3CJ8A

Crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
AMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransfe
total genus 55
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3cj8A03
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3cj8A02
4.10.180.10 Few Secondary Structures Irregular Black beetle virus capsid protein Black beetle virus capsid protein 3cj8A01
2QKXA 4KPZA 5E3PA 2G1HA 3VBMA 3VBLA 2RIJA 3D98A 4HUSA 4J09A 5DEMA 4DCLA 1YP3A 3DJ4A 1HM8A 1KK4A 3OW5A 3SPTA 2P5ZX 1J2ZA 4R7PA 3TWDA 2ICYA 2JFKA 3ECTA 4E6UA 1MR7A 4MFGA 3HHDA 3FTTA 5L6SA 2WLCA 1KQAA 3JQYA 3DHOA 1KGQA 2QIAA 2V0IA 2JF3A 4EA9A 3HJVA 1MR9A 1QREA 4EA7A 2IU9A 4MZUA 3TIOA 3BFPA 3OU9A 3R5BA 2IU8A 2P2OA 3IGJA 3MQGA 1V3WA 1T3DA 4EAAA 2G2ZA 4HCQA 4M99A 4G3SA 2QIVX 2OEFA 4E1KA 1KRVA 2V0HA 4HURA 4M28A 2VD4A 3FS8A 1QRGA 3OTMA 1QRFA 3KWCA 2OI7A 3KWDA 4N6BA 2TDTA 3PTWA 1HM9A 3EH0A 4IHFA 2IC7A 1YP2A 2Q4JA 3EG4A 2OI5A 3FSYA 3FSCA 1Z90A 3VBKA 4M2BA 4EABA 1HV9A 3CJ8A 2IUAA 1SSMA 3G87A 1V67A 3TDTA 3TZXA 2W0VA 4EQYA 3EEVA 3IM9A 2WLFA 2WLGA 3R5AA 5DG3A 4RR5A 4IHGA 3OTZA 5DZ7A 3BXYA 3C8VA 5AFUU 3D8VA 4E79A 3R3RA 3IXCA 3SRTA 3P47A 2G2OA 4H7OA 1OCXA 3GVDA 4KNRA 4E75A 4N27A 1NM2A 1YP4A 4ISXA 3BSYA 3EZOA 5F42A 3VNPA 4J18A 5AFUV 4R37A 1XATA 3I3XA 4N69A 3TZYA 3BV8A 3TV0A 1MRLA 3R8YA 4K6RA 4AAWA 4AA7A 4RL1A 3HJJA 2WLEA 4M98A 1G97A 3BSWA 4AC3A 4IHHA 4KPXA 3R5DA 3QATA 2QC3A 3R2WA 2JFDA 3R97A 3SBMA 2JF2A 4M9CA 5E3QA 2QJ3A 3I3AA 3VBNA 3GOSA 3KWEA 3ST8A 4G3QA 3K89A 3DK5A 3FOQA 1S80A 4E6TA 3VBPA 2OEGA 3R1WA 1KK5A 3FSXA 3FWWA 2GGOA 3FSBA 3PMOA 1KRUA 3Q1XA 3VBIA 4G3PA 3BRKX 4EA8A 5ADXV 3TZZA 2I5KA 4KQLA 2W0WA 2V0JA 5L6VA 3H0PA 5E3RA 5U2KA 4HZCA 1KK6A 1SSQA 4KNXA 2V0LA 2VHEA 3MQHA 3F1XA 1QRLA 1SSTA 3TK8A 1TDTA 2AQ9A 4R36A 1THJA 3NZ2A 2NPOA 3R0SA 2FKOA 4M2AA 5DEPA 3RGIA 3TISA 3OUPA 3T57A 3R5CA 2CUYA 3IM8A 1MLAA 1KGTA 4QBUA 1QQ0A 3HSQA 2H1YA 4N6AA 3R3IA 4HZDA 2GGQA 4G87A 4EGGA 2WLDA 2C2NA 4FCEA 3BSSA 1FXJA 1HM0A 1LXAA 2ICXA 1QRMA 3MC4A 3VBJA 1G95A 2G2YA 1XHDA 3TQEA 3TZWA 3GUEA 2V0KA 2XATA 1KHRA 2OI6A 5DZ6A 1KRRA 4MYOA 3V4EA 3P1BA 1FWYA 5ADXU
chains in the Genus database with same CATH superfamily
4B9NA 1UEVA 5DG8A 3QJJA 3W7BA 3CCRS 2W7AA 4UF4A 4ZVPB 5GAEI 1T9XA 9RUBA 1S9GB 2W4CA 3PRDA 3LPEA 2I0XA 3W2WB 3IBFB 1J2ZA 1HBNB 4YN3B 1YHQS 3IWLA 2FLLA 3HVTA 4NMLA 1HMVB 3MM9A 3I6PA 2WLCA 1LNQA 2UXBF 3I56S 1U7LA 2CJYB 1TUGB 2F9JA 3DRPB 3DI6B 4JV0A 1TKXB 1P9QC 2RS8A 1JLEB 2HZCA 4TY8B 2W8LA 3VGSA 1EQMA 2ZBQA 2YBVA 4RW8A 3MQGA 1FFWB 1TV6B 4F0KA 3C46A 3IGNA 1SJFA 1V5IB 2PA3A 1N6QA 5KG5A 3PRBA 4A8OA 1Y9OA 3CMQA 4CIOA 3ONQA 1IR1A 5LT5A 2IJFA 1Q1KA 4JI6F 5D4PA 3H7HB 2XMAA 2CG4A 3JQJA 2E5HA 2P6SA 2DNKA 1IKVB 2RKIB 1S1UB 3C6TB 1SSMA 2H5JB 3HD2A 4KR0B 1UEUA 1N33F 3JXOA 3LP0A 4LF7F 2ZDOA 4RWWA 4TU8A 1T9WA 5DG3A 3VF0B 4QIFA 1Q8KA 4IH5A 3DRPA 2HQGA 4UOHA 4USTA 2MYFA 1JJCB 4FYYB 3U1LA 1R7IA 1QAIA 1VQ4S 4PG5A 4M5LA 1L5UA 4PXBA 1SJ3P 4YOEA 1SIZA 2FJVA 2AJ1A 4RW4B 2RD5C 5HMWA 2DNOA 2KFNA 3ETMA 2K06A 4MMOA 1AROP 3I4HX 5GMEA 3DGVA 4DR7J 4C98A 2ZDPA 3R2DJ 2ZWPA 2BXJA 4AA7A 1GFWB 1LKZA 1OSCA 2HQ3A 3V81A 4Q0BA 4M5GA 1S6QB 4P52A 3DLHA 4YDXA 