4A 4I6YA 3HHLD 3AAWB 4M5LA 3MUVP 4ZVGA 3BBCA 2W0VA 3BV8A 2PIIA 2XLIA 4E98A 4LVNP 1Q16B 4QIVA 5M2PA 1QRFA 4M5HA 3NG8A 1Y4ZB 2BM1A 4K4SA 3AXMA 1K73T 4UOHA 4CH1A 2W1BA 1FFWB 3ICLA 4WXWA 4WE1A 4RNFA 2V8DA 1YRXA 2CQPA 4I6WA 2HFNA 1K8AT 2H5JB 2XS2A 3NMRA 2FJEB 3N28A 2BOPA 3VGVA 5HVHA 4P2SA 5IM0A 1FJGF 4RR5A 1J5OB 1GK8A 1UZDA 1IR2A 3DRPA 4JI1F 5GMKa 2UUBJ 1RHUB 1PO6A 2XMTA 3UVJB 3ZTQA 3GYGA 3FGVA 3HKWA 3IGVA 1C1BB 1U1PA 3P4UB 3UVJA 5F0WA 1DRZA 5DQHA 2R8HA 3FOQA 1P8GA 5HANA 2RDDA 1L0SA 3ILOA 3TA0A 4ZJQA 5KFWA 2OEJA 2DNRA 3W5XA 4DLGA 2D74B 5H9EJ 1KRPA 2P5ZX 4NI2B 2MKSA 5HL7Q 1UKUA 3R3TA 4KHRA 3EGNA 4O44A 4OX9J 3FCHA 4YMEA 3UE2A 4DV2F 3OH1A 2QA4S 2Q43A 4ZDNA 1WC6A 5CZVA 4NLXA 3SYZA 1ZTWA 1SJ3P 1KN6A 4IRCA 2R2RA 4M63A 3OJUA 4WP9A 1FRHA 1PKUA 2VOPA 2YX1A 2RHSB 1QQ0A 3ENVA 4BCAA 3V6DA 3TARA 2IAJB 1KTVA 2YNFB 4PQUB 3DGPA 1A0OB 1OJ4A 2WVCA 3AXKA 3H59A 1RCXB 3AB2B 2PDAA 3QIPB 2IA6A 2ZVIA 2KKHA 4AXIA 5KFSA 4LJMA 4ZITA 3V4IB 2YQ0A 3Q89A 4AL6A 2HNZB 2K3IA 3CCZA 1RT1A 1V9OA 3F1XA 3DOKA 3H5UA 3LQVA 4DV7F 4OYWA 2QMXA 4ANEA 4RKUC 3U1LA 4ZK7M 1RXOB 4QR1A 2XZDB 4KC5A 3GB0A 3B54A 4LF8J 4ANCA 1RAEB 1RWWB 4FPRA 4QIWD 3HPOA 3HF5A 3M9MB 4IUFA 3W9JA 4LF9F 4HZDA 3G4SS 3SCJE 1L3VA 1KVIA 3MMBB 1YK9A 1RI7A 2IAJA 3MTKA 4QPTA 3V4EA 1NDKA 2BA9A 3FBEA 3MEDB 3HM9A 1YJ9S 2UVUA 3MEEB 1OY6A 2M2BA 2HQ3A 1YJUA 2LQJA 2HZAA 2E1RA 4L73A 4WYLA 3U7JA 2XBPA 5AXLA 1RHKB 1EAYC 5DQIA 3J7YU 4C0OC 1DTQA 3CUNA 1X9WA 1RTDA 2DIUA 2XMUA 1NHKL 1GTEA 2VASA 2KTQA 3ZZRA 1U1QA 1YGYA 2ATCB 1KOHA 2OIHA 2GGOA 2HRUA 2N4CA 2K7KA 1QVFR 4OZ5A 4OI6A 2I8EA 3U1MA 4HDHA 4FXDA 5F8IA 2PN6A 2V4JA 1LKZA 3K5PA 3GJQB 4RW8A 1ZAVA 4DFKA 3D98A 2AX1A 3CJSA 3OXFA 4HDGA 4KE5A 3MMBA 4ZJLA 2ZEJA 4PEOA 2HZVA 1T0TV 4ECXA 5KFFA 1SC6A 4ECTA 1XNRJ 2DBBA 1JLGA 2IJNA 4DF4A 3MMAA 3MPWA 4HLBA 3ZZUA 2VF3A 5A8WB 1WC4A 2O66A 5CYQA 5ETMA 2W7PA 2QMWA 4B9MA 1VBZA 4C4WA 4N6BA 3GUEA 1HW9A 1N33F 2KFZA 2N7CA 2PT0A 4O3OA 3SIPB 3BDPA 2CDQA 1MU2A 2HQFA 1UVNA 5C7PA 1D3WA 1M5VC 2MQMA 2JF3A 3P5BP 4XTTA 1V67A 4J9RA 5F8NA 3OH0A 3HJFA 4ZVEA 1T94A 1F9EB 4M5KA 2VOOA 2DNPA 2R42A 4LMZA 2WSCC 1KEKA 3C14B 2IBKA 2KH9A 5JVGQ 2BE2A 3DOMA 1OO0B 2KN4A 3NCRA 2XCAA 1TKDA 1CVJA 2XB2D 4EA7A 5J1NA 1Y11A 1RADB 2AZ3A 3NNCA 4LR8A 2IC3A 2Q6BA 1QREA 2K7JA 4RL1A 4RNOA 4RW6A 3NGKA 2KYZA 1T05B 4M5DA 1S0VA 5A6WA 1JWWA 4K4XA 3ULHA 3P47A 1VK8A 5T7LB 2M9KA 4UW2A 2UXBF 1DARA 1VJQA 4WBFA 3EDQB 2HHHJ 4ISXA 4WK1A 2OLWA 3T6BA 3VGTA 3DHOA 3BGFA 1JNZB 3NGTA 4ZCKA 1OCXA 4YOEA 2QLBB 6AT1B 1FVQA 3C6UB 4NYZA 4NZ6A 1NDLA 1ZAXA 3QT6A 5CHCB 1FWPA 3G8QA 5GADU 3VTIA 3LGHA 2DNGA 3GJSB 3NAHA 1IUJA 1C0TA 3B78A 3D67A 3H7HB 3C19A 2W8LA 1Y3JA 4I7FB 4W98A 4DV4J 2WBMA 5M2UA 2APOA 5KG3A 5J2QB 3DLBA 4NXMJ 2VDHA 3MCSA 4EUVA 1H2UX 3M8WA 4EQYA 5KT5A 5C25B 2YQ3A 3QFHA 3MUMP 2PMWA 1WKKA 2HQGA 2LEAA 2RMLA 4K4WA 1HV9A 3KJFB 3LWMA 1BQMA 2LA4A 2B7BB 4QJVA 4LIRA 2MYFA 4CO4A 1RU2A 4PG5A 3HVAA 1LV5A 3EXYA 3VBNA 1OYEA 4MKBA 4I4BA 4Q7AA 5JMNA 4E6TA 3K8VA 3W9IA 1TK0A 1HARA 3TZWA 2NZCA 1HIYA 2XG8A 1Z2FA 2OFGX 1BMQB 3I9ZA 3SRTA 3KLIB 4MYUA 4EYHB 1TL4A 2VFVA 3MM6A 1NK8A 4AUKA 1J2VA 1TL1B 3H2LA 1REVA 3O3LA 5KFIA 5FLXY 4ZP6A 3KTQA 4I6AA 3SXLA 2XLKA 4IH6A 3HZGA 4LUBA 2YNHB 2IRYA 2NPIA 4DR4F 3VAGA 1HQUA 2C3MA 4Y0FA 3QRQA 1KRUA 1HWUA 2MKHA 5HROB 2VHGA 1K0VA 1MN9A 3JSBA 1V5VA 2IMOA 4DSEA 1SH2A 1RWVB 2DNKA 2DR8A 3CSKA 3PG9A 4DL4A 1R8AA 1WHWA 2RD5C 3MM9A 1LXNA 4CLKA 2FJWA 3PACA 4C11A 3C8VA 1UW9A 2GQQA 4GVBB 1PILA 3D7SB 2X3GA 3T9NA 2DGXA 3BREA 2PSZA 2FVQA 1YP2A 2PA3A 4A8SA 4W92B 1VRUB 4DPUA 1WHYA 5F9NA 5BYQA 2G13A 3EICA 5BJRA 1UVKA 5F8LA 3JYTA 3GIJA 1X5SA 3Q2SC 3HHLB 4DCOB 1BLUA 3BS9A 2YWEA 3EZOA 2W24A 2MJNA 2VPXB 5IT0A 2CJXB 3CCES 1SBRA 2J0SD 2NPFA 1KNZA 4LT6A 2D3ZA 5CXTA 4DQSA 3MM5A 1LWXA 1N0UA 4EGLA 4L74A 2FLLA 3CCWA 5LXYA 2M70A 3G9CA 2GS8A 3W7BA 4IHFA 4F25A 2GCFA 4TY9A 1VLYA 3Q8PB 3GZ7A 5ETSA 1LWEA 3EVMA 3PNIA 1DAXA 4MJKA 5LSLA 1FRKA 3M9OB 2ZE2B 3DHXA 3DNCA 3E51A 1HNXJ 4C98A 1WC5A 4C3KA 4F2RA 4DL6A 3HD2A 3PX4A 4M99A 2R3VA 1OS5A 2MZRA 1EZZB 3DGVA 3C16B 1YJWS 4NXNF 2HHWA 2C2RA 3RW6A 1IWAA 1YZ6A 2IY5B 1E6YA 1K44A 1D9FA 3MM5B 2R8IA 2HFSA 3N6LA 2EVZA 1RT6B 3IBFB 1N5YB 4DV6F 3EPGA 3THTA 4Y2AA 2EXUA 1CJKB 5KFZA 1J27A 1T9VA 3UDEA 5KFKA 4BDPA 2ZNYA 4ECQA 5H9FK 2CPDA 2Q79A 4TN2A 1CC8A 3OH4A 3QJPA 2DJWA 2CQBA 4OHXA 1R43A 2OELA 7FDRA 4NLGA 4K50A 1SJ1A 4JV2A 2J9DA 2RQCA 1HNZF 4DU8A 1JLEA 5ETNA 3ZO7A 3BO3A 3IR6B 4LBHA 4C2MA 2MKJA 2BBEA 4YDXA 2I6WA 3CCSS 5B0DA 1RT7A 3GFHA 1TR0A 1C0UB 2QL5B 4AQYF 1S72S 1IBMF 1QAIA 2VD4A 2OD6A 2AEFA 1S0NA 2H48B 4NYOA 5KFBA 4P2FA 4O0IA 2HK2A 2VC1A 2XMMA 3KWCA 1CULB 2DEIA 3AOCA 2NREA 3GJTB 2VPZB 3HCXA 3M7VA 4OQJA 2CNKB 3WX8A 2DK2A 3O5TB 4CT8A 4LF4J 3KK3A 1NRKA 3W65A 1Z4UA 2ZHAA 1RUSA 1S1VA 4KYZA 3GPAA 4OJ1A 5L8RC 3R0SA 5D4LA 3E3XA 5AJ3J 3ZZZA 4DUZF 4R7PA 4GC7A 1ZETA 3FTTA 5I3QA 5KG1A 2XY7A 4ILLA 2V67A 3TJ8A 3BRKX 1X4EA 2B43A 4QU6A 3J7A1 2WLGA 3CEDA 4ZVTB 1X4HA 4IO1A 5KTQA 1KFDA 2KHDA 3R7NB 2CQGA 1WACA 2GZOA 4WWSA 5K8MA 4OYZA 4W4MA 3KWDA 4KNXA 1HA1A 2C2KB 4LRFA 2GHPA 4C8LA 2GQ2A 4WZMA 1HFEL 2GIFA 3AB4B 1JLCB 2CQDA 2YX7A 2ZVSA 3A3OB 1PJ6A 5LSRA 2UU9F 1YX2A 2IYGA 4MFBB 4DR3J 1KK6A 1KHWA 2HFUA 2RU9A 4OX7A 3CXCR 4K5RA 1AYEA 4IR9A 5D6GA 5ETPA 4EYIB 1RWXB 2N82B 3QBCA 2CDRB 4N8OA 3KXDA 5KT6A 2WSFC 3OVBA 1G1XA 1HYSA 3NBPB 2YQ1A 2VZ9A 2QSFA 1Q86T 4F3MA 5J2PB 3AJDA 2XNRA 3TEGA 3T1HF 2F7VA 1WOSA 1CS4A 5B09A 3BO2A 2XMKA 1F6TA 2AT1B 3FK4A 2ZBPA 4ELUA 3KK2B 2UVRA 4Q0BA 1HQEA 2DTJA 2JC0A 3C3LA 2E1AA 1OSCA 2K8GA 2PEHA 1HQ2A 1UJ5A 1X4GA 3HD1A 2MHNA 4K2XA 4C11B 4DQQA 1NSKL 3LP1B 4ED0A 4B3TJ 2P9CA 2RF2B 2QMUB 1RAJA 2J7WA 3I5CA 3MZIA 4PQAA 4UUWA 9RUBA 2ZH1A 3BB5A 4DFJA 3FJ2A 3FKBA 3G96A 4M94A 3BSSA 4FVCA 4JYAF 1VQLS 1KSPA 1PYTA 3R5DA 4FF4A 4KGMA 4UT4A 1X5OA 3Q22A 1PG5B 2F40A 5J2MA 1FA0A 1HQUB 1YTYA 4CDIA 5DG3A 3I0SA 2CJYB 4NLOA 1B70B 4LSZB 5B0FA 3TW0A 3JSMA 3E01B 2OEFA 3OSNA 3CE8A 4CO5A 2AYGA 1EIYB 3VQTA 1OQ3A 3KUHA 4WTOB 1SJQA 2P2OA 1VI7A 1VQSA 4OYXA 3IR5B 3HK2A 3GG1A 3IO1A 4B3TF 8AT1B 2YWHA 3BDEA 2HHQA 3IAS9 2GO8A 4X84A 2VC0A 4USJC 2ASYA 1WOPA 4HHJA 4PG7A 4KHMA 4LBPA 1NKEA 3O1LA 2LU2A 2KU7A 2OPQA 2YNIA 2JLGA 1EARA 5KAKA 1RHQB 2C2ZB 1IBKF 3CD0A 3N5FA 3NNAA 2RQMA 1FKPB 1OIAA 3JQJA 2BEFA 2HFVA 5LT5A 2B3TB 2ZBQA 3D5MA 3VVTA 1C4AA 1S77D 4HI2A 4D3GA 3W9HA 4HURA 3PY8A 4OIXA 3IRWP 4PXBA 4USHA 3FS8A 1V3RA 2KXFA 3VGUA 3RG6A 3EYZA 2VBYA 4KTQA 1FFGB 2BJ1A 1N6QB 2IC7A 2HVZA 2V69A 4PG6A 5DZ7A 1G2EA 2BX6A 1AROP 3MPYA 4X66F 2KG1A 1H7WA 3QZ8A 1Y10A 1RBLA 1DTQB 1H6KX 2ZOMA 4Y2CA 2VQEJ 2QIFA 2R4FA 4FS1A 1N36F 4HUSA 1TKZB 4J9MA 1X0FA 4LFBF 3MOZA 1LNQA 1S1XA 2MDAA 4Y2KA 1HBMB 1CBKA 1RBAA 3GMGA 3UCGA 3WZ0A 2W2OP 3HVWA 3X1LB 4O4GB 1LW0B 1UJ4A 2MZTA 1P9QC 4GO7X 4ETZA 5CZXA 1KLNA 1XHDA 2JVOA 3IGNA 2PEBA 4N27A 2NLWA 3WHIA 2QC3A 4M95A 3ENAA 1U2RA 3DRRB 4MKYA 3D6TB 5D0EA 3F0NA 1M5SA 2EG1A 4LRDA 4XPEA 2MXYA 4KHPF 1ITPA 2A10A 2XM3A 4NCAA 2FYXA 4ES2A 3C14A 1N4IA 2DRDA 3KLHB 5CYJA 3T57A 1JLFB 2B4UA 2FC8A 1U25A 1LWCB 2ZBIA 2DKOB 1YG0A 3TAMB 4ID5B 4HH0A 3UN3A 1F3VA 2J8SA 4B9VA 1JLEB 4R25A 1Z2ZA 3TO8A 4AAWA 1CSJA 2CPZA 2DNQA 2QSWA 4K59A 4DX7A 5C25A 3WC2A 1A9NB 1VQ4S 4ZVHA 2PO4A 1HBUA 1F3FA 1V6HA 2ILYA 2MEWA 4ZS6A 1K9MT 2RVJA 2DGUA 4O44B 3GONA 3TAQA 4HYKA 1R8CA 2B5JA 2GNKA 2POKA 4FYDA 2WBRA 3CVKA 3GSDA 3EDRB 2VPYB 1Q8LA 4Y3CA 4CNZA 3LUYA 1N36J 3NMAA 4HT7A 1U0HB 1S99A 3VAJA 4B3RJ 3W8GA 1L5UA 1A6LA 1S48A 2RILA 5DGAA 4FF1A 3R2WA 2BJ9A 3G86A 4AD6A 1VQ5S 2FVSA 3N4WA 3ZC4A 1EETB 4N47A 5D3GA 3M2RB 3WBZA 1UAWA 4DX5A 2W7OA 3IR7B 4ZPCA 3K5MA 1RYSA 2BKPA 4DL2A 1VC6A 4ZPTR 3FEXB 3VBLA 1R0AB 2LECA 2NXNA 3DM2A 2CPIA 1NHVA 4ZVSB 1GX6A 4O4RA 5LOQA 1SC3B 1Q82T 2HHSA 1VDHA 3OUPA 3OR1A 4I1TA 4RW4A 1X5PA 2D41A 3J80Y 4HH1A 2AGQA 4Q8FA 4YQWA 3TAMA 2EEYA 5BYRA 3EX7B 1N52B 5MAOA 3OL8A 4X64J 4H4OA 4BWMA 1EQMA 2YKPA 3Q8UA 2HGNA 2AJ2A 4M5MA 2ASDA 2UVVA 2VL1A 1MU2B 1FEEA 3KG1A 3VBJA 2DGTA 4LRAA 1D0EA 2OGUA 3BN7A 2CJ9A 2MQOA 5LMNF 2NR0A 1XEZA 2ZJRQ 2FHOB 2CYYA 3D54A 3QRPA 4R5PB 2CG8A 1RTIB 1UVIA 2X1AA 1UWBB 3GFYA 3KG0A 3FBFA 1S9EA 1U8WA 3E01A 2JX2A 1KK5A 1WORA 4HTJA 5T14A 2YPYA 4JOUA 4DX6A 1T3NA 3W5ZA 4U9RA 3ZZYA 2DYAA 4CWBA 3GCXP 5AT1B 3D4JA 2EPIA 2MLZA 4QW9A 1IKWA 2KT3A 2FVRA 1X7VA 2RQKA 2NUHA 5K8PA 5KFDA 4IG3A 2QYCA 3R9LA 1O0PA 3OFHA 3B6BA 5GAEI 4AT1B 2AQ4A 2BJ8A 3OFFA 3QNWB 3G87A 3H90A 3PYGA 4RWWA 5ETOA 4DSKA 3B4MA 1T9TA 3CDBA 2XGQA 3Q2TC 1BWEA 1Y3KA 3IA0A 2XCPA 1UWBA 1WD6A 1KBRA 1IR0A 2DY1A 4RJVA 2RRNA 4WKYA 1YZ7A 4X62F 1NZ8A 5THWA 3BO4A 1HQEB 2YH1A 3NEKA 3TWZA 2HFOA 1CLFA 2WZ1A 2UP1A 1ZTTA 4F4KA 1VISA 1T7PA 3SDEB 2DXEA 4P73A 3I3AA 3CJ3A 3ISNC 4QQBA 2BVZA 4YHHJ 2F8EX 4PKDB 4H4OB 4LR7A 3AOBA 4ED1A 3VCDA 3SFUA 2MMYA 2RH3A 3PJ9A 3RGIA 1S9GA 3R5AA 4URSA 2BQUA 1PJ5A 3BBFA 3T5LA 1VRUA 1HNIB 3NGSA 1PYOB 1UCNA 1HWKA 2DGVA 3DRXA 2QKXA 1YBTA 2M0GB 3LW5C 2LXIA 5KFUA 3MUTP 1MMNA 1LOUA 1SSTA 3C15A 2OEGA 3ISZA 3MEGB 1KWMA 4KBIA 4BLGA 4E75A 4JI7J 3GQ7A 3MPUB 5BR8F 1UJ6A 4A4JA 2ZH2A 3OPKA 2Q6CA 1LWFA 3HSJA 5D4OA 3NRBA 3KJVA 4Q8EA 4XO0A 2JEGA 4NA3A 4DUZJ 2DO0A 3CDUA 2ZZNA 3DLEA 3H8YA 1SH0A 3MDFA 1PBUA 5JJBA 