2GQCA 1B70B 1S97A 1WACA 2HBYB 1XR6A 1S72S 4RO0A 3PNIA 1BQNA 5B0FA 1FRKA 7FDRA 2BYCA 2BJEA 3SBMA 4M9CA 2W24A 8AT1B 1F60B 3D68A 3PM9A 3BGRA 3TEGA 2KB2A 4WFAQ 2B5JB 3GJRB 4N8NA 5IM0B 4R0EA 3IR6B 3UN3A 5F8GA 3QZ7A 2XLJA 3TAQA 1X8DA 2EWHA 2OD4A 1S80A 1FRJA 2GV1A 3LA0A 1WHVA 4RW7A 5B0AA 3KKFA 4Q8FA 1RU2A 1HNZF 3DLKA 2FHKA 4J9SA 5CYMB 1H98A 1FESA 1VJWA 2DR8A 1X4GA 2PIIA 3I96A 2Y9HA 4R5PB 1KRUA 2WVDA 2UZAA 4MT1A 5CYJA 4DL2A 2R7OA 4UOGA 3P45B 1P27B 2HRYA 4I69A 5M2RA 3KLEA 2WVEA 3I55S 3BSOA 4RLEA 3MTKA 1TUVA 4M1KA 2BQRA 2O5DA 2HZVA 1IBCB 1YJRA 2VFSA 4F0MA 3KOAA 3PY8A 1CQNA 1TFWA 4NA2A 4P7TA 2P8IA 2Y1LB 4DMZA 3OTOF 4MK8A 1RLCL 1JLGB 2GMLA 4F4XA 2M4MA 5AE1A 1UPMB 2ZBPA 1IBMF 3C2PA 4WFBQ 4OZ2A 4LBIA 1FKPA 5D0EA 1R8AA 3MR5A 1RAIB 4DR2J 4JI4F 1HWUA 2H9ZA 3G86A 2CUYA 4PPZA 4F36A 3BSCA 3P49B 1QDUB 1YZ6A 4J9MA 4AXIA 4DLEA 2IY5B 1R0BG 3FKBA 1BLUA 1KLMB 2OFHX 4MIAA 4ZVFA 5IT9U 3W2VA 4FCEA 3VBJA 3TQEA 4RZRA 3F44A 1XHDA 2V8PA 3P4UB 4K4WA 1HNWF 5C7PA 4CLTA 4H4OB 4MYOA 1TELA 3QWUA 4Y65A 1NNDA 3W8GA 3M2UA 3TNVA 2GZOA 1FDBA 2JEJA 3NGDA 1I3OB 2EXUA 3UDLA 2SXLA 2FLOA 4IH6A 1B0PA 8ATCB 3R7SB 5AE3A 4FF3A 1PSDA 5ETRA 4ED1A 2HWIA 5I3UB 1SVDA 2ZOMA 1FF2A 5JVHQ 5E41A 2DEIA 4DG1A 4MFGA 1JLEA 3BH7B 2UV8G 2EFPA 3DHOA 4OI4A 2E44A 1CPZA 4JI5J 2BE2B 2HPUA 2R2RA 4AL5A 3UVJA 3HJVA 1UKUA 1Q53A 3BM7A 3NGKA 3QT7A 4AQYJ 3T5HA 4CZCA 1U2CA 2AF6A 4KGVB 4OYZA 1ZTTA 3R5BA 2HK2A 2RQMA 4OYMA 5CD4H 1V3WA 2NPIA 5D8HB 1GXTA 2OEFA 2R8IA 1JXEA 3BZQA 5J2MB 5LMUJ 2V0HA 5M2PA 3PACA 3FS8A 2AU0A 3KWCA 1EP4B 1TVRA 2IFXA 1X5SA 3CJ2A 1HYSA 1E6YB 4C8KA 3V6JA 3OQ2A 4K50A 3BREA 3X1LB 2BV3A 2X51A 4URSA 4DU7A 3CVKA 2WLFA 2CQ1A 5EX0A 3H25A 1GTEA 1JLFB 2IJRA 4PXEA 2C2DA 1KVJA 1FWKA 4K4TA 1N32J 2V69A 4BC7A 5D15A 4RUCA 3R3RA 1QVFR 1X5TA 1LV5A 2J0SD 3K5PA 3MXHP 4H7OA 1OCXA 2CQ3A 4N5SA 4ATNA 4RNOA 1KS2A 4FXDA 3CO9A 4J9PA 2UVVA 1YSJA 1U02A 3Q24A 3EUNA 2V68A 1I94J 4C8LA 4KE5A 2W2MP 2WVCA 3BKUA 4LSNA 1TL7A 2V8GA 1FWLA 2VPWB 2QSWA 2XMKA 2JZ5A 2YKNB 2B4UA 1IKYA 3BV8A 3HLUA 1HPZA 1KP6A 1MMDA 2WLEA 2CQGA 2KHCA 1S4EA 3P5BP 1R43A 1VGYA 3DMJB 3HSDA 4K8RA 3OUYA 1SL0A 2CWKA 2B56A 2QN6B 3QATA 3M8QB 2ASJA 4Y2KA 4C8NA 4O3QA 4ANDA 4DPYA 2VG7B 1T8EA 5E3QA 2AHOB 2R3VA 3UDCA 2HQDA 1VLOA 4FXVA 4PCQA 4B02A 1UWBB 2GIRA 5E3CA 4U8YA 2GMHA 5K9FA 1M1HA 4PWWA 4CLSA 1M0SA 4NCAA 3W1YC 4ZVGA 1XMQJ 5KFBA 4B9SA 2UXDF 1HI1A 4OHVA 1RT2B 2DGOA 3GCXP 4EYIB 4QU7A 3ET6B 1S1UA 3TVZA 3H40A 1CJTB 3I82A 2MSTA 3NWGA 3PDNA 2VPZB 3FNNA 2VPYB 3UDVA 4CRJA 2LQ8A 1BGXT 3LTOA 3ILIA 3IRWP 2YNGB 2MKIA 3PW0A 2CPFA 3AJ1A 4OLPA 4ILMA 1FT8A 2UV8A 3C15A 2CJXB 4HZCA 4IG3A 2IC3B 4JBCA 3FFIA 1U0SA 1UW4A 1Y00A 3O6QA 3PEHA 3N9UC 2CRLA 2DNHA 1D1UA 4NX9A 1S9FA 3NCRA 2HVEA 2KG1A 2CG8A 3S8SA 4GVBB 1VBZA 1PC4A 4M2AA 2HNDB 5DRKA 4DR3J 3A4TA 4GMKA 3TOQA 2VQFJ 3BGOP 4GC6A 4OYWA 1NMEB 3F41A 2W9CA 4OZ1A 2CPXA 3MEKA 4RU9A 2ALZA 4J9OA 1QQ0A 1C1BB 2Z58B 5D3GA 5FIIA 2XYPB 4FXWA 4CLZA 1DTTA 1U6ZA 4EGGA 4IOCQ 1HWLA 2XZDB 1X9SA 1T02A 3MMAB 2F9DA 1U25A 2E5LF 1EJ7L 3IXQA 3PHTA 3CMAS 2NZ4A 4K4SA 2V0KA 3SQGA 2EK1A 3PYGA 3IFEA 4L3KA 1RTDB 2MEWA 5E3PA 2YNHA 3CCTA 3VBLA 4ZPBA 3VZIA 4DCLA 1R8HA 5K8OA 2P9CA 3KJVB 4KHPJ 2P5ZX 4PWDA 3DOLB 2J9CA 4QR0A 1PG5B 4OQJA 3C19A 4ZJOA 4PG8A 3DOKB 4GC7A 1B7FA 1TMMA 2Z2ZA 3BR9A 4ED0A 1WD6A 3HHDA 3AOCA 5LSRA 3HSZA 2D1CA 1C2PA 1VQMS 3LAMA 1KBRA 1S1WA 2LXFA 2W1BA 2JF3A 3TA0A 2YWFA 3AJ2A 1RAFB 3SDEB 4URGA 2NREA 2IU9A 4MZUA 2CWXA 4PRFA 4OV1A 3VR1A 1YJUA 2P2OA 4WTOB 5LOQA 1CVJA 2KRRA 4HCQA 2V0NA 3NBPB 3M4XA 2GVDB 4Y34A 2FY1A 2ASDA 2E9TA 3TA2A 1X5PA 2C2ZB 2DTJA 4F3OA 2KYXA 3H2VE 2HHPA 3R3TA 4LSLA 3SEOA 2FVCA 4LR9A 4MKVA 2FYXA 2NUHA 3MCSA 2ZH6A 2WB1D 4PWUA 3GR1A 4BWJA 2Q43A 3PO4A 4JV5J 1VCTA 1JLBB 3TZXA 2ZE2B 3W3SA 5GAHU 5SUHA 3IM9A 4FP9A 4KHRA 3TI0A 3BO4A 2B43A 1FJEB 1N54B 1XMOF 1X31C 2DT9A 2HURA 2LP4A 2FHMA 3BXYA 3C8VA 2Q6BA 4NLXA 3AXMA 3QFHA 3L4BC 2W25A 3OSPA 2B0GA 1YRTA 1IBLJ 2B9WA 2X3DA 2BE9B 4LFBJ 3GVDA 4KNRA 1K0VA 4RUAA 2GAHC 4Q0BB 4N56A 3VVTA 3W64A 3W5ZA 2KL8A 1XERA 4K2XA 5E5NA 3KHHA 1CJVB 3DMJA 1IWAA 1XBWA 2KJWA 2KXHA 2OHDA 2E7VA 2CPJA 3MECA 4CWBA 1KDNA 5HN0A 5KFCA 5ETTA 4UZBA 2Z4PA 3TANA 2EW9A 2NXNA 4N76A 3L3CA 2JLEA 4CI0B 5DG7A 5FLXU 4LUBA 4AC3A 3VGTA 4LF5J 2G9OA 2BKNA 3PJ9A 2MQOA 1NJYA 2LEPA 3R2WA 2VA3A 1TKDA 2BKOA 2ATLA 2AX1A 2HNZB 3CD5A 2KZMA 2A3JA 1JK9B 2DCUB 1XQIA 3TX8A 1TL1B 1UFKA 1WJ9A 4DR4F 1S9GA 3BPSP 1U1PA 4FKXA 4DL5A 4NEZA 5B0DA 3PEJA 3BH6B 2UUTA 4Y00A 2QE5A 2QGFB 2YQ1A 3MM9B 5KFVA 1N5SA 3O1LA 5F8IA 3RAXA 4MYUA 2UXCJ 5GADU 1BUXA 3UN2A 2HVDA 2ILZA 1YBAA 2RAQA 5IWAF 4BDPA 5A2QY 2R7XA 1Q5YA 1UZDA 3JSRA 1ACMB 4ED8A 2KRBA 2W0WA 1XJWB 2IBKA 4R5PA 2W2NP 2YNIB 3IG1A 1Q86T 4MIBA 2V9WA 3W5YA 3NS5A 4RNMA 1ICEB 1RBAA 4N8OA 5L9XA 4EO8A 3PVXA 3LF0A 3MQHA 2V63A 4O4GB 2QG9B 1JJ2R 2FIUA 3DI6A 3D66A 5FDLA 3CJQA 3KLIA 1V3SA 1FEHA 3TK8A 1FWPA 2HNYA 5A8RA 1TFYA 4FS1A 2OEKA 4RWXA 2OEJA 3EGNA 5D4OA 1U1MA 3RW7A 1FVQA 1RAAB 4DV6J 4B3SF 5HMZA 4AL6A 3Q2TC 4ED6A 2L41A 4AQYF 1Y3JA 3CJTA 3H59A 3H2LA 1XWLA 1VI7A 3JTPA 4DPWA 3CJ3A 3GYXB 4UUWA 1NSAA 4OX9F 1DY3A 1JLCB 1EX8A 3CJ4A 4JOUA 5HANA 4NCGA 4ZDNA 4ES2A 5DLGA 3SSSA 2ADBA 2IDEA 2J6UA 3SSRA 1IKVA 2RF2A 2RKIA 3C6TA 3BYRA 1MWQA 1S76D 1PJ5A 1KR4A 2FHOB 3HFZB 1T03B 3P1BA 4NXNJ 4ZN3A 1P6TA 1KQKA 2HFZA 2JRSA 2OELA 2RUGA 1NB7A 2KDOA 3U02A 1QSSA 2IIHA 3OW5A 3GQ8A 1RBLA 3GWCA 3ET6A 3H5UA 4LF1A 1NKEA 1REVB 2ICYA 2JFKA 3CT9A 1NDCA 2CPHA 2XHCA 1WOSA 3B4MA 5EX3A 1PO6A 3H98A 4I2QA 2C3PA 3C16B 4K4VA 4TQRA 2V34A 5LJ3Y 4DL4A 3SV4A 5CQGA 1YGYA 2ASYA 3AJDA 1NB2A 1MR9A 3FRZA 3ZTSA 2HMIA 4ZVUB 4ZLNA 1LW0A 4EAAA 4OI3A 3RYLA 5K8PA 1QE1B 2JLGA 3OFHA 1H3DA 2XHWA 1EIYB 1REGX 1U47A 1XR7A 2VHGA 1FTCA 3CJRA 1KVIA 4H4MA 5J1NA 1WELA 4X4RA 2XULA 4B9UA 1FD8A 1W7WA 3T6JA 4ZPAA 3GG1A 1ZOTA 5THWA 4K4XA 2UUCF 5A8KA 3MEGB 1A0OB 1RAHB 1VRUB 4NWBA 1C4AA 4AL7A 2CQHA 4O44B 1D9FA 1DTTB 2B6AA 1S99A 2DB1A 4P2FA 5KT6A 1Q82T 2VBZA 1JKHA 1N5TA 5F9NA 4DR2F 1KNZA 2ZH8A 4LBHA 2VDIA 2WTFA 1HQUA 1VS3A 1TL1A 4WWSA 2LEBA 2OMLA 4OZJA 4E2FB 4PUOA 2MQNA 3BGLA 3RRKA 1FKOB 3EX7B 3K8WA 5B0EA 2V5HG 1N34J 2ZBIA 4ZPDA 4EWTA 1WHXA 4FYWB 3GTYX 4LIWA 1S1TB 4F0HA 2Q66A 1HNVB 3MM8B 1DQAA 4KFBA 1SH2A 1WSRA 2F5GA 1Q0NA 2PMZD 3L95X 1DLOA 2WBRA 5KFSA 2E1CA 3M7VA 1MROA 4C8OA 3GE9A 3Q8PB 4CLPA 3J7AN 1A7GE 2KKHA 1U1OA 4N47A 4X4OA 2CZ4A 2BOAA 1VBYA 4KO0B 1WSVA 5F3ZA 1U1LA 4QW8A 