1IKVA 1QAXA 3MM8A 1G7CB 4QR0A 3FQKA 4RBUA 3VGSA 3ILIA 4CM0A 3TP2A 2HNYA 3FQLA 4USVA 1WG1A 5KFRA 3OLBA 2XULA 2BW2A 4DPOA 8ATCB 3W2WA 4OI4A 1FWKA 2A6MA 4NLWA 4U8YA 3M8SA 4G1QA 4ED4A 5T7LA 5RUBA 2HMIB 3H5XA 2XO6A 1XBWA 4K0KF 2DHGA 4DUTA 3S7RA 1X9MA 3FBBA 4LSNB 4JI8J 3QJJA 2VIHA 4LBIA 4ZCMA 2DXDA 2F8HA 1WUUA 3GWCA 4DR2F 2J7KA 3CPWR 3BN4A 1VYAA 1DQAA 2JLFA 4A8OA 1FDBA 3R1LA 1CC7A 1TUWA 1RT4A 1HNZJ 1N0VC 3BSYA 4GC6A 2HRTA 4J9VA 1KVJA 1R7IA 3IXCA 2IBOA 3PFEA 3TV0A 1W2IA 2BE7D 2KYXA 3OR1B 1NJIT 3CMES 3CCTA 4L3NA 1TTHB 3CNQP 1ZM4A 2CPFA 2CAJA 4R8UA 3SEOA 1NJWA 1IM6A 2HQIA 2RE1A 3OHAA 4KR0B 3AY0A 1U48A 4MAKA 4DHVA 3VWSA 4M8LA 1EKSA 4DV6J 4ECVA 4EEYA 5J2QA 2GAGC 1F60B 1APSA 1DY3A 1FRMA 3BYRA 5CQGA 1ZA2B 1H72C 3V6KA 4ED2A 1VC5A 5BXIA 3AODA 1R3NA 3KLVA 2CNOB 1B64A 3F44A 2WLDA 1D8ZA 1DQ9A 3I82A 3OFEA 4HTIA 1T02A 5A8RA 4IR1A 3BGOP 3HVTA 5DG8A 3DRSB 4WFYA 3NKYA 1KQAA 3C6UA 3CT9A 4DL7A 2W9BA 3CJ0A 1TKXB 3MD1A 1M5OC 2WSEC 2KRRA 1TKZA 2UZAA 1B0VA 1UP1A 2V2VA 3HHDA 4DG1B 3GIKA 3UCZP 3SQGB 4C9DA 4EZ9A 3DFEA 1FKAF 1VQNS 1AT1B 4N56A 3BGRB 3R3IA 1FESA 1OMSA 1KOOA 3QMQA 4A46A 3MMJA 4V19X 1Y0HA 3V81B 1UMJA 2ZDPA 2HZCA 5J2MB 5T41A 4OJGA 3QRRA 1Q8BA 5CYMB 3RBDA 3CCRS 4ZPWR 4ALZA 1P6TA 5DEMA 1TMMA 2M88A 3OHBA 4PG4A 3TIOA 4AC3A 3CDEA 4DL3A 3V6HA 3RTVA 2GVZA 4ZP7A 1TL7A 3LP2A 1S0OA 2CQ0A 3DOLA 4L6V3 1KKHA 3DK5A 1VHIA 2I0XA 3GE9A 4J9LA 1FTRA 3K17A 4ID8A 4CZCA 4IOAQ 3BH7B 2QLWA 3M8RA 4NZ0A 4NRTA 3MCMA 5CD4H 1VOMA 3DC2A 3MMCB 4ANDA 4IO9Q 3KHHA 4G1PA 2FZKB 2OFHX 3EM1A 3OTMA 2GMJA 2ACYA 3AFGA 3M05A 2OEKA 1I3OB 2B4PA 3US5A 3KJNB 1UZHA 1Q4RA 2FKOA 3PM9A 3IP0A 4A8YA 2EI5A 4DSFA 1H7XA 3UCUP 4KQZA 4ZN3A 3HJJA 2BJEA 1N56A 4QU7A 1UFWA 2OPRA 5J1EB 2HAFA 3M8PA 5KOXA 3BSOA 2Y1IA 4J18A 2UVWA 1MROB 1KQGB 2MQ8A 4JYAJ 1FERA 3LGNA 3UDCA 4DV0F 4M98A 3LP1A 1NUEA 2ROPA 1EETA 4TU8A 1WSVA 2NQPA 3BKFA 3P5TL 4K4ZA 2Z0GA 4YB7A 4ED7A 3P96A 2Y0SD 3QGPA 3C46A 4J9KA 1V5IB 2VV5A 4P7TA 4DR6J 4XDCA 3W2VA 1WNEA 3T5KA 2E7XA 4UQTA 3Q8SB 5HLFB 2MLYA 2QFIA 4B3OB 2AYBA 3R2DJ 2B0GA 2HIYA 1SIWB 4PWDB 1PCAA 4EO6A 3W61A 4FXWA 1VRQC 2V0HA 4KT0C 2PFFB 2KDOA 4EWTA 4ZPVR 4OI2A 1FHTA 4CYUB 2DNOA 2X1BA 4PZVA 4M5GA 5A8KA 2JVRA 1UTAA 1O8BA 2C2EA 1M5HA 2LXFA 3OH2A 1VR6A 2OEMA 2YKNB 4X4OA 4B3RF 4LFCF 2RHQB 1FRIA 4P10A 4ID5A 2R7SA 1UL3A 3TA1A 1J5EJ 2VFUA 3PW0A 4K4TA 2LXUA 3R1HA 3L7UA 2ZD1B 2FHJD 2B56A 3FFIA 2MZ1A 4HHHA 2B7CB 3PW2A 2W4PA 5ITHA 4N76A 4NEZA 3J7AN 2YH0A 4P52A 2I2YA 2OPSB 3L7PA 4C3MA 4WZQA 2GGQA 1AZSA 1N5SA 1U4BA 1G3OA 2XI3A 3N9UC 4OZ3A 2P8IA 1JX4A 2DGOA 2QYGA 5AJ3F 4DS4A 2NXJA 4HACA 1WC3A 5KG2A 3W2WB 1GEHA 1R6YA 4KQLA 3JSRA 3OR2A 3AOAA 4F4YA 4M28A 2JDJA 2E44A 1UA0A 4IQMA 4M5DB 1DZ5A 2DD8S 3CWJA 1T05A 1U1MA 3P8BB 2K1RA 3KG4A 4HVZA 3GOSA 1NBEB 3M30A 3OL9A 4Q2LA 4ILRA 4OZ1A 2YWGA 3PHEA 5ETRA 2DH8A 2VUGA 4X4RA 2QA2A 4PCQA 1TP7A 3ENWA 4P75A 3R6LB 1T9YA 2HBQB 4KO0B 1YQHA 3CD5A 3V2UC 2HFZA 2QTWA 3TX8A 3CC4S 4F04B 5CH7B 4MIWA 4N8NA 1F9FA 3BPSP 1H73A 2I9SA 1EX8A 1LWCA 2K06A 3BF4A 3TVYA 4EFAC 3ETOA 3RR8A 2KI2A 1S6QA 3FSYA 2V2ZA 3MECB 2E5HA 3KMQA 3MCOA 4OI0A 3IWNC 3MI7X 5ADXU 2CQCA 3GQ9A 4IDKB 1CJTA 3ZNJ1 2BXJA 1RU1A 2Y3YA 1R31A 4TU9A 3U02A 2FGOA 1JJ4A 1KFSA 3K89A 4OZ0A 4OHVA 4NCGA 1UVMA 4ZIVA 3D3CJ 3VF0B 4G3IA 1B0TA 4NXNJ 4YP3A 1FDDA 2HBYB 3HKZD 2MQNA 1ZOTA 5EX3A 4WJBA 1EWWA 1IKYB 1LEOA 1Q8IA 3TZYA 4X4VA 1FKOA 1N5VA 5IZHA 1IBKJ 4L3KA 2EG2A 3VR1A 5G0RB 1LQ9A 2MGZA 3AA9A 2CJQA 2BQ3A 1IBCB 5I4MA 2I1RA 3OTOJ 3TRGA 2E66A 5IOLA 3HO1A 1SI9A 3VZHA 1RTJA 4FYVB 1C0UA 1EKRA 3TEHB 3TYTA 2UUTA 1WEYA 2MKCA 1VQKS 4DUYJ 1U6ZA 3GYNA 2E5LJ 5E3CA 2X3DA 4I69A 5A0YB 2UV8A 1EP4A 1HBOB 3VBKA 4FPIA 5L9NA 4RW7B 2ZC4A 3UPFA 3OW5A 1RHJB 2JZ5A 3A8IA 1U1KA 1U24A 3DLKA 1HD1A 4GRSA 1SVDA 2C1EB 2C22A 3OJSA 2VA2A 4PUOA 3W66A 4U95A 3L3CA 1AFIA 1XR5A 2BRLA 1AXQA 5GAHI 4DV0J 2BW7A 4GMKA 5HVFA 3ECTA 3QIDA 4DJBA 3LPEA 3NBPA 4DPWA 4U96A 4AL7A 3MCNA 1HBNA 4F4XA 3AH6A 2VBXA 1B4SA 1J2ZA 4MT1A 1IN0A 2R7WA 3TAPA 5KFYA 4R0EA 5SZTA 1GAOA 3RUBL 1XERA 2XATA 1B7FA 2HRYA 3PX6A 1U1RA 4TVAB 3C16A 2VDIA 2JC1A 2YY3A 2GIQA 3QT8A 3T1YJ 1WHVA 1R0AA 1VQ8S 2YWFA 1HR0J 4B9NA 4B9LA 5IFMA 4DUYF 1HHTP 3R6GB 1XNQJ 1BQXA 2ZJPQ 3TDTA 2VG6A 5IC6B 4IHGA 5FD1A 2E29A 2WW4A 4JV5J 3SQGA 3RBEA 1NB7A 4PXDA 1FNMA 2HYIB 3RYLA 4DCJB 3NS7B 1R0BG 3MR2A 2HWTA 5E3PA 1IKWB 2G0IA 2O67A 2WK4A 1W26A 4G1IA 4RBVA 2QL9B 2YTCA 4CLFA 4J90A 3UNYA 3CJKA 2E5GA 2MQPA 4HI1A 4JI5J 1LXAA 4RO0A 3I4HX 3HSQA 2V8GA 1N88A 2LQ5A 2VH7A 3BBBA 4RZRA 4WFXA 1Q7YT 1JJ2R 3J7YI 4R5PA 3SCKE 3TQEA 2A2DA 4NMXA 3JYTB 2NUUG 1LK7A 3J81j 2XY5A 1ICEB 4V19J 1JLQB 2DPIA 3MAAA 4J5OA 4ZP8A 1NDPA 4L76A 4ELVA 2G1DA 3AHPA 3QAEA 2R8JA 1E6VB 1FE4A 1S1WB 3BGUA 1MR9A 4NXMF 3GYXB 2AJ4A 3M2UB 4EO8A 4LQ3A 2HNDA 4DZDA 3M2UA 4NEYA 3ZNUA 3CC2S 4Z7CA 2DR9A 3P6YC 1RE1B 1SIZA 2O3DA 5JXSA 5CCMA 2CQ4A 2EC2A 2I38A 4G6VB 3CGIA 2R7TA 3P49B 4DQPA 4Q5VA 2QFJA 4ZKAA 3EGVA 3M6XA 1FI4A 1GMUA 3K57A 4OHWA 3K5NA 3CJ2A 4C7QA 1U02A 2CXEA 4OV1A 4OYPA 5D15A 1IBMJ 4EZ6A 2H1YA 3OVSA 2FD2A 5EWFA 2R7QA 1Q1KA 3H42A 2CRLA 4Q43A 3D0IE 1T95A 1RK8A 2B8PA 3MM8B 4K8RA 2YXLA 3TOQA 2H65B 2XYPB 3BR8A 3DLEB 4KGZB 4X4PA 4KFBB 3FZ2A 4ZA1A 2M7SA 5MLCV 1QY7A 5I3UB 3TI0A 3VZIA 4RNHA 4IRDA 4ED3A 4HZCA 2SXLA 1MW7A 3LOUA 4OJHA 3VVUA 2JEFA 2HHTA 1FX2A 1NMEB 2J8AA 1CJUB 2VFSA 5J2NB 2CJBA 2ASLA 2ERRA 5D0GA 1ZM9A 4KH0B 4A8KA 2AIRB 2X1FA 2ZM6F 4Q44A 4ICLB 3G2XA 3LAMA 4DFMA 4K0KJ 4OL8A 2ZITA 4NLRA 2GGPA 4A8FA 2EK6A 3HSDA 1TAUA 3HLUA 4ZCLA 4MH8A 4UQGA 1B3TA 2J6UA 4NRUA 5L46A 1JLFA 2DGQA 2KJWA 4KKOB 5CYQB 3MMAB 4LFCJ 2H5IB 3QFWA 2CVEA 1SC4B 1HM0A 4MYOA 2YNGB 1DLOA 4DV5F 2IPOB 2K1RB 1SJ4P 1WKLA 1NEEA 3FMBA 2KT2A 2BMBA 2WRMA 4KGKA 3RW7A 3BKUA 3M32B 2EKYA 4LSNA 3ZTSA 1VQMS 4CO3A 4MIBA 5K8OA 2FJBB 3PMOA 5E7OB 2LP4A 5GAGI 4QWCA 4URQU 2LEBA 1V3WA 1GQEA 1O5JA 3WQPA 5EWEA 1TV6A 3R2CJ 3KUEA 1RWKB 4AYBD 4DV1F 1L3TA 1NSQA 1YJVA 2XZWA 1HM8A 1MRLA 2PGCA 2WVBA 2HIQA 4Y65A 5KFGA 4J9SA 1P1LA 4DR6F 5IQQA 1ZM3A 4J9NA 2HW3A 5AE1A 4D3HA 3T6JA 3GQ8A 4KPZA 3QATA 3JQKA 4I68A 5LJ3Y 4O3QA 5DG9A 4MK8A 2UXCJ 5EGYA 5DLGA 3UR3C 1YITS 2FIUA 3M6WA 4O3SA 4MKAA 2CWXA 5KOWA 4CLZA 1ACMB 2BJDA 3ZFVA 3SSQA 1WC1A 4Z7YA 3DLJA 1TKTB 4IG0B 4M5NA 5KG6A 2MY8A 5EDWA 5E3RA 1XN9A 2R2UA 2CPJA 4A8QA 2VA3A 3H2VE 2DHXA 2PMZD 1UPMB 2G2YA 1XNQF 2A3JA 1HNIA 1F5CA 3IWXA 1WEXA 2B9YA 2DNYA 2LLZA 2XHWA 4N6AA 4UOCA 4MIAA 2V8VA 1Q7LB 2IM1A 2M5YA 2XYGB 2RU3A 1FRLA 3T1YF 5A8RB 2KXHA 4DV3J 2IM0A 4DV7J 1S5ZA 2FHKA 4BBYA 2NZ4A 4U8VA 1N34J 1T3OA 2KM8C 4DS5A 2C2MB 5CAAA 5EWGA 1DJ0A 1X4BA 3B82A 2XS7A 1IQTA 5GAEU 1YHQS 1TQLA 3L95X 4MKVA 2D7SA 2QT7A 4H4KC 3I55S 3CDWA 2IJRA 4FNHA 4ITSA 4QOTA 1JXEA 1U45A 4ENOA 2DPJA 3QZ7A 1S80A 5DJBA 5A6PA 4E0DA 3OTDA 1C1CA 1F2GA 4DR1F 2C3OA 2AEMA 4OX6A 3H4BA 1HI8A 1X5TA 1I5OB 2AWZA 4DMZA 5EN1A 3I0SB 1ZH5A 4QYRA 1KGQA 3M4XA 3FSXA 1RAHB 1YRUA 3NCQA 4USTA 3U1NA 2N3OA 1IXKA 1UFKA 5KG7A 5LMNJ 3HHEA 3GV5B 4USIA 2FY1A 2QIVX 1KONA 1XK8A 2OPRB 5J1EA 2MKKA 4OZNA 2E5IA 2ADBA 5G0RA 2GJFA 2MGZB 5D0HA 1KD1T 4NZ7A 5KFHA 2QLJB 3RBXA 3OTOF
chains in the Genus database with same CATH topology
3I3XA 1Z90A 4K6RA 2OEFA 2W0WA 3HHDA 3DJ4A 4IHFA 3FSCA 3EG4A 5DEPA 2P2OA 1QRMA 4AA7A 3R3IA 2JF3A 5E3QA 2H1YA 2C2NA 1V67A 4M99A 2IUAA 2OI7A 4G3SA 1KK5A 4KNRA 1T3DA 3FSYA 2G1HA 3H0PA 5DEMA 2WLCA 5ADXU 1YP3A 3TIOA 4AC3A 4EA7A 2W0VA 3BV8A 5DZ6A 4RL1A 1QREA 4HZCA 5F42A 2I5KA 3PTWA 1QRFA 3K89A 3DK5A 3G87A 1XATA 4G87A 2JFKA 3P47A 4HURA 3MC4A 3FS8A 3FWWA 4ISXA 3TZYA 3R97A 3DHOA 3BFPA 3IGJA 2IC7A 1OCXA 5DZ7A 4E6UA 3OTZA 4FCEA 2NPOA 3OTMA 3BSWA 3D8VA 2WLEA 4H7OA 3HJVA 4RR5A 1FWYA 2FKOA 3I3AA 1SSQA 4HUSA 5ADXV 4G3QA 3VBMA 2CUYA 3HJJA 2JFDA 2VD4A 4E79A 2OI5A 1HM0A 3JQYA 4MYOA 3FOQA 1QRLA 3RGIA 3KWCA 1KHRA 2TDTA 4J18A 2IU9A 2P5ZX 3R5AA 1XHDA 3SBMA 2RIJA 4EQYA 3PMOA 3VBKA 4N27A 4R36A 1V3WA 2QKXA 3BXYA 4M98A 3OW5A 1HV9A 2VHEA 4R37A 2QC3A 1SSTA 2OEGA 4M9CA 1THJA 3R0SA 3TK8A 1HM8A 1MRLA 4MFGA 4E75A 4R7PA 1TDTA 3TZZA 3VBNA 3FTTA 2G2OA 4E6TA 3IM9A 1QQ0A 3BRKX 4EABA 3ECTA 3MQHA 4KPZA 2WLGA 3T57A 3QATA 3TWDA 4EAAA 3VBPA 3TZWA 1HM9A 1J2ZA 4N69A 3FSBA 3SRTA 3MQGA 4DCLA 5L6VA 2G2ZA 2XATA 2IU8A 3KWDA 4KNXA 5AFUV 4AAWA 3F1XA 2V0HA 1MR7A 3TISA 3R1WA 3R5BA 1KGTA 2V0KA 1MLAA 1QRGA 3SPTA 5E3RA 4MZUA 1KK6A 5U2KA 3NZ2A 2G2YA 3TDTA 1G97A 4IHGA 3EH0A 4M2BA 4N6AA 3KWEA 2ICYA 1KRUA 2AQ9A 4HZDA 3R3RA 5L6SA 1NM2A 3GVDA 1KRVA 3R5CA 1KRRA 5E3PA 4QBUA 2OI6A 2QIAA 3V4EA 1SSMA 3OU9A 4M2AA 4IHHA 3BSYA 3Q1XA 4EA8A 1YP4A 2V0IA 3R2WA 4J09A 2QJ3A 1LXAA 3IXCA 5AFUU 3HSQA 1KK4A 3TV0A 4HCQA 2GGQA 3C8VA 3EEVA 1FXJA 2Q4JA 3TQEA 2V0LA 1YP2A 2JF2A 1S80A 4E1KA 3VBLA 2GGOA 4EA9A 3TZXA 3ST8A 4KQLA 2WLFA 4KPXA 4M28A 3P1BA 1KGQA 3EZOA 3FSXA 3OUPA 3D98A 3BSSA 4G3PA 3IM8A 1MR9A 2WLDA 1G95A 3R5DA 3R8YA 4EGGA 2V0JA 3GOSA 2QIVX 3CJ8A 1KQAA 5DG3A 3VNPA 3VBIA 2ICXA 4N6BA 3GUEA 3VBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3X A;  1Z90 A;  4K6R A;  2OEF A;  2W0W A;  3HHD A;  3DJ4 A;  4IHF A;  3FSC A;  3EG4 A;  5DEP A;  2P2O A;  1QRM A;  4AA7 A;  3R3I A;  2JF3 A;  5E3Q A;  2H1Y A;  2C2N A;  1V67 A;  4M99 A;  2IUA A;  2OI7 A;  