2W9AA 2DJWA 5HJYA 3HHLB 1HNZJ 1KQFB 3GYNA 2OO4A 3AD7C 3BGUA 2B4PA 3RBXA 3CF5Q 2DNZA 4FVCA 1P1TA 1HHQA 3R5JB 3TAMB 1S6OA 1ROFA 4DV2F 4Z2XA 1D3WA 1Y7PA 2MLZA 2Q6CA 3M8YA 3US5A 2AJ4A 3LP2A 3TWZA 3AY0A 1P9YA 3BKFA 3CCZA 5A2QU 3JSMA 2HEKA 4OI0A 2AEFA 3PMOA 4E98A 4TU7A 1F2HA 2KT3A 4OI1A 1RT5B 3RTVA 1FXLA 1VDHA 4ZVSB 3E3XA 5BYQA 4FS2A 5HROA 3EZ5A 4KQLA 3H0PA 2UXBJ 3OUYB 1CJTA 3FRYA 4L6V3 4GO5X 1XMQF 4N41A 1ITPA 4EZ6A 4Z37A 3SSQA 4KH1B 4TLQA 3V5RA 2GC8A 2OJ3A 1U8WA 2OEMA 3GZ7A 4B3OB 3F1XA 1SJ4P 3GCWP 4Y2IA 2UUBF 2CQ4A 2IAJB 2F4VJ 1YTYA 1SUQB 4NZ6A 2C3YA 3PZPA 3M8RA 4ECZA 2ZZNA 3OUPA 1FTRA 1YI2S 4KGXB 2LVWA 3P6YC 1Y10A 3W9HA 2OPPB 4YB1P 1X7VA 3J7YU 1PJ6A 1R8PA 3EVOA 4I2PB 4DN0A 1E6VA 1VQSA 5D0HA 2LEAA 3O8WA 3EMTA 4ER8A 1QSYA 4JI3J 5HK4A 4IQXA 4DSJA 1OY8A 1RWMB 3N4WA 2HQIA 3JAMU 1HM0A 3LALA 5L39A 3CJ5A 3H20A 4JI7J 2XATA 5IC4B 4MYTA 4CYUA 1S57A 2RRBA 1RYSA 3ZTOA 2OTLS 3FVYA 1KLMA 1C0TA 3ITHA 2G4BA 4BC9A 2DKOB 3TVYA 5L1KA 1DARA 2RIJA 2J5AA 1S0OA 1A6LA 3LP1A 1YP3A 1JIHA 1UW9A 4DV5J 4B3MF 2HHSA 3SPTA 3AAWB 4NLRA 5KG1A 4R0JA 3KK2B 1U49A 1FKPB 2NSCA 3CCUS 3EPGA 1RT4B 1F3VA 2LA6A 2WSFC 3FBBA 3M30A 3QZ8A 4DX8H 3DOLA 3OFGA 2DH9A 4AT1B 2B7CB 7FD1A 3T6BA 1T94A 1PILA 1RHMB 2VV5A 3CJKB 1IR2A 2FLNA 1QREA 1DJ0A 1HBOA 2AJ0A 3MAAA 3N5FA 1T3DA 2ASLA 1S7IA 5IV3A 1XEZA 1YRXA 3ILLA 5C24A 1T3OA 1QRFA 5EDWA 4WFZA 4ECSA 3NMAA 2HAFA 4O3PA 2E5GA 3Q0AA 4K0KJ 2N4CA 4JI0F 2JSXA 3UCZP 2MSSA 4KSEB 3H5XA 2A0FB 2XGQA 3KHRA 4ZVRB 3MD1A 2NSBA 4TVAB 4ZHRB 2MKSA 2CVEA 1YJTA 2GQQA 5JJBA 4FF4A 3D4JA 3R27A 5D78A 3ZTRA 1G6BA 1OPIA 4V19X 1VBKA 4NZ7A 3KK1A 2R4FA 1L0SA 3OTZA 2VQFF 2UP1A 3R2CJ 3MOZA 2R7UA 4E79A 3OLBA 3ENQA 1PJ7A 1WG1A 1DAXA 1YRUA 2QZ8A 3IXCA 1S49A 1BQNB 5T41A 3RJMB 2FUG9 4ICLA 2DH8A 2BANB 3GMGA 3VTIA 4CTAA 4UQGA 1DTQB 2HWHA 2CNLB 3OTOJ 3K5NA 1S0MA 4ES1A 3N28A 4X4TA 5F42A 1SH0A 2IMOA 2AEMA 3EYZA 4J5OA 1EARA 3S6EA 4KRWA 4ZLLA 3KJNB 2ZVSA 3DKDA 4IFVA 3CJSA 3UDEA 5J2QB 1B4SA 3P96A 2HQFA 4EYHB 2QLXA 1FNOA 1RA7A 3WQPA 4X66J 1RE1B 5J2NB 1CJKA 4LRBA 5IQ6A 3QT6A 4I68A 1SL1A 3EE3A 3A8KA 3R97A 1YDLA 3IAS9 1TP7A 1S0NA 3AD9C 1NU4A 4F4WA 4WXWA 2ZVIA 1W2IA 3AQPA 2V67A 3PW2A 2F8HA 4RW9A 3UFCX 4ZCIA 3ZZPA 1GMWA 4JV1A 4E6TA 4H4KC 4DFMA 2AGPA 4DFJA 3G82A 2V2ZA 4OI2A 1F5BA 1KK5A 3FWWA 2BVZA 1RI7A 4PG4A 4EGLA 2FLPA 4C8ZA 3DLGA 4ENOA 2XS5A 4RNNA 2DXFA 4R8UB 4YR2A 4X4NA 3UQSA 5L6VA 1UA0A 2QMUB 3TUZC 3NBPA 3IR7B 1ZZFA 2Y0SD 3GFXA 5ETQA 2KN4A 5D3GB 1IBKJ 2H4WB 1R27B 4YMEA 3K5LA 4QYZJ 1F9FA 5T7LB 2DRDA 2QTWA 5H9FJ 5L9NA 4DQRA 4EEYA 1NSQA 4NLGA 4Y28C 3KFWX 3RBEA 2JC1A 2XS7A 3FEZA 2KJVA 3NOGA 4USIA 1RT1B 3RGIA 2WK4A 4P9SA 1UFWA 3RBDA 2GHVC 2C3OA 2HLUA 5LMNJ 1X9WA 3QMQA 5HVGA 4NYZA 4UQTA 4YY3J 2DEJA 3FBFA 2OSRA 3P8BB 4HACB 5KFTA 1KOOA 1RT7A 2E9ZA 1D8ZA 1DZ5A 1RAJA 3KG1A 3K58A 1FERA 2W2QP 1VQOS 3OTDA 1AZSB 1FHTA 1YBUA 1VBXA 2IM3A 3MC4A 2I2YA 2J8AA 4DV6F 3I5BA 1YZ7A 5D0GA 4EUVA 2AV5A 1X5OA 2YKQA 1RB0A 2RF2B 3ELHA 1K9MT 2QMWA 4KV8B 2HS3A 2YH1A 3ADAC 4GKKF 2D9OA 1RWKB 2GVDA 3C16A 3IWXA 1LW2B 3M6WA 4KC5A 2QMXA 4M5HA 1G3OA 2HIYA 3UN5A 9ATCB 5KTQA 1RWUA 4CP5A 4QWDA 8RUCA 4ELTA 1WKKA 4RKUC 2UXCF 4DUYF 2U2FA 3N0VA 4LR7A 4G1QB 3B6BA 2DNPA 3HMJG 1KGQA 3TA1A 1L3SA 1S77D 5ADZA 4ZLJA 5IS2A 3BS9A 4I6YA 3WIUA 3BFPA 2AX0A 4IG3B 1IBLF 1DLOB 2DHXA 3P5TL 3PKYA 4F3MA 1CSJA 3DYAB 2NXUA 4UT4A 3RAMA 1RISA 2ZOFA 4NLPA 3DDKA 5KFUA 5AJ3F 5H9EJ 3EVWA 4RBVA 4KJIA 1JJHA 4HTIA 4LQ3A 5HLFA 1SBRA 5IT0A 1XMOJ 1WC3A 4NL5A 1U2RA 4HDGA 3TR5A 3BO3A 2GA7A 1WUUA 4A8KA 2TDTA 1WI8A 4J9KA 1M90T 2VONA 4UTGA 2DXEA 2J6TA 1EKRA 4M2BA 2W9BB 3PRVA 4DR6J 2G0IA 4J9NA 2A6MA 4LF5F 2BJ8A 2G13A 3BKTA 1LK5A 1X9MA 2HYIB 3DLLQ 1AXQA 2IBOA 1GX5A 4RR5A 2XCPA 3Q8UA 3OXLA 4A8YA 3U27A 4O44A 1MU2B 1CQMA 2CJ9A 1O0PA 1YITS 1HKAA 4NXMF 4IRCA 5U47A 4LR8A 4ZCKA 4U9RA 3BDPA 1V9OA 4M5NA 4KKOA 4TY9A 3OSNA 1ELOA 1YQHA 2YNIA 4WYLA 2CYYA 2U1AA 2HS4A 3G71S 5K14B 1MROB 4DX7A 5ITHA 5HLFB 4W90B 3WX8A 5KFQA 1F3FA 1GMUA 3N01A 3BEGB 3TZYA 3AH6A 2AT1B 4F4YA 1RWXB 4OYPA 5D77A 2DR9A 2I38A 4ELUA 1S1TA 2I1RA 4R25A 3CTRA 5E2QA 1BMQB 3PJWA 1VFJA 2H4YB 4F04B 2HHXA 1LXJA 3EDRB 1NPKA 1NDLA 3D6HB 3N6MA 1IKWB 1WC0A 3OPKA 4PEOA 3MPVA 3UVJB 5KFGA 1P8GA 7AT1B 1RCXB 3WIVA 5DO2A 2ZHAA 1Y5NB 1UFLA 2OPPA 3HT0A 2JJ4D 2QJ3A 2AZ3A 3OXFA 1MU2A 1IWGA 3OL6A 2ZHBA 1AUDA 2DISA 4K2JA 4CCHA 1YBTA 3LP2B 1S48A 2FPHX 3FEXB 3ZZ0A 3PR5B 1HL6A 1B3TA 2E5LJ 2BKPA 5BYSA 5GAGI 4Q7AA 5HP1B 1ZM9A 2DK2A 3FOQA 2I8EA 3UI3A 3VHQA 3R6LB 1DQ8A 3M9MB 4OZ5A 5FDLB 4DX6A 2CPZA 4DPOA 3H42A 2KM8C 1NK8A 3T1YF 4DR7F 2KZZA 3IMQJ 3HX9A 1VR6A 2XCAA 1HW9A 3VBIA 4G3PA 3I0RB 3QGIA 2MZ1A 2IJNA 4YDDB 2EBEA 3THTA 2HIQA 1QE1A 2OD6A 2WRMA 1M5VC 1FRMA 2FD2A 5B0CA 2EI5A 3M8PA 1NKCA 2BACA 4DV5F 1QRLA 2GJ2A 3NAHA 3JYTB 1M5OC 2R8GA 3LW5C 4ILLA 3BN4A 1FJGF 4R36A 2AQ9A 1MMLA 3GG0A 4B3TJ 3RRHA 3H8YA 3ISND 4LRFA 4X4PA 4FBUA 3LUYA 1RT3A 4YHHJ 1DURA 2X7IA 4NLYA 4C0OC 3OHBA 3UNGC 1LOUA 2KT2A 2ZJQQ 1QM9A 3IM8A 2LMIA 1PAEX 2N7CA 4LF7J 3GYGA 4DR6F 4O3RA 3LANA 2CQ0A 2BJ7A 2OMOA 3W2WA 4WF9Q 2MPUA 5C5JA 1CJKB 2OI2A 4F2RA 1R0AA 2QEXS 5BYRA 3ITHB 1SI9A 5A8KB 3GJSB 3GIKA 3MGJA 2HFVA 1U09A 3OR1B 1ZS6A 4XK8C 1SXLA 3MOJB 3IP0A 1PCAA 4NLSA 1NUEA 1RAOA 3A8IA 5LSLA 1RCOB 2A10A 1DRZA 2J9DA 2E66A 3AFGA 4RW6B 2VJUA 1N0UA 3T9NA 3TJAA 5C2CA 1PGZA 4HHJA 3EICA 2PI4A 1RHRB 2KYZA 4ZP6A 1TKZA 1KOHA 2RT3A 3R1LA 4NYOA 1UP1A 5KT3A 1Q8IA 3UW1A 1VLYA 1G7CB 2XMVA 2GQ2A 4EA9A 1CC8A 3SMZA 2W7PA 2DGWA 4DCPB 3MEGA 2DHGA 3CIMA 3DCAA 2WCXA 2QLFB 3TIOA 4WP8A 1SL2A 2XLKA 2ABYA 3LP0B 5I3QA 2ZJRQ 4IFVB 4NEYA 5K20B 4V1Ak 5ETVA 3UR0A 3KLGA 3T1HJ 4HKQA 3GJTB 3HVRA 1HR0F 2AWZA 1KRVA 3DOMB 2E1PA 3ZC4A 4PYDA 4TU9A 4M28A 3G8SA 2V4QA 3OTMA 2XTJP 4DV2J 4DFPA 2OI7A 1NPPA 1VMBA 3J81j 2H54B 4ZK7M 3K17A 3PFOA 1SC3B 2POKA 2Q4JA 1RT5A 2VKRA 2VG6A 2OI5A 4EABA 2BE7D 3DLEA 1LFWA 3M6VA 4MH8A 2AIRB 3MPUB 2IUAA 3CC2S 1IM4A 3D5MA 1HI0P 4AUKA 1Z2FA 3EEVA 4TXSA 3QFWA 4RBTA 4WKRA 4I2QB 1SV5B 3M2RB 2OPQB 4KGZB 4DCJB 4CO2A 2KT5A 4ZITA 3LH2S 4ZHRA 2MZJA 2ZC4A 2PO4A 1TKTB 4CNYA 4RPFA 4WJBA 2G2OA 2VKZG 2F4VF 3HHLA 4E75A 1JWWA 1X0FA 3EGWB 4LSZB 2FVQA 1T9YA 3VALA 2FJWA 2QL7B 3JAMY 1B64A 2JVRA 3DRRB 1QAXA 3OXGA 1U24A 3M1VA 2B9YA 1RADB 3MMJA 4ID8A 1LWXA 4OJGA 5J1EB 3KLHA 2AD9A 2V4JB 2BQUA 2GW8A 2V94A 1RBOB 4FDFA 2GNKA 4K6RA 2WW8A 3EM1A 3W2VB 2YKNA 4E8UA 4X4QA 2AYGA 1W25A 2K3KA 1EHWA 1S59A 5LMNF 4USUA 1YX2A 