4G3S A;  1KK5 A;  4KNR A;  1T3D A;  3FSY A;  2G1H A;  3H0P A;  5DEM A;  2WLC A;  5ADX U;  1YP3 A;  3TIO A;  4AC3 A;  4EA7 A;  2W0V A;  3BV8 A;  5DZ6 A;  4RL1 A;  1QRE A;  4HZC A;  5F42 A;  2I5K A;  3PTW A;  1QRF A;  3K89 A;  3DK5 A;  3G87 A;  1XAT A;  4G87 A;  2JFK A;  3P47 A;  4HUR A;  3MC4 A;  3FS8 A;  3FWW A;  4ISX A;  3TZY A;  3R97 A;  3DHO A;  3BFP A;  3IGJ A;  2IC7 A;  1OCX A;  5DZ7 A;  4E6U A;  3OTZ A;  4FCE A;  2NPO A;  3OTM A;  3BSW A;  3D8V A;  2WLE A;  4H7O A;  3HJV A;  4RR5 A;  1FWY A;  2FKO A;  3I3A A;  1SSQ A;  4HUS A;  5ADX V;  4G3Q A;  3VBM A;  2CUY A;  3HJJ A;  2JFD A;  2VD4 A;  4E79 A;  2OI5 A;  1HM0 A;  3JQY A;  4MYO A;  3FOQ A;  1QRL A;  3RGI A;  3KWC A;  1KHR A;  2TDT A;  4J18 A;  2IU9 A;  2P5Z X;  3R5A A;  1XHD A;  3SBM A;  2RIJ A;  4EQY A;  3PMO A;  3VBK A;  4N27 A;  4R36 A;  1V3W A;  2QKX A;  3BXY A;  4M98 A;  3OW5 A;  1HV9 A;  2VHE A;  4R37 A;  2QC3 A;  1SST A;  2OEG A;  4M9C A;  1THJ A;  3R0S A;  3TK8 A;  1HM8 A;  1MRL A;  4MFG A;  4E75 A;  4R7P A;  1TDT A;  3TZZ A;  3VBN A;  3FTT A;  2G2O A;  4E6T A;  3IM9 A;  1QQ0 A;  3BRK X;  4EAB A;  3ECT A;  3MQH A;  4KPZ A;  2WLG A;  3T57 A;  3QAT A;  3TWD A;  4EAA A;  3VBP A;  3TZW A;  1HM9 A;  1J2Z A;  4N69 A;  3FSB A;  3SRT A;  3MQG A;  4DCL A;  5L6V A;  2G2Z A;  2XAT A;  2IU8 A;  3KWD A;  4KNX A;  5AFU V;  4AAW A;  3F1X A;  2V0H A;  1MR7 A;  3TIS A;  3R1W A;  3R5B A;  1KGT A;  2V0K A;  1MLA A;  1QRG A;  3SPT A;  5E3R A;  4MZU A;  1KK6 A;  5U2K A;  3NZ2 A;  2G2Y A;  3TDT A;  1G97 A;  4IHG A;  3EH0 A;  4M2B A;  4N6A A;  3KWE A;  2ICY A;  1KRU A;  2AQ9 A;  4HZD A;  3R3R A;  5L6S A;  1NM2 A;  3GVD A;  1KRV A;  3R5C A;  1KRR A;  5E3P A;  4QBU A;  2OI6 A;  2QIA A;  3V4E A;  1SSM A;  3OU9 A;  4M2A A;  4IHH A;  3BSY A;  3Q1X A;  4EA8 A;  1YP4 A;  2V0I A;  3R2W A;  4J09 A;  2QJ3 A;  1LXA A;  3IXC A;  5AFU U;  3HSQ A;  1KK4 A;  3TV0 A;  4HCQ A;  2GGQ A;  3C8V A;  3EEV A;  1FXJ A;  2Q4J A;  3TQE A;  2V0L A;  1YP2 A;  2JF2 A;  1S80 A;  4E1K A;  3VBL A;  2GGO A;  4EA9 A;  3TZX A;  3ST8 A;  4KQL A;  2WLF A;  4KPX A;  4M28 A;  3P1B A;  1KGQ A;  3EZO A;  3FSX A;  3OUP A;  3D98 A;  3BSS A;  4G3P A;  3IM8 A;  1MR9 A;  2WLD A;  1G95 A;  3R5D A;  3R8Y A;  4EGG A;  2V0J A;  3GOS A;  2QIV X;  3CJ8 A;  1KQA A;  5DG3 A;  3VNP A;  3VBI A;  2ICX A;  4N6B A;  3GUE A;  3VBJ A; 
#chains in the Genus database with same CATH topology
 3B4D A;  4PYA A;  3BQ2 A;  1FD2 A;  3DMJ B;  2W0W A;  2YKM A;  3Q23 A;  4HAC B;  4DV4 F;  4I2Q A;  3EG4 A;  1SB6 A;  1FNO A;  2OHD A;  1U1N A;  2KB2 A;  1P9Y A;  4C0H A;  5BYS A;  2NSB A;  2DH9 A;  2G0C A;  5IV3 A;  3SSS A;  1SKS A;  1D9D A;  4AE5 A;  1K47 A;  7FD1 A;  4QR2 A;  1CS4 B;  4WII A;  1UPP A;  3LTO A;  3PRB A;  4FZV A;  2WB4 A;  2RRA A;  2ZH6 A;  4CP5 A;  3KJV B;  2ZD1 A;  4X65 F;  1KDN A;  1KR4 A;  5U47 A;  1WEL A;  1VLO A;  1YWX A;  3C8Y A;  1MWZ A;  4LF7 F;  3KJQ B;  2UXB J;  3DGP B;  4C8Y A;  1HI0 P;  3V6D B;  3FEZ A;  4ZVF A;  2HBZ B;  3N5B A;  5F8G A;  1X4D A;  4F0H A;  1NK0 A;  4KO0 A;  3WX4 A;  4JV1 A;  1L3U A;  5A8K B;  3MC4 A;  4LF1 A;  5HAO A;  1SKW A;  3DN9 A;  1BY9 A;  4JI2 J;  1T9X A;  3OTB A;  4NA2 A;  2VD3 A;  2R7O A;  3BFP A;  1UFL A;  4I2P A;  1HMV B;  1U2C A;  2YBV A;  3VHQ A;  3OTZ A;  1NPR A;  2OI2 A;  5KFO A;  1H98 A;  1RWO B;  3RB0 A;  5FDL A;  3D8V A;  4FVM A;  1N5Y A;  4O4G A;  1KVK A;  2FVC A;  1KLM B;  2P9E A;  2Z58 B;  3TA2 A;  3W5Y A;  5ADX V;  4F3Q A;  3GQC A;  4DR2 J;  2RDI A;  1N48 A;  4KGV B;  4G3Q A;  3VBM A;  2CUY A;  2EFG A;  5IWA J;  3CC7 S;  2WAQ D;  3P45 B;  1QRL A;  1XMQ J;  4DPX A;  1NPK A;  2TDT A;  3IBC B;  4L72 B;  3TVK A;  3JAM Y;  1SQG A;  1WOO A;  3CF5 Q;  5E33 A;  1JQG A;  2OO4 A;  1NH8 A;  1UEV A;  3SBM A;  3KHR A;  2HNY B;  3O44 A;  5HP1 A;  2KFN A;  3NS5 A;  4ED8 A;  4ZOS A;  1R8H A;  2V6A A;  4RW6 B;  1DBD A;  4C8Z A;  1ZM2 A;  4KHP J;  4DDF A;  3TK8 A;  1FO1 A;  1URN A;  3SUC A;  3H4D A;  4ZPA A;  3FEY B;  1SXL A;  1ZBT A;  4JV5 F;  4ELT A;  2VON A;  2BKO A;  4Q0B B;  2EKN A;  3EJM A;  3QSI A;  1S57 A;  2EFN A;  5IC4 B;  2WVF A;  1XMO F;  4B3M J;  1FVS A;  4HT5 A;  4Y28 C;  1K1Q A;  4LRE A;  5BR8 J;  4N69 A;  2WOM B;  4OYA A;  5K14 B;  4F36 A;  3MQG A;  3SFG A;  4A47 A;  3QWU A;  4QIE A;  1NLK L;  1RT4 B;  2C2O B;  4HHU A;  3LGM A;  4NLU A;  4ZPD A;  3TUZ C;  2JHE A;  3K59 A;  4A8X A;  4CLT A;  2ABY A;  4ERD A;  5KFE A;  3UW1 A;  3RBZ A;  2V0K A;  2XSJ B;  3DLK B;  1QRG A;  2LA6 A;  5KFT A;  1VS3 A;  1TL5 A;  4F0M A;  3VAK A;  3L4B C;  3PW7 A;  1NK5 A;  3MWB A;  4ED5 A;  1DTT B;  2FLP A;  2AD9 A;  3S1T A;  2C28 A;  4M2B A;  1EHW A;  2ZJQ Q;  1RAA B;  4OX8 A;  1TKT A;  4IG0 A;  2WCX A;  2E1P A;  4ZLJ A;  4X4S A;  3J81 Y;  4CIO A;  2GGP B;  1RTJ B;  3GV8 B;  3KWM A;  3OU9 A;  3H25 A;  4EU0 A;  4IHH A;  4ICL A;  5SUH A;  2WTF A;  4EA8 A;  3DM2 B;  2ZHO A;  4OZ2 A;  1I94 J;  3D1Q A;  2J6T A;  4JI0 J;  5ETK A;  4OFZ A;  4ZHR A;  1REG X;  3N6M A;  1FXJ A;  2EBG A;  3JTN A;  2QV6 A;  3HHK A;  3CMA S;  5IXU A;  4XDD A;  4X4N A;  2B9W A;  3M8Y A;  2ZNZ A;  3AA8 A;  5DQG A;  1VQ6 S;  1M5K C;  5E3A A;  4DG1 A;  5KFN A;  1TL1 A;  2MKY A;  2ALY B;  2N4D A;  2VU5 A;  2Z4P A;  3JSY A;  3MM6 B;  2MST A;  4LFA F;  2GHV C;  1WTB A;  2FJV A;  5KT3 A;  5KT4 A;  2A18 A;  2J76 E;  2A1B A;  2V2Q A;  2V0J A;  2VB6 A;  3CJ8 A;  2R8G A;  2GQC A;  3R7S B;  4YS2 A;  1G4C A;  1RTI A;  2OAU A;  4ZLN A;  4OX9 F;  4DV2 J;  5J2P A;  4B3S J;  1GMW A;  2BKN A;  4WP3 A;  5AXK A;  4DBQ A;  3LH2 S;  2ZOF A;  3F56 A;  3I6P A;  3JTP A;  4WE1 B;  3ZZT A;  4YUD A;  1D8Y A;  1NK9 A;  1TFW A;  2EC0 A;  3FSC A;  4YY3 J;  3KFW X;  2KVQ E;  5KFQ A;  1HKA A;  4F4W A;  4E8U A;  1GMV A;  3PKM A;  2EK1 A;  1FWL A;  3UD5 A;  3DRY A;  1QUP A;  1W25 A;  2F3J A;  2AV5 A;  3MM9 B;  3V4I A;  2LDI A;  2PFD A;  3QIP A;  5KFA A;  3CJT A;  2BQR A;  3DDN A;  2MZQ A;  2DGW A;  5E0O A;  4PQU A;  1T11 A;  7AT1 B;  1OY9 A;  4DN9 A;  1Y7P A;  4KGX B;  3W1Y C;  1YP3 A;  1TVR B;  4LSL B;  3UFC X;  3SQO P;  1Q53 A;  3R27 A;  1TL3 B;  3RR7 A;  2GC8 A;  3S6E A;  3CCU S;  1TK5 A;  1XAT A;  2F4F A;  2RRB A;  1FKO B;  1HI1 A;  5HK4 A;  4O3R A;  1YDL A;  3DMJ A;  3FWW A;  3CMQ A;  1PYS B;  2B6A B;  3TUJ C;  3UDV A;  2V34 A;  5HQL A;  4QWE A;  4EBE A;  1XQI A;  3NGD A;  2VG7 A;  4DEZ A;  2WW8 A;  3ITH B;  4P2X A;  2AGO A;  4RU2 A;  1G6B A;  3LA0 A;  2MB0 B;  4P9S A;  3ET6 A;  3NY0 A;  1GX5 A;  2IRU A;  1U1O A;  2GHW A;  3MR5 A;  5KFP A;  3I96 A;  2OMO A;  5F3T A;  2HPU A;  3OVA A;  3KOA A;  4A8W A;  1QAY A;  3KK1 A;  3ADA C;  5EHH A;  2L3M A;  1Q95 G;  4IFV A;  1KHR A;  4G65 A;  3GIL A;  3GV7 B;  4UOF A;  2DXF A;  3C15 B;  3ETM A;  2WON A;  3MEG A;  5AXM A;  5B08 A;  2E7V A;  1XMO J;  3FBC A;  3Q83 A;  4B3M F;  2NXE A;  1WF0 A;  2DIT A;  2O1P A;  3K5O A;  2VHE A;  2H51 B;  5IV4 A;  3D1O A;  3KDN A;  5FII A;  1THJ A;  1KQF B;  1YIJ S;  4BHQ A;  1C4C A;  2P5V A;  1H38 A;  3NGR A;  4FF2 A;  3JS9 A;  2CG4 A;  4JI4 J;  1RAO A;  4OI3 A;  1S4F A;  1HL6 A;  1XWL A;  2HUR A;  5A8W A;  3KLH A;  5GAG U;  2FB0 A;  5CA5 A;  1OQ6 A;  3TWD A;  4EAA A;  3D6F B;  3LPY A;  3THP A;  3CDA A;  5L6V A;  4ZIW A;  2CZ4 A;  3VAL A;  4LF2 A;  3NS6 A;  3Q8Q B;  2GIR A;  5AFU V;  2HGM A;  3BSC A;  1YBU A;  1PIE A;  2EFP A;  2W25 A;  4FKX A;  3TQ1 A;  1M0S A;  3R5B A;  3POT A;  4LQ9 A;  5J1P A;  2GVD A;  2QLF B;  1VGY A;  4LIW A;  1XIQ A;  1RT2 B;  2XSF A;  3DYA B;  5LSO A;  1W2B R;  2JJ4 D;  2AJ0 A;  2L9N A;  4USM A;  4TXS A;  1G97 A;  3GII A;  2UUC J;  3SCI E;  3KWE A;  4OZJ A;  3I9V 9;  2IC3 B;  1ZYQ A;  4K4U A;  2AQ9 A;  1YVF A;  1B7Y B;  1RWP B;  3BPD A;  5DDR C;  1MWY A;  4RUA A;  3R5C A;  2CQ3 A;  1RHM B;  4XIU A;  2E1C A;  3QLH A;  4FBU A;  1H3D A;  1HPZ B;  3ELH A;  3EWG A;  3K58 A;  1D1U A;  1GFW B;  2UUC F;  2XLJ A;  5KFV A;  3QGH A;  5C42 B;  4V1A k;  4H54 A;  3EZU A;  2H4W B;  2Z30 B;  1KP6 A;  2HHP A;  3EZ5 A;  3IG1 B;  4NCG B;  4YFU A;  1JLB B;  2ZWP A;  5EUH A;  3T1H J;  2LYV A;  2XI2 A;  1FEH A;  3DXB A;  1S12 A;  2UUW A;  4O3N A;  4ES1 A;  2CNN B;  1D9A A;  3ST8 A;  3PHT A;  4FP9 A;  1XMB A;  4KPX A;  4JP8 A;  4RLE A;  1UET A;  2YNG A;  2ZUG A;  4ZP9 A;  1I6J A;  1QSS A;  3DOL B;  1TL7 B;  3LP2 B;  4KKO A;  2CPE A;  1GXT A;  4DF8 A;  2RS8 A;  4PYD A;  1HWL A;  2CAD A;  4F67 A;  2YNF A;  2GV1 A;  1RSC A;  1VK3 A;  4UY8 5;  3IRX A;  1T03 A;  4J9P A;  1WEZ A;  3BH6 B;  1CJV B;  3NOG A;  1KQK A;  5HQM A;  2ICX A;  3SZ2 A;  1K0T A;  1Y5L B;  1OPI A;  2ZFH A;  1FRJ A;  3I3X A;  2HLU A;  3LWL A;  2XWX A;  3EXC X;  3ISN D;  2Z56 B;  1PBA A;  2L41 A;  3DJ4 A;  4WU3 A;  3AJ1 A;  3V81 A;  1UVL A;  2F9J A;  1N54 B;  2AX0 A;  4MMO A;  4R0J A;  4LF6 J;  3GP9 A;  2P6S A;  3QQC D;  4U7C A;  3D1H A;  1M90 T;  2ZZT A;  4N41 A;  4NLV A;  2BDP A;  3HUL A;  2R8K A;  4KNR A;  4IRK A;  1LFW A;  4RPF A;  3FRZ A;  5I3U A;  4QIF A;  2F65 A;  2K2P A;  4BS2 A;  3HI9 A;  2QN6 B;  1JLA B;  2J5A A;  4CRJ A;  3IRX B;  5F8M