3R9LA 1SKRA 4IOAQ 1C1CB 5HVFA 2KG0A 4OFZA 4B08A 1WC1A 1WEXA 4G6VB 2CJKA 1T0TV 4I2PA 1Q7LB 1T3NA 4I56A 5B08A 4WP9A 2HRTA 3T9ZA 4KO0A 1RT3B 2D3ZA 3O5TB 4DSEA 3HJFA 2APOA 2CJAA 3K2YA 2E5IA 4HH1A 4CNZA 1RTZA 4QIEA 5L1JA 4JI5F 4MKYA 3O3LA 4LFAJ 2ACMA 2IAJA 4JI2F 4IG0A 5KFIA 1K73T 4OJHA 3A1YG 5D0RA 4CLUA 1RK8A 2LQ5A 4KFBB 4QU6A 2Z0GA 1T9VA 4A47A 5KFFA 1TUWA 5ADXV 1ZAWA 3QIPB 3HM9A 3MM7A 5AXKA 5KG7A 2XMWA 2V0JA 3NLCA 3Q86A 5F8NA 2B7BB 5I42B 1U1RA 4K4ZA 4DV3J 1KK6A 2KTQA 2F40A 3I0RA 1SSQA 2BMBA 3QO9B 4O3OA 4RNHA 4ZPCA 2QYGA 2LQJA 1Q4RA 2O66A 1K8AT 1GMWD 5KFNA 1FE0A 3HT3A 1SSTA 4GRSA 5DEPA 5D6GA 1IQTA 1Y5LB 3MR7A 2AZ1A 3QLHB 1OY6A 2C2KB 3C6UB 4WK1A 1IJFB 5KT4A 2D3UA 3QIDA 4WIQA 1S9EA 1YJ9S 2DR5A 3KTQA 4TQSA 2BJ9A 2DGQA 2MZTA 2W2OP 3L09A 3A3NB 1TL5A 3QAUA 4U67Q 5I3UA 3RB0A 1FDNA 4DQIA 4LFAF 4OX9J 4G87A 1X60A 5E7OB 4C7QA 3MFIA 4AXJA 5HROB 3J80Y 3CPWR 1PIEA 5HSPA 3OJSA 2ICXA 3FCVA 3IN5A 1QUVA 2XBPA 3FQLA 1B7YB 2RE1A 3A13A 2FZKB 4NPOA 5CZXA 5L38A 5KFEA 1CS4B 5LXRA 3PG9A 4Q2LA 3ETOA 4ZP8A 1TL7B 4PKDB 5LXYA 4XDDA 2BR0A 1FRHA 2HMIB 1VYAA 2JEGA 4IR9A 2H65B 4RU2A 3NS7B 5KFXA 2RDDA 5KFJA 4IH7A 5GMKa 4DF8A 1KK4A 3IWNC 3BBFA 1CJUA 1OPZA 2AP6A 2WZ1A 4Z7CA 2DY1A 1H7WA 4A48A 3VAGA 3ECTA 3ILJA 2WBMA 2FY8A 2VG7A 4X62J 4QIWD 3M2RA 1U48A 2QA4G 1O8BA 2OPRA 1LK7A 3M8QA 4CLLA 3MAHA 3F73A 1AUSL 3H5YA 1TK8A 1TL3B 3EXCX 3EVMA 2O01C 2BA9A 4WPAA 1EQ0A 4KT0C 3OH0A 3CC7S 3QWPA 3CW2C 2H5EA 3T19A 4UY85 5F8LA 3KHLA 5ETPA 4G3SA 2R8JA 3G6YA 4JB8B 2J76E 2YVSA 3C8YA 2ZH9A 5K8NA 2VD4A 4CH7A 3HD1A 3KK3B 1N88A 2KVQE 3EH0A 1FE4A 3V6KA 4EI2A 4F8RA 2HZAA 2X3GA 4EBCA 1UZHA 3OTEA 1HBUA 1MN9A 1HNVA 3MM8A 2KM8B 1B0TA 4FF1A 2XO6A 5KFKA 2DR6A 4WFYA 3TUPA 2DCLA 3W62A 4DS5A 4Q2MA 4JYAJ 1TZ0A 4IHGA 1NZ8A 3CDWA 1KFDA 4RW7B 1TL3A 5D4LA 2PDAA 1F9HA 2GHPA 4MKAA 1VOMA 2ZH2A 1PBUA 2QA4S 3TQ1A 1S0VA 2MY8A 4PYAA 4P74A 3OL7A 2FHJA 4ZKAA 3W60A 2AJ2A 4CO0A 1JLFA 2YH0A 3UE2A 2DHSA 2FJAB 4M5MA 4ISXA 2CQIA 4NLOA 3DHWC 3D0GE 3FJ2A 1Z1ZA 2OFGX 4PXCA 2YX7A 3TV0A 3RAQA 2DIVA 2COLA 3HCXA 4QPTA 3GIIA 1UJ5A 2C3UA 2WW4A 2ZHOA 3CIZA 1LEOA 4F7VA 2ZH1A 2DXDA 2EK6A 2RRAA 4QIGA 1NHKL 3AB4B 2C2EA 1GH8A 2QC3A 3VAIA 1K1QA 2JDJA 3TJ8A 3GV7B 2J6SA 2JFDA 4ILRA 3PIOQ 1ZH5A 3KG4A 1F0XA 2AGOA 4HACA 3PKMA 3VBNA 3THVA 2M7SA 4DSKA 4JI7F 1RTHA 4LF4J 1ZETA 2ZUAA 3A8JA 4HVZA 3QLHA 4EU0A 5IXUA 3V4IA 1I5OB 4OHYA 1JLQA 4JP8A 2BUNA 2GFFA 1VRQC 2VF3A 5C42B 5KT5A 2PEHA 2XC9A 2RJZA 3MEDA 3NCPA 5HAOA 2KHDA 4YQWA 3RB3A 4PQUA 3Q1XA 4WIIA 1EETA 1SJQA 2M8DB 4DQSA 1FNXH 3BR8A 1CEZA 3TZZA 3CDAA 1FK9B 4A8QA 1OWXA 2LDIA 3DYAA 2VIHA 1CS4A 1UJ6A 4KNXA 2VHEA 4OHXA 1IM6A 3RZAA 1N34F 1OJ4A 3OLAA 1FX4A 3M9OB 1N36F 4M95A 4KGMA 2FJBB 3KUHA 4J37A 5KFRA 3GJQB 1N0VC 3I87A 1GK8A 2OGUA 2ZKUA 3NZ2A 3R0SA 4IOBA 3VV2B 4U7UK 2LECA 1NK6A 1M5SA 3TO8A 3T57A 3OFFA 1D8YA 4DQPA 3OH4A 1LWEB 1S6PA 1X4DA 4OHZA 2C2OB 2R2SA 1HNXF 2FVPA 2KXNB 3SQOP 3J80U 3JTOA 2KFZA 1FJCA 2AYBA 3UCGA 2E7WA 3PX4A 2L48A 4DXLA 4DWIA 1LWCB 2UUCJ 3KLFA 4ELVA 1FXRA 4QYZK 1S12A 2RUSA 5J2NA 1RHUB 2P5VA 4QR1A 2EVZA 2L08A 5KG0A 2W9BA 3W5XA 4FN5A 1G95A 3OGZA 3NGRA 1HHSA 3GB0A 2XY7A 3VAFA 5K14A 2JVOA 4RX6A 4M8LA 2KFYA 4FYXB 1WHYA 