A;  5HMY A;  5KT2 A;  3MGJ A;  2KXN B;  1S6O A;  5KFC A;  2IM2 A;  3CB4 A;  3WIU A;  4YR0 A;  1CEZ A;  4U6P A;  1WF2 A;  1HWI A;  5DZ6 A;  2Y8Y A;  2HQC A;  2XMA A;  3DDK A;  2XNQ A;  1TV6 B;  4J91 A;  3VAM A;  1M1K T;  1F5B A;  4C3L A;  2ZOG A;  1ZPW X;  4G87 A;  3PJX A;  4M5J A;  3NXZ A;  3OXG A;  4WF9 Q;  2OUG A;  3BGL A;  3CCV S;  4PXC A;  2UV8 G;  5GVQ A;  1UEU A;  2F63 A;  4N77 A;  4P7V A;  4B08 A;  1LW2 A;  1CUL A;  2B4O A;  1RA6 A;  2DCU B;  2C3U A;  2ILZ A;  3KDO A;  3EUN A;  4RW9 A;  2XHC A;  4GVL A;  4QW8 A;  4NOH A;  3A4T A;  2LDY A;  1WTF A;  2DT9 A;  1HD0 A;  2D69 A;  2RUG A;  3D3B J;  3HX9 A;  1YSJ A;  2NPO A;  1TZ0 A;  4O23 A;  4RX6 A;  4B02 A;  2G4B A;  2WLE A;  3Q24 A;  1QUV A;  4F02 A;  1PJ7 A;  2BOA A;  1FX4 A;  5LMU J;  4I7F A;  1DQ8 A;  2E7W A;  4WU2 A;  5C5J A;  1JNR B;  1RHR B;  2JFD A;  3C6T B;  3FZB A;  3O8W A;  2YKN A;  2AHO B;  2MJU A;  3JAM U;  3FCW A;  3M8Q B;  4P71 A;  1ZZN A;  2UXC F;  4Y2I A;  3FSI A;  1JIH A;  2QX0 A;  4USU A;  2Y1L B;  2WHO A;  3SMZ A;  3GTY X;  1X60 A;  2FY8 A;  4ER8 A;  4ECW A;  2LKZ A;  1ROF A;  2RIJ A;  1O6X A;  4UZB A;  3NL0 A;  4JUZ A;  1HYS B;  2U1A A;  1WC0 A;  3OTC A;  5DS7 A;  2Y1J A;  4B3S F;  4DSI A;  1YI2 S;  1SL2 A;  1LW0 A;  5HLF A;  3KLG B;  3TZZ A;  4LF5 F;  2DH7 A;  3W2V B;  4IFY B;  2Z8Q A;  3MD3 A;  3PR4 A;  1L3K A;  1R89 A;  1U7L A;  1JLA A;  3KHG A;  1GXU A;  2OPS A;  3EE3 A;  3GIM A;  4CO2 A;  4I67 A;  4DCL A;  3OXL A;  5C24 A;  3WIV A;  4AFF A;  2GFF A;  3PYE A;  2G2Z A;  4DV5 J;  1V3S A;  4OYB A;  1NJY A;  4MK7 A;  4DR5 J;  3EPI A;  1HMV A;  5DRK A;  4BWJ A;  4BC9 A;  5DET A;  3MPV A;  2BE9 B;  1DFD A;  4OHZ A;  3N6N A;  3G8S A;  3SPT A;  3SSR A;  6FDR A;  3THV A;  2IJF A;  3NCP A;  2F9D A;  3LAL A;  2WON B;  1S79 A;  3BZQ A;  2ICY A;  5DDQ C;  2HHH F;  2ALZ A;  2AW0 A;  1SC1 B;  5HBM B;  4PPZ A;  1FDA A;  2BJ7 A;  4OV6 A;  2BV3 A;  3MOJ B;  4PXE A;  1E6V A;  1S1W A;  3CCL S;  2GMH A;  4XAK A;  1JLG B;  1RAI B;  5C24 B;  4NLQ A;  4NX9 A;  2AU0 A;  1SCJ B;  5FLX U;  3PIO Q;  2JRS A;  2GX8 A;  2YX4 A;  3ET6 B;  1KK4 A;  2UUA J;  4HCQ A;  2AEJ A;  1VIO A;  5CD4 A;  4NYP A;  2GJ2 A;  3Q8V A;  4KPC A;  3T5J A;  2EFV A;  3OR2 B;  2H5E A;  4ZLL A;  1N32 J;  3A12 A;  3HFZ B;  1I51 B;  2HMI A;  4DZ6 A;  4WPA A;  4WIQ A;  1RT6 A;  1VQO S;  1GNK A;  1F5A A;  2V8P A;  2E5J A;  2RKI A;  1XR6 A;  3V6J A;  2X1G A;  3D66 A;  3NOC A;  2XYH B;  4ZPB A;  3MF5 A;  2D3O R;  2KZM A;  1HWJ A;  2ZWO A;  1G95 A;  4OI1 A;  4EGG A;  1AUS L;  1RTZ A;  2FDN A;  3MEE A;  2BYC A;  2BE2 B;  5ETL A;  1HNX F;  2ZE2 A;  1YJR A;  3L7O A;  1M5P C;  1SQF A;  4YR3 A;  5L1J A;  3OD2 A;  1CQM A;  2W8K A;  5GAD I;  1Q5V A;  2UUB F;  1Z90 A;  4K6R A;  2VQE F;  4OLO A;  3K2Y A;  4NLS A;  5I3P A;  3PEJ A;  3MFH A;  4CCH A;  3I31 A;  3UD4 P;  2UXD F;  5IWA F;  3PV8 A;  2QO3 A;  4PR6 A;  1KC8 T;  1GXL A;  2AP6 A;  2IRX A;  2PA8 D;  3A3N B;  4WFN Q;  3I0R B;  4G3S A;  3HVT B;  5AE2 A;  2KM8 B;  4J9Q A;  5D4P A;  4QYZ K;  2W9C B;  3FUY A;  4Q45 A;  2W2P P;  3KKF A;  3H0P A;  2WLC A;  3UN2 A;  4GKJ F;  3MR3 A;  1D09 B;  4U67 Q;  4WFB Q;  4PUO B;  3G8T A;  4X2B A;  3PTW A;  3OW2 R;  2DHH A;  3AT1 B;  5IS2 A;  5C2G A;  4RNM A;  1VQ7 S;  1HNW J;  4ZJO A;  4R8U B;  2ZKT A;  4TQS A;  2JFK A;  4KPY A;  3LAN A;  2MPU A;  3ZXW A;  2ZBC A;  1QSY A;  4DR7 J;  4DQI A;  3A8E A;  4CH7 A;  4LF9 J;  4LF7 J;  3CD6 S;  2OH2 A;  3R97 A;  3PRV A;  3FNN A;  5C42 A;  3PO5 A;  3HT0 A;  4E6U A;  4KRW A;  1P1T A;  4LF8 F;  3M2R A;  2ACM A;  1QTM A;  3BSW A;  4TLR A;  4H7O A;  3OL6 A;  4WKR A;  4XK8 C;  2QRR A;  1NZA A;  5B0G A;  4RNN A;  4YEA A;  1JK9 B;  1NSA A;  2FUG 9;  2KO1 A;  4HR2 A;  1XNR F;  4YDD B;  1WKJ A;  2Z2Z A;  3H98 A;  4F8R A;  2IVY A;  1JJH A;  2NYH A;  4CTA B;  2Y0B B;  3I56 S;  1REV B;  3FVY A;  4GO5 X;  2J9E A;  2FLN A;  3QO9 B;  4F7V A;  4OJ3 A;  4K4V A;  4CI0 B;  5A76 A;  1N5Q A;  2DIV A;  1VRT B;  2CJK A;  1FRX A;  3DI6 B;  3MMC A;  4DL5 A;  2V8H A;  1HW8 A;  3J80 U;  2U2F A;  4FNI A;  1TVR A;  1ZZF A;  3CO9 A;  2R7U A;  3RRG A;  1SUQ A;  5LJ5 Y;  2MQQ A;  2JL9 A;  4NPO A;  2YKO A;  2LQ8 A;  5E5N A;  5L1K A;  4Z37 A;  3A8K A;  4JI3 F;  3S8S A;  4NL5 A;  2D3U A;  2DNN A;  1BHN A;  2DR7 A;  1FXL A;  2X51 A;  1F1B B;  2C42 A;  2F4V J;  1M1G A;  4HL9 A;  1S0M A;  2MKI A;  2OTJ S;  1SKU B;  4NA1 A;  3MAA B;  4PAB A;  5DG7 A;  5L39 A;  4X4Q A;  3N79 A;  2GAH C;  1S9G B;  2XGP A;  2OD4 A;  1KQS R;  1BD6 A;  2FHJ A;  2HLT A;  2K3K A;  4ES3 A;  4KY3 A;  2GA7 A;  5F8H A;  3CO0 P;  5LM7 E;  3FMW A;  5HP1 B;  2XC9 A;  1ZPV A;  3VAI A;  1NK4 A;  1L3S A;  3GR0 A;  3GR1 A;  4NI2 A;  5LXR A;  2UU9 J;  3VV2 B;  1RAF B;  2DRA A;  4J7C A;  4M1K A;  4B3O A;  1RWN B;  5L6S A;  2BRK A;  3DLH A;  3M1V B;  4KSE B;  1HBM A;  2AYM A;  2DHA A;  4CLP A;  2D9O A;  2QIA A;  1FE0 A;  1SSM A;  3CCQ S;  4J9O A;  1BGX T;  2CZ9 A;  1GH8 A;  4IFY A;  2HS3 A;  3KLI A;  2PMH A;  2KVI A;  2B6A A;  1KLM A;  1MN7 A;  4ZLP A;  3KLG A;  4DR4 J;  2DR5 A;  2BUN A;  1J5O A;  1CPZ A;  4C97 A;  1IKX A;  1JXV A;  3LP0 B;  4WXO A;  4P2M A;  5HAT A;  4NAS A;  1R6V A;  4C8N A;  3RAQ A;  4DR7 F;  3TJ9 A;  2HVI A;  1LWE B;  3V4M A;  3LAK A;  1RAG B;  1YJT A;  3MFI A;  2FPH X;  4FXV A;  4IG3 B;  4RUH A;  2ZZM A;  4BC7 A;  2YWW A;  5F9L A;  2GJI A;  3PYD A;  1RP5 A;  2YPZ A;  3LF0 A;  4YB1 P;  1NKB A;  1H0H B;  4PWU A;  4YN3 B;  4ZVR B;  2ATL A;  3K0J A;  5JVH Q;  4LF4 F;  3NAI A;  3ILL A;  4G3P A;  4PG8 A;  5JUM A;  3NNH A;  2GML A;  2ZBR A;  4FS2 A;  5B0E A;  3KK1 B;  1X4C A;  3M6U A;  1YBA A;  4LRB A;  4AQY J;  2V2K A;  1QM9 A;  3N01 A;  3VNP A;  1RT3 B;  2R7X A;  1X4F A;  2CVI A;  2F4V F;  5F0U A;  2W9C A;  3QT7 A;  3O6Q A;  1VIX A;  2F1F A;  1S1T B;  3OFG A;  4DFP A;  4DL0 C;  2PD1 A;  3DRR A;  3D68 A;  3MR7 A;  3ZTO A;  2AMC B;  2W2Q P;  2HS4 A;  3T19 A;  1SQE A;  5HMX A;  3KLE A;  4DLE A;  3RAX A;  2XMW A;  3M2V A;  2VG5 A;  2HNZ A;  3KUG A;  4ED6 A;  2Y1R I;  2C2N A;  4ECU A;  3PEH A;  2P2C B;  3MR6 A;  4EK2 A;  1NHU A;  4ETX A;  2M52 A;  3I5B A;  2IVM A;  4Y2M A;  5FJ4 A;  1CQN A;  2EBE A;  4MK9 A;  3L09 A;  3OQ2 A;  2G1H A;  3MM7 B;  4N5S A;  1TK8 A;  3JXO A;  2NS1 B;  1N5T A;  1TU0 B;  4U7U K;  1E6Y B;  1TL3 A;  3MPD A;  1QVG R;  2I5J A;  2RB7 A;  3IS9 A;  4H4M A;  2R7V A;  4EBD A;  1S1U A;  3DU5 A;  4Z2X A;  3KHL A;  1VHF A;  2G9O A;  1YRT A;  2OKQ A;  3LO3 A;  5G4D A;  3W63 A;  3P3D A;  2I5K A;  1N32 F;  1IWG A;  2MY7 A;  3HFV A;  2MHE A;  3SV4 A;  2NYI A;  5IT4 A;  1J5E F;  4ZHR B;  1QD1 A;  2XZT B;  2F5G A;  4ZVO B;  4TQR A;  3QSY B;  3DKD A;  5B0B A;  1RIS A;  1OYD A;  3M2V B;  1SL0 A;  1U0S A;  2FZC B;  3GQA A;  4S0M A;  2KJV A;  2PI4 A;  5ETV A;  5GMD A;  3Q8Y A;  1U0H A;  4FYY B;  3RRH A;  2HWH A;  1T03 B;  1UVJ A;  1PAU B;  1NB2 A;  1QJH A;  5D78 A;  2IIH A;  5K8N A;  2HVD A;  2XO7 A;  1DLO B;  1HBN B;  2IHR 1;  2LVW A;  3U27 A;  1SJR A;  1BWV A;  3R5J B;  2G0J A;  3J7Z T;  4U7U D;  1U47 A;  1URR A;  1LFP A;  5HBM A;  2J9D E;  2VBZ A;  3I32 A;  1HBU B;  3RZA A;  2VJU A;  1X31 C;  3W62 A;  2EFQ A;  1JLB A;  5LL6 d;  3HT3 A;  5I42 B;  3M9N B;  2RSQ A;  4R36 A;  1S59 A;  5A0Y A;  3PIP Q;  4F4A A;  2X7I A;  4DU7 A;  3NWR A;  3KYL A;  4KB7 A;  1VBK A;  2HHU A;  1TDT A;  5D77 A;  2JWN A;  2C3Y A;  2KRB A;  3CUL A;  2FGC A;  5DO2 A;  1FTC A;  3RJM B;  5HVG A;  1PGZ A;  3M6V A;  3MQH A;  2JSX A;  4YR2 A;  2ASJ A;  5CYM A;  1S97 A;  2FQQ B;  2XMJ A;  1ZA1 B;  4L75 A;  4NLY A;  4C48 A;  2VIC A;  2HS0 A;  3HDS A;  4N7T A;  2ADC A;  4ZVU B;  2IU8 A;  3UO0 A;  2EFO A;  2MLX A;  2HKE A;  3MTJ A;  3KLF A;  1NKC A;  3EGW B;  2QL7 B;  2RDJ A;  3TJA A;  1IKY A;  1MML A;  5L1I A;  2Z57 B;  3IXQ A;  1BE4 A;  1H2V Z;  1HNV A;  1RTH A;  4CTA A;  3MAH A;  2B5J B;  3PO4 A;  4JI5 F;  1RQ0 A;  3T9Z A;  1S1V B;  4UOG A;  2IMW P;  1TKX A;  2RAQ A;  3OLA A;  4FF3 A;  5HJY A;  5IT9 Y;  1Q8K A;  3I4P A;  3GFZ A;  4DCP B;  1T9U A;  2V0N A;  3UNG C;  1KRV A;  1PC4 A;  3AD8 C;  1RT1 B;  3DOK B;  2BAN B;  4Y34 A;  3OBI A;  5D4N A;  1S7H A;  3QGG A;  4FKY A;  2JEI A;  1MSW D;  3Q1X A;  4Y6I A;  4QPX A;  4WFZ A;  3ZZ0 A;  4EI2 A;  1HR0 F;  1WDD A;  4K4Y A;  2VJV A;  4YB5 A;  5HMZ A;  4I56 A;  1YLX A;  4CH0 S;  3HXM A;  5DM7 Q;  1UA1 A;  4NLP A;  1MNE A;  3OTE A;  4HKQ A;  4ZVP B;  1YJ7 A;  4MFB A;  2JF2 A;  3DXS X;  4DPY A;  2JLE A;  3GFX A;  4IH5 A;  4CYU A;  4EA9 A;  2A2C A;  3ZTR A;  3TZX A;  3J81 U;  1NK6 A;  2ROE A;  1RBO B;  2FJD B;  4EBC A;  1NSP A;  2AKW B;  3T5H A;  3EVO A;  1CJK A;  3H5Y A;  2BAN A;  1IKX B;  3LP0 A;  2CQI A;  1N8R T;  2DEJ A;  2YVS A;  5L1L A;  3C2P A;  4KFB A;  1S10 A;  1SJF A;  1IM4 A;  2M3D A;  2PE8 A;  3AD7 C;  4JI6 F;  3VBI A;  4WTY A;  3M1V A;  3KLF B;  2P6T A;  4G1Q B;  2IA0 A;  2BJ3 A;  1WWH A;  2CZV C;  2LCW A;  1NXI A;  3C66 A;  1HNV B;  1RTH B;  4Q2M A;  4C0B A;  3JSM B;  3D6M B;  2E5L F;  2H54 B;  5DEP A;  1RA7 A;  2KHC A;  5GME A;  4Y00 A;  1F0X A;  2XQC A;  4OYI A;  2B9X A;  2AF6 A;  4F3O A;  1NND A;  5E3Q A;  4B9U A;  4M5I A;  3J7Z 5;  2RT3 A;  1RAC B;  3D28 A;  1RKJ A;  2OI7 A;  1FF2 A;  2V4R A;  1T3D A;  2JEJ A;  3HZE A;  3M8Q A;  1HHQ A;  3DOM B;  3IMQ J;  2FJX A;  3KNG A;  3MED A;  2CQ2 A;  4TYA A;  2VQF J;  1QE1 B;  5EX0 A;  2ZH9 A;  4ZMM A;  2VKR A;  1P27 B;  3OSP A;  2ZH8 A;  1QTN B;  4CLY A;  1AFJ A;  1NPP A;  4LRC A;  3QT5 A;  4P74 A;  1GTH A;  2XY6 A;  3W60 A;  1A7G E;  1RCO B;  4A8M P;  3R7B B;  3PKY A;  3FC9 A;  3DLL Q;  3T1A A;  4JI8 F;  2V9W A;  3K7R A;  2DO4 A;  2C2D A;  1RT3 A;  1S6P B;  2FJA B;  2JOQ A;  1WF1 A;  4DN0 A;  2A0F B;  4TY8 A;  1SPB P;  3X3U A;  1N33 J;  3D6H B;  1QSL A;  3KMS A;  2ZHB A;  3CJK B;  4RW4 B;  3ZZO A;  1HPZ A;  2ZH7 A;  2HBR B;  2PI5 A;  2OI5 A;  3I5A A;  1RAB B;  2VKZ G;  3OT9 A;  3RAM A;  4ZVQ B;  5DLF A;  1NU4 A;  2BAC A;  2J0Q D;  4CQ1 A;  2QLX A;  2AYE A;  2QG9 B;  3ONQ A;  1NDC A;  2CJA A;  2EW9 A;  2O5D A;  2RKI B;  3B8H A;  3IFE A;  1X0P A;  2RF2 A;  1RT2 A;  3BM7 A;  4NLT A;  2CWK A;  3W8P A;  3G71 S;  4R37 A;  2XTJ P;  3HHL C;  2ZH4 A;  2OPP B;  1T8E A;  4IKA A;  4JI7 F;  4MFG A;  3QJL A;  1RLD A;  3R5G A;  1JB0 C;  4NWB A;  3OUY A;  1VQP S;  3DLG A;  1QAJ A;  5ETQ A;  5KG0 A;  4WCE Q;  4RUC A;  3DRS A;  1FCA A;  3VBP A;  1XTZ A;  1HM9 A;  5HN0 A;  3FSB A;  3DRP B;  5B0C A;  3V5R A;  1FFS B;  3RRK A;  3DCA A;  4HEA 9;  4TYB A;  1BQN B;  2QZ8 A;  3Q8R B;  1AB8 A;  2FLO A;  4ZCI A;  3K5L A;  1DTT A;  3G82 A;  1TAQ A;  4YHH F;  2CPH A;  1PC5 A;  3BSN A;  2GW8 A;  3ENQ A;  2IFX A;  3R1W A;  2Q3P A;  2ZDO A;  5ETT A;  2BR0 A;  1BQM B;  2HK3 A;  4ILM A;  2FTR A;  1HLW A;  5U2K A;  2E1M C;  1EP4 B;  1HBO A;  4UY8 T;  3IG1 A;  3EH0 A;  1IVZ A;  3QYY A;  3AQO A;  2GVZ B;  5C2C A;  1FJ7 A;  1NM2 A;  1FJE B;  1B99 A;  1YKW A;  3HHN B;  4QBU A;  2AJQ A;  2OI6 A;  3QGI A;  2DB1 A;  1Y5I B;  5HO4 A;  4QCL A;  2AJ1 A;  1R27 B;  2RNE A;  1X8D A;  3A3P B;  4CM2 A;  4NLD A;  3PRD A;  3MXH P;  2ZH3 A;  1CJU A;  3ITH A;  1VRT A;  3EEV A;  1NH7 A;  1RLC L;  1VQY A;  1WHX A;  4ZN1 A;  5J2N A;  2V0L A;  5H9E K;  2Y9H A;  1WI8 A;  2LFV A;  3W64 A;  4AL5 A;  4PAA A;  3RB6 A;  2BAB A;  1TFY A;  4E1K A;  1BXN A;  1NAQ A;  3BQ1 A;  2P9G A;  3DDI A;  4CO1 A;  4JI3 J;  2WLF A;  1IQZ A;  5CAB A;  3HP6 A;  2KZZ A;  3MEK A;  4TU7 A;  4UTG A;  3KK2 A;  2W9B B;  1BUX A;  1YJN S;  3BKT A;  3UDL A;  4X4T A;  1KHV A;  3NLC A;  1IBL J;  1SL1 A;  3IN5 A;  4B9S A;  1VJW A;  2COL A;  2KT5 A;  3R8Y A;  3NP5 A;  3UI3 A;  2DNH A;  1M1H A;  3H40 A;  3BJY A;  4DSJ A;  2HVH A;  4GKK F;  1HHS A;  2AZ1 A;  4OLP A;  2VFT A;  5IM0 B;  3IBW A;  1XJW B;  1NO8 A;  3S01 A;  4WK3 A;  2EWH A;  3GCW P;  4X64 F;  3W3S A;  2Z2Y B;  1IJF B;  1C1C B;  1Y00 A;  2ZKU A;  1JKH B;  4I0W A;  4NE9 C;  1R0C B;  2JNJ A;  4J37 A;  3PX0 A;  1FJG J;  1QRM A;  3RB3 A;  1IBL F;  1HNW F;  3I87 A;  1NCL A;  2XS5 A;  2NSC A;  4URG A;  1DHM A;  2MZJ A;  2XEX A;  3G6V A;  5L38 A;  1LW2 B;  2ZC3 A;  2IUA A;  2N3L A;  4IFV B;  3QWP A;  4ATN A;  1Y9O A;  2MZS A;  4UZC A;  1U49 A;  2Q66 A;  1RDR A;  4KV8 A;  1C0T B;  2W2M P;  5H9F J;  1Q79 A;  4LFA J;  4F50 A;  5ADZ A;  3D0H E;  2QA4 G;  3BSA A;  3NGU A;  1JLQ A;  4K5S A;  1Q78 A;  4O3P A;  5KG5 A;  1VQ9 S;  5D8H B;  4IYQ A;  1JJC B;  1U8S A;  5F42 A;  3DI6 A;  3UR0 A;  3D2W A;  4PRF A;  3GG0 A;  3TUP A;  1R8B A;  4NML A;  4X4U A;  4USK A;  2H4Y B;  2Z2M A;  1FJC A;  2QGF B;  3FRY A;  4I2Q B;  5DDO C;  4WP8 A;  3PYF A;  2M4M A;  4FN5 A;  5H1S V;  4JI0 F;  4ECZ A;  3CIZ A;  2AJF E;  2XMV A;  3RU0 A;  5IQ6 A;  2R9L A;  4DQR A;  2W7A A;  3IGJ A;  3F73 A;  2ZH5 A;  1Q0N A;  4GKJ J;  6FD1 A;  4C8K A;  1S1X B;  5HSP A;  4FCE A;  3TR5 A;  1F9H A;  1WG5 A;  4FBT A;  1SH3 A;  1RZM A;  2QE5 A;  1FWY A;  1MRO A;  3T3F A;  3DHW C;  1S1U B;  2D1C A;  2HWI A;  3A13 A;  3E8O A;  3M8P B;  2CPY A;  2W2N P;  2DGS A;  3OGZ A;  1LWF B;  2DNL A;  3PZP A;  4DXL A;  4C6A A;  3OL7 A;  3JQY A;  2MTL A;  1N6Q A;  4F2S A;  3DYA A;  2UXD J;  1U09 A;  2HND B;  2L9W A;  2DCL A;  1FD8 A;  3GJR B;  4TY8 B;  2VG5 B;  3TVZ A;  3GLJ A;  1VC0 A;  2DIS A;  1JMT A;  2MQL A;  3KLE B;  1VBX A;  3TX0 A;  3BXY A;  4FDF A;  4OMF G;  9ATC B;  1LK5 A;  2HGL A;  3M32 A;  3UD3 P;  3E2E A;  1CJT B;  4FYX B;  1V3Z A;  3FDS A;  3PW4 A;  1S9F A;  4QYZ J;  2CKW A;  2FZG B;  3IM9 A;  1WSR A;  2N7Y A;  4O0N A;  4CNY A;  1AUD A;  2J6S A;  4EAB A;  4PWD A;  1RB0 A;  3EVW A;  3CIM A;  3WC0 A;  4F0K A;  1XC9 A;  4B17 A;  1W7W A;  2VPW B;  3L9Z A;  2CQH A;  3PCO B;  3CJQ A;  2RQ4 A;  4TLQ A;  1LXJ A;  2J0X A;  3DLG B;  4RW7 A;  1VCT A;  1S4E A;  5F41 A;  5HJX A;  4LFB J;  1MG7 A;  1SV5 B;  2NXU A;  2V63 A;  4AXJ A;  1O51 A;  3F41 A;  4DOZ A;  1JXL A;  2OML A;  1WJ9 A;  2UUA F;  3GIR A;  1KTQ A;  3CTR A;  5KFM A;  3BGR A;  1VMB A;  5DDP C;  2RS2 A;  5IT9 U;  3QPI A;  1S7I A;  1QLN A;  1MWQ A;  3ILJ A;  2E9T A;  2YKQ A;  2H9Z A;  4CT9 A;  3POT B;  4C8O A;  1EQ0 A;  3R3R A;  4QIG A;  4CLL A;  3SV3 A;  3KNA A;  4QWB A;  4H4M B;  4KJI A;  2HHV A;  2C3P A;  4M2A A;  1IR1 A;  3K8W A;  4IOC Q;  1T9W A;  4KAI A;  1YP4 A;  2V0I A;  3H20 A;  2QEX S;  3AJ2 A;  1S9E B;  5AFU U;  2B9E A;  2B8Q A;  2IDE A;  4F4Z A;  1ZS6 A;  2FVP A;  2ZUA A;  2VQF F;  4UF4 A;  1NJZ A;  4JI4 F;  2J7U A;  3ZZP A;  1XR7 A;  1WG4 A;  2IM3 A;  2M8H A;  4E2F B;  4DR5 F;  5K20 B;  4I2P B;  2DVI A;  4J9U E;  3PW5 A;  3MUR P;  1RWU A;  1S76 D;  2IVF B;  2CA9 A;  2L08 A;  1FDN A;  3EGZ A;  1EB0 A;  3QAU A;  4OHY A;  4CLU A;  3MHY A;  4IDK A;  4USW A;  1ELO A;  3MAQ A;  4X65 J;  3P1B A;  1WI6 A;  2V50 A;  1RT7 B;  4YB6 A;  2XWY A;  4DX8 H;  5DGB A;  1PAE X;  4ECY A;  2DNZ A;  4LF5 J;  2WOM A;  5K14 A;  2HQD A;  1RKI A;  5A2Q U;  2IYI A;  1OSD A;  2VFR A;  2CNL B;  1SUQ B;  4JI6 J;  1Z1Z A;  1H74 A;  2H3E B;  1OPZ A;  1TUG B;  2WB1 D;  1RT5 A;  2LQB A;  4RW9 B;  3UQS A;  1MMD A;  4P72 A;  5KFJ A;  2DRB A;  3SCL E;  3AD9 C;  1B0P A;  1FK9 A;  3O2I A;  3PFO A;  2YKA A;  2B4V A;  4ECR A;  4IH7 A;  5L9X A;  2HVE A;  5D3G B;  1ZAW A;  1H2T Z;  4DI6 A;  5HMW A;  4DPT A;  5LMU F;  4TKT A;  4GKK J;  1AW0 A;  4RU9 A;  2D9P A;  2V5H G;  1C1B A;  1TMJ A;  4KIA A;  3VAH A;  2LU1 A;  2PC6 A;  3CJ5 A;  1OY8 A;  2FC9 A;  2LEP A;  5KFL A;  1UWA A;  3A8J A;  4X62 J;  4A48 A;  4DWI A;  1AA1 B;  3H5S A;  2JH3 A;  4DR1 J;  2D3O 1;  2WVE A;  3TAN A;  1FXD A;  2Z2L A;  5KG4 A;  1IJE B;  2GO9 A;  3JTO A;  4KV8 B;  1RWM B;  2OJ3 A;  1I1G A;  2NCK L;  2R2T A;  1UW4 A;  1AZS B;  2OSQ A;  4LVO P;  1N4L A;  3PVX A;  2R7R A;  2OTL S;  1U26 A;  3PDN A;  1CJV A;  4WYW A;  3C6T A;  3ZTP A;  4YY3 F;  2V4Q A;  2L48 A;  1PSD A;  4OYO A;  5K9F A;  1N34 F;  4DR3 F;  3PJW A;  1X9S A;  1JKH A;  1FKP A;  1GMW D;  3HJV A;  4K2J A;  1CG2 A;  2CIM A;  4DV3 F;  2E9R X;  1SSQ A;  5CCL A;  2OPQ B;  2V9K A;  2YNI B;  1EJ7 L;  4K7Q A;  2WVD A;  1R8P A;  4B9T A;  4E79 A;  4LF6 F;  3HHL A;  3M30 B;  2KFY A;  3GU0 A;  3H2U B;  3JQM A;  2W4C A;  2IU9 A;  2YWK A;  5A2Q Y;  4P6Q A;  1FNX H;  1Q81 T;  1OWX A;  2L9D A;  2NXC A;  3TUI C;  2VG7 B;  1GT8 A;  4JI1 J;  3JB9 k;  5HI7 A;  2V4J B;  3IAM 9;  4RW8 B;  2IDL A;  3QO9 A;  2W01 A;  1U2F A;  4GVB A;  5B0A A;  3M8Z A;  2RUS A;  4TNO A;  4QWD A;  2KG0 A;  1NK7 A;  2M8D B;  4M9C A;  2YKM B;  5M2R A;  4CLW A;  2FHM A;  3BQ0 A;  4DSL A;  3Q86 A;  2RJZ A;  4JB8 B;  2G2O A;  2W4D A;  2BM0 A;  3VQS A;  2OSR A;  3QLH B;  5KT7 A;  4RUB A;  1Y5N B;  1K1S A;  3BEG B;  4UUX A;  1I94 F;  2ROG A;  3FCV A;  2KL8 A;  4LSL A;  1RGV A;  2BZ2 A;  4MYT A;  5HRO A;  2A6O A;  1RYR A;  2I5J B;  3IS9 B;  3N0V A;  3FFI B;  4LR9 A;  4DV1 J;  4IQX A;  4OZL A;  2VG6 B;  3G6X A;  2HAI A;  5K5M A;  1VBY A;  1MR7 A;  4QZV B;  3TIS A;  2GVD B;  4MTP A;  3G6E S;  1KGT A;  1MLA A;  2Y8W A;  1BC6 A;  3WDO A;  3CJR A;  1RJJ A;  1Z2L A;  4MZU A;  2DNM A;  1F2H A;  4CLS A;  1NJX A;  1SV5 A;  2HHX A;  3NZ2 A;  1DUR A;  4JBC A;  4PPD A;  5I42 A;  1TUV A;  4RWX A;  3DU6 A;  2AGP A;  2HSE B;  1FT8 A;  1S1T A;  2O01 C;  3CW2 C;  4I64 A;  3SI8 A;  2J0W A;  3GVD A;  2DR6 A;  3OV7 A;  1KRR A;  5FDL B;  3D0G E;  3G82 B;  2F8M A;  5AXN A;  1BQN A;  1KS2 A;  5DM6 Q;  4NCB A;  1S6Q B;  3VAF A;  3EMT A;  2ZM6 J;  3HSZ A;  2QJ3 A;  3CCM S;  4J09 A;  5F8J A;  2DHS A;  3D9B A;  2DY9 A;  3HSG A;  3BR9 A;  3I0R A;  3SDE A;  2B51 A;  5HQ8 A;  2V68 A;  3AQP A;  2CPX A;  2Q4J A;  3HMJ G;  3OUY B;  2LMI A;  2LQ9 A;  4ECS A;  8RUC A;  1ULR A;  2OP5 A;  2OPP A;  1JLC A;  5E2Q A;  1SKR A;  3PXG a;  4QWA A;  4IOB A;  2HEK A;  1QE1 A;  3BYP A;  3UN5 A;  4W90 B;  4JV0 A;  4C8M A;  3IM8 A;  1M8N A;  1RTD B;  3G6Y A;  1QDU B;  1S6U A;  3IWL A;  4EMD A;  1Q5Y A;  1XMQ F;  1U6F A;  3CJ4 A;  3OH3 A;  3NWG A;  3HFK A;  4CO0 A;  3RB4 A;  2Q1L A;  3A1Y G;  2E9Z A;  3MM7 A;  2YNH A;  2CFX A;  2W9A A;  1VFJ A;  2MSS A;  4RBT A;  4PWW A;  2J9C A;  5AE3 A;  4WFA Q;  2R2S A;  2VOD A;  2CQ1 A;  2VBW A;  5D0R A;  1X4A A;  1FXR A;  2QA1 A;  