2QRRA 3PW5A 1HARA 1H2UX 1X4HA 5HL7Q 3DJ4A 1HM8A 2M3DA 2PC6A 2NUUG 1W26A 1PYOB 3H5SA 3IBWA 3NRBA 1HMVA 4KY3A 1TU0B 1VK3A 5A6PA 3MUVP 3DRYA 2FTRA 4Y2MA 1LWEA 1NZAA 1S6PB 3IGVA 1VRTB 2RSQA 3KLIB 5HBMA 2XNRA 4GO7X 4PABA 4C0BA 2Q3PA 3HP6A 4OV6A 3Q89A 3J7ZT 5EWGA 2RQKA 3JSBA 4WXOA 3GLJA 3T1YJ 1SH3A 1ZZNA 3Q8SB 4DV7J 3HKWA 1UA1A 1F6TA 3QNWB 4E1KA 5CD4A 3KLEB 3DLEB 1TK5A 1UL3A 1QRGA 2DD8S 2FJDB 3RG6A 3M2VB 1IKXA 3OR2A 3CXCR 3N79A 4L74A 1D09B 3KWMA 3PTWA 4CO1A 2DNRA 4YEAA 4EK2A 2NPFA 2W8KA 3FSYA 2QX0A 4NLUA 2RILA 5MAOA 1QAJA 3UD5A 2IRUA 3CDUA 4ZVEA 4ERDA 3R5AA 1VHFA 2HLTA 3DGPB 3PYEA 1BXNA 3TVKA 5IT4A 3G6VA 5HMYA 2R7WA 3DLJA 3B8HA 3JYTA 2ZOGA 1FKAF 1JLBA 2A2CA 4FBTA 4IFYB 2DNNA 1Q8LA 2P6TA 2ZNYA 3GQ7A 4P2MA 3PHEA 3KMSA 2BM1A 3FQKA 1R6VA 3H90A 3CCSS 1N36J 2YNGA 2F7VA 2VBWA 4A8FA 5G4DA 3HF5A 2IM0A 2HVIA 2W4PA 4IG0B 4O4GA 4N69A 2XZWA 1TR0A 3QO9A 4KGKA 3FUYA 3R8YA 1TV6A 2CZVC 2KU7A 2H3EB 2R7QA 2N7YA 2F65A 2FZCB 4M98A 2XWXA 4TYBA 3J7A1 1NCLA 1QVGR 3PV8A 1VISA 3HI9A 2HGNA 3ZXWA 2JWNA 1RACB 2PA8D 1K0TA 3ILOA 4C11A 2MHNA 1KFSA 3K59A 1A9NB 4YB6A 2DVIA 2Z2MA 4DR4J 2VG5A 3GQAA 2CPIA 4MK9A 3V6HA 2VC1A 2C1EB 2GJFA 2MJUA 3N6NA 1U45A 2CQCA 2HAIA 3QAEA 1NK5A 3KNGA 2P9EA 2RH3A 4A4JA 1HWIA 2FDNA 1FDDA 1TKZB 4GVBA 2ZH7A 2A2DA 3R1WA 4CYUB 3D9BA 2V50A 5I42A 2BABA 1RABB 2DR7A 4ZS6A 4A8XA 4EA8A 4P10A 3R5GA 4KPCA 4DL0C 4EO6A 3PYDA 5E3RA 4H4MB 5F8MA 2MB0B 3BPDA 3GSIA 1EETB 3MMBA 3HHNB 2OLWA 5DLFA 3MPDA 4D3GA 2J0WA 2G1DA 2DY9A 2HFOA 3MMAA 1R0AB 1PYSB 1SPBP 3OW2R 2XY6A 5CCMA 3LGNA 4CO3A 1XTZA 1WDTA 3A3PB 4WK3A 5AJ3J 3LPYA 3AD8C 1BQXA 2Z8QA 1N32F 1TMJA 4C3LA 1CG2A 2Y8YA 3H4BA 2WVFA 4DV4F 2HNZA 4F4ZA 1XMBA 4O23A 3ZZTA 3TYTA 2VA2A 2JX2A 3M8SA 4RW6A 3QSYB 1U1QA 4ZJLA 1MW7A 3QSIA 2MJNA 1EP4A 1TVRB 5F9LA 3C3LA 1KKHA 3GFHA 2Y8WA 1IKWA 1LXNA 2C2MB 2CQ2A 3FBEA 3RB6A 5DZ6A 1JNZB 2E7XA 1QRMA 3VCDA 4OYBA 2XI3A 3TZWA 4IKAA 2M2BA 3BYPA 2MKYA 2HHWA 3FEYB 1WTFA 2FQQB 4QW9A 1FWYA 2XMMA 4FVMA 5F0UA 3IRXB 3SUCA 1H73A 1V3RA 4CO4A 4JI6J 3UWTA 4G65A 4OYOA 3G2XA 1YG0A 3OVAA 1NKBA 2B3TB 3D3CJ 1WC5A 1KSPA 3T5JA 4ECWA 4DG1B 3PW4A 1UVNA 1D0EA 2ZH3A 1HQEB 4AFFA 4KBIA 5HQ8A 1HLWA 5KFZA 3KHGA 1N5YB 2XI2A 3CD6S 3V2UC 2JC0A 4XPCA 2J8SA 1L3KA 4MIWA 3U1NA 5J1PA 1J5OB 4LFCF 2WB4A 3AA8A 2GIQA 1U0HB 3DRSA 3I0SA 4NA1A 3OU9A 1NDPA 3M8PB 1S1VB 3DFEA 1KHWA 3GSDA 5T7LA 4YR0A 4DV1F 3W8PA 1XNQF 2K1RA 4BBYA 1SQGA 5DDOC 3MR2A 4NZ0A 1U2FA 4W98A 2BW2A 2QA2A 4FPRA 3TUJC 4N6BA 3PCOB 5KFMA 1SC1B 3KLGB 2ROPA 1FKOA 5A8WA 1R3NA 1YP2A 1DBDA 3KUGA 2MGZA 4LF6F 1BY9A 2MKJA 1HNIB 4C4WA 3K7RA 3J7Z5 4JV5F 4M63A 5EGYA 2F8EX 2NS1B 2HBRB 2QLJB 4RUBA 4X4SA 4QWAA 2EC0A 1LWCA 4NE9C 3J81Y 2N3OA 2ZKTA 3CCLS 4HT5A 2VICA 3NCQA 3DU5A 3MMCB 4KAIA 4QOTA 5DZ7A 2W9CB 3LQVA 4KHMA 4C9DA 1HBNA 3D8VA 2KH9A 4I67A 4ALZA 2L9NA 2DPIA 2VZ9A 2I5JB 2CIMA 4WBFA 5J2PB 1XIQA 1NJIT 2HHHJ 1P1LA 2P2CB 3NS6A 3SZ2A 3BQ0A 2PD1A 2FC8A 2OUGA 4G3IA 1XN9A 2V2VA 1Y0HA 2ILYA 3A12A 3GR0A 3HHEA 1KN6A 2CDQA 2PFDA 5A8WB 1B0VA 4URQU 4B17A 2V8DA 2MGZB 2DNQA 2V2KA 1T9TA 1XNRF 4ED2A 2MHEA 2OAUA 3VAKA 1M5PC 2D3OR 5HATA 4OJ1A 3PJXA 1HBMB 1C0UA 4NMXA 3OH1A 4JI2J 3QT5A 2MKKA 1JMTA 1IUJA 3D7SB 1UVMA 3I31A 4ID5B 