2V94 A;  1C2P A;  4AA7 A;  1S6P A;  1UEK A;  4FYW B;  5KFX A;  5E41 A;  3PR5 B;  1WDT A;  3TNV A;  4KH1 B;  1IKV B;  4OYM A;  1S49 A;  3GSI A;  1FK9 B;  3CD7 A;  4F26 A;  4JI2 F;  3KK3 B;  2XSJ A;  1U6B A;  5GAH U;  4XPC A;  3UWT A;  5B7W A;  1RT5 B;  3HVR A;  1TEL A;  1U1L A;  3CCJ S;  5F3Z A;  3Q0A A;  4X66 J;  3T41 A;  4H4K A;  3MEC A;  3IC1 A;  2HG4 A;  4I6Y A;  3HHL D;  3AAW B;  4M5L A;  3MUV P;  4ZVG A;  3BBC A;  2W0V A;  3BV8 A;  2PII A;  2XLI A;  4E98 A;  4LVN P;  1Q16 B;  4QIV A;  5M2P A;  1QRF A;  4M5H A;  3NG8 A;  1Y4Z B;  2BM1 A;  4K4S A;  3AXM A;  1K73 T;  4UOH A;  4CH1 A;  2W1B A;  1FFW B;  3ICL A;  4WXW A;  4WE1 A;  4RNF A;  2V8D A;  1YRX A;  2CQP A;  4I6W A;  2HFN A;  1K8A T;  2H5J B;  2XS2 A;  3NMR A;  2FJE B;  3N28 A;  2BOP A;  3VGV A;  5HVH A;  4P2S A;  5IM0 A;  1FJG F;  4RR5 A;  1J5O B;  1GK8 A;  1UZD A;  1IR2 A;  3DRP A;  4JI1 F;  5GMK a;  2UUB J;  1RHU B;  1PO6 A;  2XMT A;  3UVJ B;  3ZTQ A;  3GYG A;  3FGV A;  3HKW A;  3IGV A;  1C1B B;  1U1P A;  3P4U B;  3UVJ A;  5F0W A;  1DRZ A;  5DQH A;  2R8H A;  3FOQ A;  1P8G A;  5HAN A;  2RDD A;  1L0S A;  3ILO A;  3TA0 A;  4ZJQ A;  5KFW A;  2OEJ A;  2DNR A;  3W5X A;  4DLG A;  2D74 B;  5H9E J;  1KRP A;  2P5Z X;  4NI2 B;  2MKS A;  5HL7 Q;  1UKU A;  3R3T A;  4KHR A;  3EGN A;  4O44 A;  4OX9 J;  3FCH A;  4YME A;  3UE2 A;  4DV2 F;  3OH1 A;  2QA4 S;  2Q43 A;  4ZDN A;  1WC6 A;  5CZV A;  4NLX A;  3SYZ A;  1ZTW A;  1SJ3 P;  1KN6 A;  4IRC A;  2R2R A;  4M63 A;  3OJU A;  4WP9 A;  1FRH A;  1PKU A;  2VOP A;  2YX1 A;  2RHS B;  1QQ0 A;  3ENV A;  4BCA A;  3V6D A;  3TAR A;  2IAJ B;  1KTV A;  2YNF B;  4PQU B;  3DGP A;  1A0O B;  1OJ4 A;  2WVC A;  3AXK A;  3H59 A;  1RCX B;  3AB2 B;  2PDA A;  3QIP B;  2IA6 A;  2ZVI A;  2KKH A;  4AXI A;  5KFS A;  4LJM A;  4ZIT A;  3V4I B;  2YQ0 A;  3Q89 A;  4AL6 A;  2HNZ B;  2K3I A;  3CCZ A;  1RT1 A;  1V9O A;  3F1X A;  3DOK A;  3H5U A;  3LQV A;  4DV7 F;  4OYW A;  2QMX A;  4ANE A;  4RKU C;  3U1L A;  4ZK7 M;  1RXO B;  4QR1 A;  2XZD B;  4KC5 A;  3GB0 A;  3B54 A;  4LF8 J;  4ANC A;  1RAE B;  1RWW B;  4FPR A;  4QIW D;  3HPO A;  3HF5 A;  3M9M B;  4IUF A;  3W9J A;  4LF9 F;  4HZD A;  3G4S S;  3SCJ E;  1L3V A;  1KVI A;  3MMB B;  1YK9 A;  1RI7 A;  2IAJ A;  3MTK A;  4QPT A;  3V4E A;  1NDK A;  2BA9 A;  3FBE A;  3MED B;  3HM9 A;  1YJ9 S;  2UVU A;  3MEE B;  1OY6 A;  2M2B A;  2HQ3 A;  1YJU A;  2LQJ A;  2HZA A;  2E1R A;  4L73 A;  4WYL A;  3U7J A;  2XBP A;  5AXL A;  1RHK B;  1EAY C;  5DQI A;  3J7Y U;  4C0O C;  1DTQ A;  3CUN A;  1X9W A;  1RTD A;  2DIU A;  2XMU A;  1NHK L;  1GTE A;  2VAS A;  2KTQ A;  3ZZR A;  1U1Q A;  1YGY A;  2ATC B;  1KOH A;  2OIH A;  2GGO A;  2HRU A;  2N4C A;  2K7K A;  1QVF R;  4OZ5 A;  4OI6 A;  2I8E A;  3U1M A;  4HDH A;  4FXD A;  5F8I A;  2PN6 A;  2V4J A;  1LKZ A;  3K5P A;  3GJQ B;  4RW8 A;  1ZAV A;  4DFK A;  3D98 A;  2AX1 A;  3CJS A;  3OXF A;  4HDG A;  4KE5 A;  3MMB A;  4ZJL A;  2ZEJ A;  4PEO A;  2HZV A;  1T0T V;  4ECX A;  5KFF A;  1SC6 A;  4ECT A;  1XNR J;  2DBB A;  1JLG A;  2IJN A;  4DF4 A;  3MMA A;  3MPW A;  4HLB A;  3ZZU A;  2VF3 A;  5A8W B;  1WC4 A;  2O66 A;  5CYQ A;  5ETM A;  2W7P A;  2QMW A;  4B9M A;  1VBZ A;  4C4W A;  4N6B A;  3GUE A;  1HW9 A;  1N33 F;  2KFZ A;  2N7C A;  2PT0 A;  4O3O A;  3SIP B;  3BDP A;  2CDQ A;  1MU2 A;  2HQF A;  1UVN A;  5C7P A;  1D3W A;  1M5V C;  2MQM A;  2JF3 A;  3P5B P;  4XTT A;  1V67 A;  4J9R A;  5F8N A;  3OH0 A;  3HJF A;  4ZVE A;  1T94 A;  1F9E B;  4M5K A;  2VOO A;  2DNP A;  2R42 A;  4LMZ A;  2WSC C;  1KEK A;  3C14 B;  2IBK A;  2KH9 A;  5JVG Q;  2BE2 A;  3DOM A;  1OO0 B;  2KN4 A;  3NCR A;  2XCA A;  1TKD A;  1CVJ A;  2XB2 D;  4EA7 A;  5J1N A;  1Y11 A;  1RAD B;  2AZ3 A;  3NNC A;  4LR8 A;  2IC3 A;  2Q6B A;  1QRE A;  2K7J A;  4RL1 A;  4RNO A;  4RW6 A;  3NGK A;  2KYZ A;  1T05 B;  4M5D A;  1S0V A;  5A6W A;  1JWW A;  4K4X A;  3ULH A;  3P47 A;  1VK8 A;  5T7L B;  2M9K A;  4UW2 A;  2UXB F;  1DAR A;  1VJQ A;  4WBF A;  3EDQ B;  2HHH J;  4ISX A;  4WK1 A;  2OLW A;  3T6B A;  3VGT A;  3DHO A;  3BGF A;  1JNZ B;  3NGT A;  4ZCK A;  1OCX A;  4YOE A;  2QLB B;  6AT1 B;  1FVQ A;  3C6U B;  4NYZ A;  4NZ6 A;  1NDL A;  1ZAX A;  3QT6 A;  5CHC B;  1FWP A;  3G8Q A;  5GAD U;  3VTI A;  3LGH A;  2DNG A;  3GJS B;  3NAH A;  1IUJ A;  1C0T A;  3B78 A;  3D67 A;  3H7H B;  3C19 A;  2W8L A;  1Y3J A;  4I7F B;  4W98 A;  4DV4 J;  2WBM A;  5M2U A;  2APO A;  5KG3 A;  5J2Q B;  3DLB A;  4NXM J;  2VDH A;  3MCS A;  4EUV A;  1H2U X;  3M8W A;  4EQY A;  5KT5 A;  5C25 B;  2YQ3 A;  3QFH A;  3MUM P;  2PMW A;  1WKK A;  2HQG A;  2LEA A;  2RML A;  4K4W A;  1HV9 A;  3KJF B;  3LWM A;  1BQM A;  2LA4 A;  2B7B B;  4QJV A;  4LIR A;  2MYF A;  4CO4 A;  1RU2 A;  4PG5 A;  3HVA A;  1LV5 A;  3EXY A;  3VBN A;  1OYE A;  4MKB A;  4I4B A;  4Q7A A;  5JMN A;  4E6T A;  3K8V A;  3W9I A;  1TK0 A;  1HAR A;  3TZW A;  2NZC A;  1HIY A;  2XG8 A;  1Z2F A;  2OFG X;  1BMQ B;  3I9Z A;  3SRT A;  3KLI B;  4MYU A;  4EYH B;  1TL4 A;  2VFV A;  3MM6 A;  1NK8 A;  4AUK A;  1J2V A;  1TL1 B;  3H2L A;  1REV A;  3O3L A;  5KFI A;  5FLX Y;  4ZP6 A;  3KTQ A;  4I6A A;  3SXL A;  2XLK A;  4IH6 A;  3HZG A;  4LUB A;  2YNH B;  2IRY A;  2NPI A;  4DR4 F;  3VAG A;  1HQU A;  2C3M A;  4Y0F A;  3QRQ A;  1KRU A;  1HWU A;  2MKH A;  5HRO B;  2VHG A;  1K0V A;  1MN9 A;  3JSB A;  1V5V A;  2IMO A;  4DSE A;  1SH2 A;  1RWV B;  2DNK A;  2DR8 A;  3CSK A;  3PG9 A;  4DL4 A;  1R8A A;  1WHW A;  2RD5 C;  3MM9 A;  1LXN A;  4CLK A;  2FJW A;  3PAC A;  4C11 A;  3C8V A;  1UW9 A;  2GQQ A;  4GVB B;  1PIL A;  3D7S B;  2X3G A;  3T9N A;  2DGX A;  3BRE A;  2PSZ A;  2FVQ A;  1YP2 A;  2PA3 A;  4A8S A;  4W92 B;  1VRU B;  4DPU A;  1WHY A;  5F9N A;  5BYQ A;  2G13 A;  3EIC A;  5BJR A;  1UVK A;  5F8L A;  3JYT A;  3GIJ A;  1X5S A;  3Q2S C;  3HHL B;  4DCO B;  1BLU A;  3BS9 A;  2YWE A;  3EZO A;  2W24 A;  2MJN A;  2VPX B;  5IT0 A;  2CJX B;  3CCE S;  1SBR A;  2J0S D;  2NPF A;  1KNZ A;  4LT6 A;  2D3Z A;  5CXT A;  4DQS A;  3MM5 A;  1LWX A;  1N0U A;  4EGL A;  4L74 A;  2FLL A;  3CCW A;  5LXY A;  2M70 A;  3G9C A;  2GS8 A;  3W7B A;  4IHF A;  4F25 A;  2GCF A;  4TY9 A;  1VLY A;  3Q8P B;  3GZ7 A;  5ETS A;  1LWE A;  3EVM A;  3PNI A;  1DAX A;  4MJK A;  5LSL A;  1FRK A;  3M9O B;  2ZE2 B;  3DHX A;  3DNC A;  3E51 A;  1HNX J;  4C98 A;  1WC5 A;  4C3K A;  4F2R A;  4DL6 A;  3HD2 A;  3PX4 A;  4M99 A;  2R3V A;  1OS5 A;  2MZR A;  1EZZ B;  3DGV A;  3C16 B;  1YJW S;  4NXN F;  2HHW A;  2C2R A;  3RW6 A;  1IWA A;  1YZ6 A;  2IY5 B;  1E6Y A;  1K44 A;  1D9F A;  3MM5 B;  2R8I A;  2HFS A;  3N6L A;  2EVZ A;  1RT6 B;  3IBF B;  1N5Y B;  4DV6 F;  3EPG A;  3THT A;  4Y2A A;  2EXU A;  1CJK B;  5KFZ A;  1J27 A;  1T9V A;  3UDE A;  5KFK A;  4BDP A;  2ZNY A;  4ECQ A;  5H9F K;  2CPD A;  2Q79 A;  4TN2 A;  1CC8 A;  3OH4 A;  3QJP A;  2DJW A;  2CQB A;  4OHX A;  1R43 A;  2OEL A;  7FDR A;  4NLG A;  4K50 A;  1SJ1 A;  4JV2 A;  2J9D A;  2RQC A;  1HNZ F;  4DU8 A;  1JLE A;  5ETN A;  3ZO7 A;  3BO3 A;  3IR6 B;  4LBH A;  4C2M A;  2MKJ A;  2BBE A;  4YDX A;  2I6W A;  3CCS S;  5B0D A;  1RT7 A;  3GFH A;  1TR0 A;  1C0U B;  2QL5 B;  4AQY F;  1S72 S;  1IBM F;  1QAI A;  2VD4 A;  2OD6 A;  2AEF A;  1S0N A;  2H48 B;  4NYO A;  5KFB A;  4P2F A;  4O0I A;  2HK2 A;  2VC1 A;  2XMM A;  3KWC A;  1CUL B;  2DEI A;  3AOC A;  2NRE A;  3GJT B;  2VPZ B;  3HCX A;  3M7V A;  4OQJ A;  2CNK B;  3WX8 A;  2DK2 A;  3O5T B;  4CT8 A;  4LF4 J;  3KK3 A;  1NRK A;  3W65 A;  1Z4U A;  2ZHA A;  1RUS A;  1S1V A;  4KYZ A;  3GPA A;  4OJ1 A;  5L8R C;  3R0S A;  5D4L A;  3E3X A;  5AJ3 J;  3ZZZ A;  4DUZ F;  4R7P A;  4GC7 A;  1ZET A;  3FTT A;  5I3Q A;  5KG1 A;  2XY7 A;  4ILL A;  2V67 A;  3TJ8 A;  3BRK X;  1X4E A;  2B43 A;  4QU6 A;  3J7A 1;  2WLG A;  3CED A;  4ZVT B;  1X4H A;  4IO1 A;  5KTQ A;  1KFD A;  2KHD A;  3R7N B;  2CQG A;  1WAC A;  2GZO A;  4WWS A;  5K8M A;  4OYZ A;  4W4M A;  3KWD A;  4KNX A;  1HA1 A;  2C2K B;  4LRF A;  2GHP A;  4C8L A;  2GQ2 A;  4WZM A;  1HFE L;  2GIF A;  3AB4 B;  1JLC B;  2CQD A;  2YX7 A;  2ZVS A;  3A3O B;  1PJ6 A;  5LSR A;  2UU9 F;  1YX2 A;  2IYG A;  4MFB B;  4DR3 J;  1KK6 A;  1KHW A;  2HFU A;  2RU9 A;  4OX7 A;  3CXC R;  4K5R A;  1AYE A;  4IR9 A;  5D6G A;  5ETP A;  4EYI B;  1RWX B;  2N82 B;  3QBC A;  2CDR B;  4N8O A;  3KXD A;  5KT6 A;  2WSF C;  3OVB A;  1G1X A;  1HYS A;  3NBP B;  2YQ1 A;  2VZ9 A;  2QSF A;  1Q86 T;  4F3M A;  5J2P B;  3AJD A;  2XNR A;  3TEG A;  3T1H F;  2F7V A;  1WOS A;  1CS4 A;  5B09 A;  3BO2 A;  2XMK A;  1F6T A;  2AT1 B;  3FK4 A;  2ZBP A;  4ELU A;  3KK2 B;  2UVR A;  4Q0B A;  1HQE A;  2DTJ A;  2JC0 A;  3C3L A;  2E1A A;  1OSC A;  2K8G A;  2PEH A;  1HQ2 A;  1UJ5 A;  1X4G A;  3HD1 A;  2MHN A;  4K2X A;  4C11 B;  4DQQ A;  1NSK L;  3LP1 B;  4ED0 A;  4B3T J;  2P9C A;  2RF2 B;  2QMU B;  1RAJ A;  2J7W A;  3I5C A;  3MZI A;  4PQA A;  4UUW A;  9RUB A;  2ZH1 A;  3BB5 A;  4DFJ A;  3FJ2 A;  3FKB A;  3G96 A;  4M94 A;  3BSS A;  4FVC A;  4JYA F;  1VQL S;  1KSP A;  1PYT A;  3R5D A;  4FF4 A;  4KGM A;  4UT4 A;  1X5O A;  3Q22 A;  1PG5 B;  2F40 A;  5J2M A;  1FA0 A;  1HQU B;  1YTY A;  4CDI A;  5DG3 A;  3I0S A;  2CJY B;  4NLO A;  1B70 B;  4LSZ B;  5B0F A;  3TW0 A;  3JSM A;  3E01 B;  2OEF A;  3OSN A;  3CE8 A;  4CO5 A;  2AYG A;  1EIY B;  3VQT A;  1OQ3 A;  3KUH A;  4WTO B;  1SJQ A;  2P2O A;  1VI7 A;  1VQS A;  4OYX A;  3IR5 B;  3HK2 A;  3GG1 A;  3IO1 A;  4B3T F;  8AT1 B;  2YWH A;  3BDE A;  2HHQ A;  3IAS 9;  2GO8 A;  4X84 A;  2VC0 A;  4USJ C;  2ASY A;  1WOP A;  4HHJ A;  4PG7 A;  4KHM A;  4LBP A;  1NKE A;  3O1L A;  2LU2 A;  2KU7 A;  2OPQ A;  2YNI A;  2JLG A;  1EAR A;  5KAK A;  1RHQ B;  2C2Z B;  1IBK F;  3CD0 A;  3N5F A;  3NNA A;  2RQM A;  1FKP B;  1OIA A;  3JQJ A;  2BEF A;  2HFV A;  5LT5 A;  2B3T B;  2ZBQ A;  3D5M A;  3VVT A;  1C4A A;  1S77 D;  4HI2 A;  4D3G A;  3W9H A;  4HUR A;  3PY8 A;  4OIX A;  3IRW P;  4PXB A;  4USH A;  3FS8 A;  1V3R A;  2KXF A;  3VGU A;  3RG6 A;  3EYZ A;  2VBY A;  4KTQ A;  1FFG B;  2BJ1 A;  1N6Q B;  2IC7 A;  2HVZ A;  2V69 A;  4PG6 A;  5DZ7 A;  1G2E A;  2BX6 A;  1ARO P;  3MPY A;  4X66 F;  2KG1 A;  1H7W A;  3QZ8 A;  1Y10 A;  1RBL A;  1DTQ B;  1H6K X;  2ZOM A;  4Y2C A;  2VQE J;  2QIF A;  2R4F A;  4FS1 A;  1N36 F;  4HUS A;  1TKZ B;  4J9M A;  1X0F A;  4LFB F;  3MOZ A;  1LNQ A;  1S1X A;  2MDA A;  4Y2K A;  1HBM B;  1CBK A;  1RBA A;  3GMG A;  3UCG A;  3WZ0 A;  2W2O P;  3HVW A;  3X1L B;  4O4G B;  1LW0 B;  1UJ4 A;  2MZT A;  1P9Q C;  4GO7 X;  4ETZ A;  5CZX A;  1KLN A;  1XHD A;  2JVO A;  3IGN A;  2PEB A;  4N27 A;  2NLW A;  3WHI A;  2QC3 A;  4M95 A;  3ENA A;  1U2R A;  3DRR B;  4MKY A;  3D6T B;  5D0E A;  3F0N A;  1M5S A;  2EG1 A;  4LRD A;  4XPE A;  2MXY A;  4KHP F;  1ITP A;  2A10 A;  2XM3 A;  4NCA A;  2FYX A;  4ES2 A;  3C14 A;  1N4I A;  2DRD A;  3KLH B;  5CYJ A;  3T57 A;  1JLF B;  2B4U A;  2FC8 A;  1U25 A;  1LWC B;  2ZBI A;  2DKO B;  1YG0 A;  3TAM B;  4ID5 B;  4HH0 A;  3UN3 A;  1F3V A;  2J8S A;  4B9V A;  1JLE B;  4R25 A;  1Z2Z A;  3TO8 A;  4AAW A;  1CSJ A;  2CPZ A;  2DNQ A;  2QSW A;  4K59 A;  4DX7 A;  5C25 A;  3WC2 A;  1A9N B;  1VQ4 S;  4ZVH A;  2PO4 A;  1HBU A;  1F3F A;  1V6H A;  2ILY A;  2MEW A;  4ZS6 A;  1K9M T;  2RVJ A;  2DGU A;  4O44 B;  3GON A;  3TAQ A;  4HYK A;  1R8C A;  2B5J A;  2GNK A;  2POK A;  4FYD A;  2WBR A;  3CVK A;  3GSD A;  3EDR B;  2VPY B;  1Q8L A;  4Y3C A;  4CNZ A;  3LUY A;  1N36 J;  3NMA A;  4HT7 A;  1U0H B;  1S99 A;  3VAJ A;  4B3R J;  3W8G A;  1L5U A;  1A6L A;  1S48 A;  2RIL A;  5DGA A;  4FF1 A;  3R2W A;  2BJ9 A;  3G86 A;  4AD6 A;  1VQ5 S;  2FVS A;  3N4W A;  3ZC4 A;  1EET B;  4N47 A;  5D3G A;  3M2R B;  3WBZ A;  1UAW A;  4DX5 A;  2W7O A;  3IR7 B;  4ZPC A;  3K5M A;  1RYS A;  2BKP A;  4DL2 A;  1VC6 A;  4ZPT R;  3FEX B;  3VBL A;  1R0A B;  2LEC A;  2NXN A;  3DM2 A;  2CPI A;  1NHV A;  4ZVS B;  1GX6 A;  4O4R A;  5LOQ A;  1SC3 B;  1Q82 T;  2HHS A;  1VDH A;  3OUP A;  3OR1 A;  4I1T A;  4RW4 A;  1X5P A;  2D41 A;  3J80 Y;  4HH1 A;  2AGQ A;  4Q8F A;  4YQW A;  3TAM A;  2EEY A;  5BYR A;  3EX7 B;  1N52 B;  5MAO A;  3OL8 A;  4X64 J;  4H4O A;  4BWM A;  1EQM A;  2YKP A;  3Q8U A;  2HGN A;  2AJ2 A;  4M5M A;  2ASD A;  2UVV A;  2VL1 A;  1MU2 B;  1FEE A;  3KG1 A;  3VBJ A;  2DGT A;  4LRA A;  1D0E A;  2OGU A;  3BN7 A;  2CJ9 A;  2MQO A;  5LMN F;  2NR0 A;  1XEZ A;  2ZJR Q;  2FHO B;  2CYY A;  3D54 A;  3QRP A;  4R5P B;  2CG8 A;  1RTI B;  1UVI A;  2X1A A;  1UWB B;  3GFY A;  3KG0 A;  3FBF A;  1S9E A;  1U8W A;  3E01 A;  2JX2 A;  1KK5 A;  1WOR A;  4HTJ A;  5T14 A;  2YPY A;  4JOU A;  4DX6 A;  1T3N A;  3W5Z A;  4U9R A;  3ZZY A;  2DYA A;  4CWB A;  3GCX P;  5AT1 B;  3D4J A;  2EPI A;  2MLZ A;  4QW9 A;  1IKW A;  2KT3 A;  2FVR A;  1X7V A;  2RQK A;  2NUH A;  5K8P A;  5KFD A;  4IG3 A;  2QYC A;  3R9L A;  1O0P A;  3OFH A;  3B6B A;  5GAE I;  4AT1 B;  2AQ4 A;  2BJ8 A;  3OFF A;  3QNW B;  3G87 A;  3H90 A;  3PYG A;  4RWW A;  5ETO A;  4DSK A;  3B4M A;  1T9T A;  3CDB A;  2XGQ A;  3Q2T C;  1BWE A;  1Y3K A;  3IA0 A;  2XCP A;  1UWB A;  1WD6 A;  1KBR A;  1IR0 A;  2DY1 A;  4RJV A;  2RRN A;  4WKY A;  1YZ7 A;  4X62 F;  1NZ8 A;  5THW A;  3BO4 A;  1HQE B;  2YH1 A;  3NEK A;  3TWZ A;  2HFO A;  1CLF A;  2WZ1 A;  2UP1 A;  1ZTT A;  4F4K A;  1VIS A;  1T7P A;  3SDE B;  2DXE A;  4P73 A;  3I3A A;  3CJ3 A;  3ISN C;  4QQB A;  2BVZ A;  4YHH J;  2F8E X;  4PKD B;  4H4O B;  4LR7 A;  3AOB A;  4ED1 A;  3VCD A;  3SFU A;  2MMY A;  2RH3 A;  3PJ9 A;  3RGI A;  1S9G A;  3R5A A;  4URS A;  2BQU A;  1PJ5 A;  3BBF A;  3T5L A;  1VRU A;  1HNI B;  3NGS A;  1PYO B;  1UCN A;  1HWK A;  2DGV A;  3DRX A;  2QKX A;  1YBT A;  2M0G B;  3LW5 C;  2LXI A;  5KFU A;  3MUT P;  1MMN A;  1LOU A;  1SST A;  3C15 A;  2OEG A;  3ISZ A;  3MEG B;  1KWM A;  4KBI A;  4BLG A;  4E75 A;  4JI7 J;  3GQ7 A;  3MPU B;  5BR8 F;  1UJ6 A;  4A4J A;  2ZH2 A;  3OPK A;  2Q6C A;  1LWF A;  3HSJ A;  5D4O A;  3NRB A;  3KJV A;  4Q8E A;  4XO0 A;  2JEG A;  4NA3 A;  4DUZ J;  2DO0 A;  3CDU A;  2ZZN A;  3DLE A;  3H8Y A;  1SH0 A;  3MDF A;  1PBU A;  5JJB A;  1IKV A;  1QAX A;  3MM8 A;  1G7C B;  4QR0 A;  3FQK A;  4RBU A;  3VGS A;  3ILI A;  4CM0 A;  3TP2 A;  2HNY A;  3FQL A;  4USV A;  1WG1 A;  5KFR A;  3OLB A;  2XUL A;  2BW2 A;  4DPO A;  8ATC B;  3W2W A;  4OI4 A;  1FWK A;  2A6M A;  4NLW A;  4U8Y A;  3M8S A;  4G1Q A;  4ED4 A;  5T7L A;  5RUB A;  2HMI B;  3H5X A;  2XO6 A;  1XBW A;  4K0K F;  2DHG A;  4DUT A;  3S7R A;  1X9M A;  3FBB A;  4LSN B;  4JI8 J;  3QJJ A;  2VIH A;  4LBI A;  4ZCM A;  2DXD A;  2F8H A;  1WUU A;  3GWC A;  4DR2 F;  2J7K A;  3CPW R;  3BN4 A;  1VYA A;  1DQA A;  2JLF A;  4A8O A;  1FDB A;  3R1L A;  1CC7 A;  1TUW A;  1RT4 A;  1HNZ J;  1N0V C;  3BSY A;  4GC6 A;  2HRT A;  4J9V A;  1KVJ A;  1R7I A;  3IXC A;  2IBO A;  3PFE A;  3TV0 A;  1W2I A;  2BE7 D;  2KYX A;  3OR1 B;  1NJI T;  3CME S;  3CCT A;  4L3N A;  1TTH B;  3CNQ P;  1ZM4 A;  2CPF A;  2CAJ A;  4R8U A;  3SEO A;  1NJW A;  1IM6 A;  2HQI A;  2RE1 A;  3OHA A;  4KR0 B;  3AY0 A;  1U48 A;  4MAK A;  4DHV A;  3VWS A;  4M8L A;  1EKS A;  4DV6 J;  4ECV A;  4EEY A;  5J2Q A;  2GAG C;  1F60 B;  1APS A;  1DY3 A;  1FRM A;  3BYR A;  5CQG A;  1ZA2 B;  1H72 C;  3V6K A;  4ED2 A;  1VC5 A;  5BXI A;  3AOD A;  1R3N A;  3KLV A;  2CNO B;  1B64 A;  3F44 A;  2WLD A;  1D8Z A;  1DQ9 A;  3I82 A;  3OFE A;  4HTI A;  1T02 A;  5A8R A;  4IR1 A;  3BGO P;  3HVT A;  5DG8 A;  3DRS B;  4WFY A;  3NKY A;  1KQA A;  3C6U A;  3CT9 A;  4DL7 A;  2W9B A;  3CJ0 A;  1TKX B;  3MD1 A;  1M5O C;  2WSE C;  2KRR A;  1TKZ A;  2UZA A;  1B0V A;  1UP1 A;  2V2V A;  3HHD A;  4DG1 B;  3GIK A;  3UCZ P;  3SQG B;  4C9D A;  4EZ9 A;  3DFE A;  1FKA F;  1VQN S;  1AT1 B;  4N56 A;  3BGR B;  3R3I A;  1FES A;  1OMS A;  1KOO A;  3QMQ A;  4A46 A;  3MMJ A;  4V19 X;  1Y0H A;  3V81 B;  1UMJ A;  2ZDP A;  2HZC A;  5J2M B;  5T41 A;  4OJG A;  3QRR A;  1Q8B A;  5CYM B;  3RBD A;  3CCR S;  4ZPW R;  4ALZ A;  1P6T A;  5DEM A;  1TMM A;  2M88 A;  3OHB A;  4PG4 A;  3TIO A;  4AC3 A;  3CDE A;  4DL3 A;  3V6H A;  3RTV A;  2GVZ A;  4ZP7 A;  1TL7 A;  3LP2 A;  1S0O A;  2CQ0 A;  3DOL A;  4L6V 3;  1KKH A;  3DK5 A;  1VHI A;  2I0X A;  3GE9 A;  4J9L A;  1FTR A;  3K17 A;  4ID8 A;  4CZC A;  4IOA Q;  3BH7 B;  2QLW A;  3M8R A;  4NZ0 A;  4NRT A;  3MCM A;  5CD4 H;  1VOM A;  3DC2 A;  3MMC B;  4AND A;  4IO9 Q;  3KHH A;  4G1P A;  2FZK B;  2OFH X;  3EM1 A;  3OTM A;  2GMJ A;  2ACY A;  3AFG A;  3M05 A;  2OEK A;  1I3O B;  2B4P A;  3US5 A;  3KJN B;  1UZH A;  1Q4R A;  2FKO A;  3PM9 A;  3IP0 A;  4A8Y A;  2EI5 A;  4DSF A;  1H7X A;  3UCU P;  4KQZ A;  4ZN3 A;  3HJJ A;  2BJE A;  1N56 A;  4QU7 A;  1UFW A;  2OPR A;  5J1E B;  2HAF A;  3M8P A;  5KOX A;  3BSO A;  2Y1I A;  4J18 A;  2UVW A;  1MRO B;  1KQG B;  2MQ8 A;  4JYA J;  1FER A;  3LGN A;  3UDC A;  4DV0 F;  4M98 A;  3LP1 A;  1NUE A;  2ROP A;  1EET A;  4TU8 A;  1WSV A;  2NQP A;  3BKF A;  3P5T L;  4K4Z A;  2Z0G A;  4YB7 A;  4ED7 A;  3P96 A;  2Y0S D;  3QGP A;  3C46 A;  4J9K A;  1V5I B;  2VV5 A;  4P7T A;  4DR6 J;  4XDC A;  3W2V A;  1WNE A;  3T5K A;  2E7X A;  4UQT A;  3Q8S B;  5HLF B;  2MLY A;  2QFI A;  4B3O B;  2AYB A;  3R2D J;  2B0G A;  2HIY A;  1SIW B;  4PWD B;  1PCA A;  4EO6 A;  3W61 A;  4FXW A;  1VRQ C;  2V0H A;  4KT0 C;  2PFF B;  2KDO A;  4EWT A;  4ZPV R;  4OI2 A;  1FHT A;  4CYU B;  2DNO A;  2X1B A;  4PZV A;  4M5G A;  5A8K A;  2JVR A;  1UTA A;  1O8B A;  2C2E A;  1M5H A;  2LXF A;  3OH2 A;  1VR6 A;  2OEM A;  2YKN B;  4X4O A;  4B3R F;  4LFC F;  2RHQ B;  1FRI A;  4P10 A;  4ID5 A;  2R7S A;  1UL3 A;  3TA1 A;  1J5E J;  2VFU A;  3PW0 A;  4K4T A;  2LXU A;  3R1H A;  3L7U A;  2ZD1 B;  2FHJ D;  2B56 A;  3FFI A;  2MZ1 A;  4HHH A;  2B7C B;  3PW2 A;  2W4P A;  5ITH A;  4N76 A;  4NEZ A;  3J7A N;  2YH0 A;  4P52 A;  2I2Y A;  2OPS B;  3L7P A;  4C3M A;  4WZQ A;  2GGQ A;  1AZS A;  1N5S A;  1U4B A;  1G3O A;  2XI3 A;  3N9U C;  4OZ3 A;  2P8I A;  1JX4 A;  2DGO A;  2QYG A;  5AJ3 F;  4DS4 A;  2NXJ A;  4HAC A;  1WC3 A;  5KG2 A;  3W2W B;  1GEH A;  1R6Y A;  4KQL A;  3JSR A;  3OR2 A;  3AOA A;  4F4Y A;  4M28 A;  2JDJ A;  2E44 A;  1UA0 A;  4IQM A;  4M5D B;  1DZ5 A;  2DD8 S;  3CWJ A;  1T05 A;  1U1M A;  3P8B B;  2K1R A;  3KG4 A;  4HVZ A;  3GOS A;  1NBE B;  3M30 A;  3OL9 A;  4Q2L A;  4ILR A;  4OZ1 A;  2YWG A;  3PHE A;  5ETR A;  2DH8 A;  2VUG A;  4X4R A;  2QA2 A;  4PCQ A;  1TP7 A;  3ENW A;  4P75 A;  3R6L B;  1T9Y A;  2HBQ B;  4KO0 B;  1YQH A;  3CD5 A;  3V2U C;  2HFZ A;  2QTW A;  3TX8 A;  3CC4 S;  4F04 B;  5CH7 B;  4MIW A;  4N8N A;  1F9F A;  3BPS P;  1H73 A;  2I9S A;  1EX8 A;  1LWC A;  2K06 A;  3BF4 A;  3TVY A;  4EFA C;  3ETO A;  3RR8 A;  2KI2 A;  1S6Q A;  3FSY A;  2V2Z A;  3MEC B;  2E5H A;  3KMQ A;  3MCO A;  4OI0 A;  3IWN C;  3MI7 X;  5ADX U;  2CQC A;  3GQ9 A;  4IDK B;  1CJT A;  3ZNJ 1;  2BXJ A;  1RU1 A;  2Y3Y A;  1R31 A;  4TU9 A;  3U02 A;  2FGO A;  1JJ4 A;  1KFS A;  3K89 A;  4OZ0 A;  4OHV A;  4NCG A;  1UVM A;  4ZIV A;  3D3C J;  3VF0 B;  4G3I A;  1B0T A;  4NXN J;  4YP3 A;  1FDD A;  2HBY B;  3HKZ D;  2MQN A;  1ZOT A;  5EX3 A;  4WJB A;  1EWW A;  1IKY B;  1LEO A;  1Q8I A;  3TZY A;  4X4V A;  1FKO A;  1N5V A;  5IZH A;  1IBK J;  4L3K A;  2EG2 A;  3VR1 A;  5G0R B;  1LQ9 A;  2MGZ A;  3AA9 A;  2CJQ A;  2BQ3 A;  1IBC B;  5I4M A;  2I1R A;  3OTO J;  3TRG A;  2E66 A;  5IOL A;  3HO1 A;  1SI9 A;  3VZH A;  1RTJ A;  4FYV B;  1C0U A;  1EKR A;  3TEH B;  3TYT A;  2UUT A;  1WEY A;  2MKC A;  1VQK S;  4DUY J;  1U6Z A;  3GYN A;  2E5L J;  5E3C A;  2X3D A;  4I69 A;  5A0Y B;  2UV8 A;  1EP4 A;  1HBO B;  3VBK A;  4FPI A;  5L9N A;  4RW7 B;  2ZC4 A;  3UPF A;  3OW5 A;  1RHJ B;  2JZ5 A;  3A8I A;  1U1K A;  1U24 A;  3DLK A;  1HD1 A;  4GRS A;  1SVD A;  2C1E B;  2C22 A;  3OJS A;  2VA2 A;  4PUO A;  3W66 A;  4U95 A;  3L3C A;  1AFI A;  1XR5 A;  2BRL A;  1AXQ A;  5GAH I;  4DV0 J;  2BW7 A;  4GMK A;  5HVF A;  3ECT A;  3QID A;  4DJB A;  3LPE A;  3NBP A;  4DPW A;  4U96 A;  4AL7 A;  3MCN A;  1HBN A;  4F4X A;  3AH6 A;  2VBX A;  1B4S A;  1J2Z A;  4MT1 A;  1IN0 A;  2R7W A;  3TAP A;  5KFY A;  4R0E A;  5SZT A;  1GAO A;  3RUB L;  1XER A;  2XAT A;  1B7F A;  2HRY A;  3PX6 A;  1U1R A;  4TVA B;  3C16 A;  2VDI A;  2JC1 A;  2YY3 A;  2GIQ A;  3QT8 A;  3T1Y J;  1WHV A;  1R0A A;  1VQ8 S;  2YWF A;  1HR0 J;  4B9N A;  4B9L A;  5IFM A;  4DUY F;  1HHT P;  3R6G B;  1XNQ J;  1BQX A;  2ZJP Q;  3TDT A;  2VG6 A;  5IC6 B;  4IHG A;  5FD1 A;  2E29 A;  2WW4 A;  4JV5 J;  3SQG A;  3RBE A;  1NB7 A;  4PXD A;  1FNM A;  2HYI B;  3RYL A;  4DCJ B;  3NS7 B;  1R0B G;  3MR2 A;  2HWT A;  5E3P A;  1IKW B;  2G0I A;  2O67 A;  2WK4 A;  1W26 A;  4G1I A;  4RBV A;  2QL9 B;  2YTC A;  4CLF A;  4J90 A;  3UNY A;  3CJK A;  2E5G A;  2MQP A;  4HI1 A;  4JI5 J;  1LXA A;  4RO0 A;  3I4H X;  3HSQ A;  2V8G A;  1N88 A;  2LQ5 A;  2VH7 A;  3BBB A;  4RZR A;  4WFX A;  1Q7Y T;  1JJ2 R;  3J7Y I;  4R5P A;  3SCK E;  3TQE A;  2A2D A;  4NMX A;  3JYT B;  2NUU G;  1LK7 A;  3J81 j;  2XY5 A;  1ICE B;  4V19 J;  1JLQ B;  2DPI A;  3MAA A;  4J5O A;  4ZP8 A;  1NDP A;  4L76 A;  4ELV A;  2G1D A;  3AHP A;  3QAE A;  2R8J A;  1E6V B;  1FE4 A;  1S1W B;  3BGU A;  1MR9 A;  4NXM F;  3GYX B;  2AJ4 A;  3M2U B;  4EO8 A;  4LQ3 A;  2HND A;  4DZD A;  3M2U A;  4NEY A;  3ZNU A;  3CC2 S;  4Z7C A;  2DR9 A;  3P6Y C;  1RE1 B;  1SIZ A;  2O3D A;  5JXS A;  5CCM A;  2CQ4 A;  2EC2 A;  2I38 A;  4G6V B;  3CGI A;  2R7T A;  3P49 B;  4DQP A;  4Q5V A;  2QFJ A;  4ZKA A;  3EGV A;  3M6X A;  1FI4 A;  1GMU A;  3K57 A;  4OHW A;  3K5N A;  3CJ2 A;  4C7Q A;  1U02 A;  2CXE A;  4OV1 A;  4OYP A;  5D15 A;  1IBM J;  4EZ6 A;  2H1Y A;  3OVS A;  2FD2 A;  5EWF A;  2R7Q A;  1Q1K A;  3H42 A;  2CRL A;  4Q43 A;  3D0I E;  1T95 A;  1RK8 A;  2B8P A;  3MM8 B;  4K8R A;  2YXL A;  3TOQ A;  2H65 B;  2XYP B;  3BR8 A;  3DLE B;  4KGZ B;  4X4P A;  4KFB B;  3FZ2 A;  4ZA1 A;  2M7S A;  5MLC V;  1QY7 A;  5I3U B;  3TI0 A;  3VZI A;  4RNH A;  4IRD A;  4ED3 A;  4HZC A;  2SXL A;  1MW7 A;  3LOU A;  4OJH A;  3VVU A;  2JEF A;  2HHT A;  1FX2 A;  1NME B;  2J8A A;  1CJU B;  2VFS A;  5J2N B;  2CJB A;  2ASL A;  2ERR A;  5D0G A;  1ZM9 A;  4KH0 B;  4A8K A;  2AIR B;  2X1F A;  2ZM6 F;  4Q44 A;  4ICL B;  3G2X A;  3LAM A;  4DFM A;  4K0K J;  4OL8 A;  2ZIT A;  4NLR A;  2GGP A;  4A8F A;  2EK6 A;  3HSD A;  1TAU A;  3HLU A;  4ZCL A;  4MH8 A;  4UQG A;  1B3T A;  2J6U A;  4NRU A;  5L46 A;  1JLF A;  2DGQ A;  2KJW A;  4KKO B;  5CYQ B;  3MMA B;  4LFC J;  2H5I B;  3QFW A;  2CVE A;  1SC4 B;  1HM0 A;  4MYO A;  2YNG B;  1DLO A;  4DV5 F;  2IPO B;  2K1R B;  1SJ4 P;  1WKL A;  1NEE A;  3FMB A;  2KT2 A;  2BMB A;  2WRM A;  4KGK A;  3RW7 A;  3BKU A;  3M32 B;  2EKY A;  4LSN A;  3ZTS A;  1VQM S;  4CO3 A;  4MIB A;  5K8O A;  2FJB B;  3PMO A;  5E7O B;  2LP4 A;  5GAG I;  4QWC A;  4URQ U;  2LEB A;  1V3W A;  1GQE A;  1O5J A;  3WQP A;  5EWE A;  1TV6 A;  3R2C J;  3KUE A;  1RWK B;  4AYB D;  4DV1 F;  1L3T A;  1NSQ A;  1YJV A;  2XZW A;  1HM8 A;  1MRL A;  2PGC A;  2WVB A;  2HIQ A;  4Y65 A;  5KFG A;  4J9S A;  1P1L A;  4DR6 F;  5IQQ A;  1ZM3 A;  4J9N A;  2HW3 A;  5AE1 A;  4D3H A;  3T6J A;  3GQ8 A;  4KPZ A;  3QAT A;  3JQK A;  4I68 A;  5LJ3 Y;  4O3Q A;  5DG9 A;  4MK8 A;  2UXC J;  5EGY A;  5DLG A;  3UR3 C;  1YIT S;  2FIU A;  3M6W A;  4O3S A;  4MKA A;  2CWX A;  5KOW A;  4CLZ A;  1ACM B;  2BJD A;  3ZFV A;  3SSQ A;  1WC1 A;  4Z7Y A;  3DLJ A;  1TKT B;  4IG0 B;  4M5N A;  5KG6 A;  2MY8 A;  5EDW A;  5E3R A;  1XN9 A;  2R2U A;  2CPJ A;  4A8Q A;  2VA3 A;  3H2V E;  2DHX A;  2PMZ D;  1UPM B;  2G2Y A;  1XNQ F;  2A3J A;  1HNI A;  1F5C A;  3IWX A;  1WEX A;  2B9Y A;  2DNY A;  2LLZ A;  2XHW A;  4N6A A;  4UOC A;  4MIA A;  2V8V A;  1Q7L B;  2IM1 A;  2M5Y A;  2XYG B;  2RU3 A;  1FRL A;  3T1Y F;  5A8R B;  2KXH A;  4DV3 J;  2IM0 A;  4DV7 J;  1S5Z A;  2FHK A;  4BBY A;  2NZ4 A;  4U8V A;  1N34 J;  1T3O A;  2KM8 C;  4DS5 A;  2C2M B;  5CAA A;  5EWG A;  1DJ0 A;  1X4B A;  3B82 A;  2XS7 A;  1IQT A;  5GAE U;  1YHQ S;  1TQL A;  3L95 X;  4MKV A;  2D7S A;  2QT7 A;  4H4K C;  3I55 S;  3CDW A;  2IJR A;  4FNH A;  4ITS A;  4QOT A;  1JXE A;  1U45 A;  4ENO A;  2DPJ A;  3QZ7 A;  1S80 A;  5DJB A;  5A6P A;  4E0D A;  3OTD A;  1C1C A;  1F2G A;  4DR1 F;  2C3O A;  2AEM A;  4OX6 A;  3H4B A;  1HI8 A;  1X5T A;  1I5O B;  2AWZ A;  4DMZ A;  5EN1 A;  3I0S B;  1ZH5 A;  4QYR A;  1KGQ A;  3M4X A;  3FSX A;  1RAH B;  1YRU A;  3NCQ A;  4UST A;  3U1N A;  2N3O A;  1IXK A;  1UFK A;  5KG7 A;  5LMN J;  3HHE A;  3GV5 B;  4USI A;  2FY1 A;  2QIV X;  1KON A;  1XK8 A;  2OPR B;  5J1E A;  2MKK A;  4OZN A;  2E5I A;  2ADB A;  5G0R A;  2GJF A;  2MGZ B;  5D0H A;  1KD1 T;  4NZ7 A;  5KFH A;  2QLJ B;  3RBX A;  3OTO F; 
#chains in the Genus database with same CATH homology
 3I3X A;  1Z90 A;  4K6R A;  2OEF A;  2W0W A;  3HHD A;  3DJ4 A;  4IHF A;  3FSC A;  3EG4 A;  5DEP A;  2P2O A;  1QRM A;  4AA7 A;  3R3I A;  2JF3 A;  5E3Q A;  2H1Y A;  2C2N A;  1V67 A;  4M99 A;  2IUA A;  2OI7 A;  4G3S A;  1KK5 A;  4KNR A;  1T3D A;  3FSY A;  2G1H A;  3H0P A;  5DEM A;  2WLC A;  5ADX U;  1YP3 A;  3TIO A;  4AC3 A;  4EA7 A;  2W0V A;  3BV8 A;  5DZ6 A;  4RL1 A;  1QRE A;  4HZC A;  5F42 A;  2I5K A;  3PTW A;  1QRF A;  3K89 A;  3DK5 A;  3G87 A;  1XAT A;  4G87 A;  2JFK A;  3P47 A;  4HUR A;  3MC4 A;  3FS8 A;  3FWW A;  4ISX A;  3TZY A;  3R97 A;  3DHO A;  3BFP A;  3IGJ A;  2IC7 A;  1OCX A;  5DZ7 A;  4E6U A;  3OTZ A;  4FCE A;  2NPO A;  3OTM A;  3BSW A;  3D8V A;  2WLE A;  4H7O A;  3HJV A;  4RR5 A;  1FWY A;  2FKO A;  3I3A A;  1SSQ A;  4HUS A;  5ADX V;  4G3Q A;  3VBM A;  2CUY A;  3HJJ A;  2JFD A;  2VD4 A;  4E79 A;  2OI5 A;  1HM0 A;  3JQY A;  4MYO A;  3FOQ A;  1QRL A;  3RGI A;  3KWC A;  1KHR A;  2TDT A;  4J18 A;  2IU9 A;  2P5Z X;  3R5A A;  1XHD A;  3SBM A;  2RIJ A;  4EQY A;  3PMO A;  3VBK A;  4N27 A;  4R36 A;  1V3W A;  2QKX A;  3BXY A;  4M98 A;  3OW5 A;  1HV9 A;  2VHE A;  4R37 A;  2QC3 A;  1SST A;  2OEG A;  4M9C A;  1THJ A;  3R0S A;  3TK8 A;  1HM8 A;  1MRL A;  4MFG A;  4E75 A;  4R7P A;  1TDT A;  3TZZ A;  3VBN A;  3FTT A;  2G2O A;  4E6T A;  3IM9 A;  1QQ0 A;  3BRK X;  4EAB A;  3ECT A;  3MQH A;  4KPZ A;  2WLG A;  3T57 A;  3QAT A;  3TWD A;  4EAA A;  3VBP A;  3TZW A;  1HM9 A;  1J2Z A;  4N69 A;  3FSB A;  3SRT A;  3MQG A;  4DCL A;  5L6V A;  2G2Z A;  2XAT A;  2IU8 A;  3KWD A;  4KNX A;  5AFU V;  4AAW A;  3F1X A;  2V0H A;  1MR7 A;  3TIS A;  3R1W A;  3R5B A;  1KGT A;  2V0K A;  1MLA A;  1QRG A;  3SPT A;  5E3R A;  4MZU A;  1KK6 A;  5U2K A;  3NZ2 A;  2G2Y A;  3TDT A;  1G97 A;  4IHG A;  3EH0 A;  4M2B A;  4N6A A;  3KWE A;  2ICY A;  1KRU A;  2AQ9 A;  4HZD A;  3R3R A;  5L6S A;  1NM2 A;  3GVD A;  1KRV A;  3R5C A;  1KRR A;  5E3P A;  4QBU A;  2OI6 A;  2QIA A;  3V4E A;  1SSM A;  3OU9 A;  4M2A A;  4IHH A;  3BSY A;  3Q1X A;  4EA8 A;  1YP4 A;  2V0I A;  3R2W A;  4J09 A;  2QJ3 A;  1LXA A;  3IXC A;  5AFU U;  3HSQ A;  1KK4 A;  3TV0 A;  4HCQ A;  2GGQ A;  3C8V A;  3EEV A;  1FXJ A;  2Q4J A;  3TQE A;  2V0L A;  1YP2 A;  2JF2 A;  1S80 A;  4E1K A;  3VBL A;  2GGO A;  4EA9 A;  3TZX A;  3ST8 A;  4KQL A;  2WLF A;  4KPX A;  4M28 A;  3P1B A;  1KGQ A;  3EZO A;  3FSX A;  3OUP A;  3D98 A;  3BSS A;  4G3P A;  3IM8 A;  1MR9 A;  2WLD A;  1G95 A;  3R5D A;  3R8Y A;  4EGG A;  2V0J A;  3GOS A;  2QIV X;  3CJ8 A;  1KQA A;  5DG3 A;  3VNP A;  3VBI A;  2ICX A;  4N6B A;  3GUE A;  3VBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...