3ZNUA 1S1VA 1QTMA 4KTQA 2B8QA 2MQ8A 4P2SA 3PW7A 4DR1J 1QUPA 3NNAA 3EZUA 4EMDA 1C1CA 3KK1B 3EXYA 3K89A 1UJ4A 1WG4A 3DM2A 4B3OA 2KVIA 3W65A 4ETZA 5A8RB 2FVRA 2YY3A 1GMVA 3HVAA 3ENAA 2CVIA 3JQKA 3K8VA 4UZCA 3DXBA 3F56A 4ZVQB 3BRKX 5L8RC 1KHVA 4I64A 4ED3A 4CQ1A 2HHVA 5J2MA 3CWJA 4H54A 5B0BA 2AKWB 5DDRC 3NGTA 3PR4A 4XO0A 2YNFA 4K0KF 4NXMJ 4C3KA 3CE8A 1QJHA 2MZQA 2QA1A 1UVIA 3E01B 1HD1A 4NA3A 3S1TA 3MZIA 2EPIA 1IXKA 1THJA 1HR0J 1RTHB 1S6UA 4L76A 3V6DB 1I6JA 1CC7A 2LQ9A 2LYVA 1VK8A 2R2UA 4CLFA 1VIOA 1PBAA 1Q5VA 3FZ2A 2L3MA 4OIXA 3KYLA 3Q23A 4ECTA 1V3ZA 2B5JA 1EAYC 4BLGA 1KD1T 2K2PA 3B4DA 3HSQA 1S4FA 1NH7A 1NPRA 1IKXB 2MQQA 2LDYA 5DM7Q 2Y0BB 3D6FB 2UUBJ 1HBUB 2PT0A 2E29A 3FMBA 2UU9J 3NGUA 1KRRA 1JNRB 2Y1RI 5KFOA 1HBOB 2IVFB 4QYRA 4B3RJ 1FVSA 3DDIA 4KPZA 5DJBA 4HUSA 1VQYA 4OJ3A 2PEBA 4HH0A 2DH7A 1WF2A 1JQGA 1RGVA 2LCWA 1MSWD 3C6UA 2QV6A 2XNQA 2ZFHA 4ZVOB 3DOKA 5JVGQ 5L6SA 2HWTA 3I0SB 1FRIA 2V0IA 5ETKA 5HJXA 4DZ6A 2EBGA 1FEEA 1SKWA 4GKJJ 3GP9A 1G4CA 1WEZA 2IU8A 1SQEA 2ZC3A 3N6LA 3NXZA 2Q1LA 4C97A 1RHJB 2BRKA 2O67A 4B3TF 1FJGJ 5KG3A 4D3HA 5GADI 4WFXA 1R89A 3DLGB 1AFIA 2AYMA 5ETMA 3NNHA 4LSLB 4Y3CA 1AFJA 2BANA 4TNOA 5CA5A 3DDNA 3EG4A 1ZBTA 4HHUA 3G87A 2RHSB 3CJ8A 4LJMA 4AE5A 5EN1A 3TDTA 4DV0F 1BWVA 2JH3A 3MM6A 4EQYA 1Y3KA 5G0RA 2HS0A 3MWBA 3CCJS 1IJEB 4HI1A 1QAYA 1HI8A 3LO3A 3UR3C 4DJBA 5HBMB 1URNA 1N5QA 4P2XA 2D3O1 2HGMA 3OBIA 2OPSB 2QLWA 5JXSA 1RT4A 2RB7A 4C8MA 4X65J 1HA1A 5BR8J 1RT1A 4L72B 1FO1A 2GO9A 4DL7A 2LFVA 4WYWA 3Q83A 3NAIA 4YP3A 3BSYA 4O3NA 2HHTA 3LGMA 4LQ9A 4W92B 4USMA 3MECB 4LVOP 2NCKL 5DGBA 2N82B 4NASA 2YX4A 2ZITA 2PI5A 1N4IA 4PR6A 2ZZTA 1KLNA 2K7KA 4AAWA 4MAKA 3GILA 2VFRA 1WDDA 2HSEB 2M52A 1M1GA 3W9JA 3M9NB 3JB9k 1SCJB 5E33A 5DQIA 3BSWA 1M5HA 2IYIA 4LMZA 2ZM6F 4KPXA 1BQMA 4MK7A 5T14A 1VC0A 2F3JA 3MPWA 1FX2A 2F4FA 2HVZA 3Q22A 1YJNS 4QCLA 3HZGA 4ZVTB 3THPA 2R9LA 3PX0A 4TY8A 4Y0FA 3ST8A 1JLAB 2GO8A 3AQOA 4DR1F 1TKXA 2Z2LA 1RYRA 3OVBA 1DHMA 5LM7E 3TW0A 3OL9A 1YJVA 4BHQA 4LBPA 2EFQA 3VBPA 1RHQB 1AW0A 3SIPB 3ULHA 4U7CA 3GV5B 1VQKS 2FJEB 2EFNA 2Z57B 4EFAC 2H5IB 4X2BA 5EHHA 2UVUA 1M8NA 2BEFA 1KONA 5F8JA 4ETXA 1RWWB 1H0HB 3UNYA 2R7VA 2YXLA 2CADA 4ZN1A 2LU1A 1OMSA 4YUDA 3R1HA 1RDRA 3EJMA 1E6VB 4C3MA 4NXNF 3IS9A 1S1XB 2EC2A 2EKNA 3VVUA 2YWEA 4P71A 5C2GA 2GMJA 4ZA1A 4G1PA 2A1BA 4PPDA 3JTNA 5IOLA 3I4PA 4L73A 3A3OB 2C28A 1DFDA 2HKEA 3EDQB 1NAQA 2B4OA 1XNQJ 3V4IB 5CXTA 3HO1A 4JI8F 4AD6A 1UMJA 3E01A 3M32A 4B9TA 5RUBA 5DG9A 2N4DA 1SJ1A 4L3NA 2YX1A 3DU6A 1PYTA 2MKHA 3I9ZA 1KGTA 3LP1B 2YKMA 4DN9A 2R42A 5KT7A 2OSQA 1CJUB 2CQPA 3C15B 1LW2A 1SQFA 3R3IA 2GAGC 4MKBA 4IO9Q 3HK2A 1FJ7A 1HBMA 3V81B 4NRTA 2C2NA 5IWAJ 1BC6A 1FXJA 3GQ9A 1LXAA 1K44A 5CYQA 4HLBA 3VGUA 4DBQA 4ZIWA 5LJ5Y 4ZJQA 4DV4J 4FF2A 2OH2A 4USHA 2CQBA 2R7RA 2C22A 2CPDA 1FD2A 2DGXA 4DUZF 4N77A 4USKA 4P72A 3BJYA 3HHLD 2GVZA 4DV1J 2CPYA 1WTBA 5DEMA 4J9RA 1RXOB 2MXYA 1QTNB 1TAQA 1C4CA 2CNOB 2PN6A 4LREA 4F26A 2D7SA 3OJUA 4E6UA 1MR7A 1KVKA 4HHHA 1GT8A 2JOQA 5DS7A 4CH0S 3KJQB 3BSNA 4YY3F 4B3MJ 4ZPVR 4K7QA 1K47A 1VQ5S 2YNFB 3O2IA 1WOOA 2ZEJA 2F63A 2ERRA 2VODA 4LRAA 1NO8A 4M99A 5HMXA 4KQZA 4RBUA 3E8OA 4ZPWR 2C42A 2XQCA 4WFNQ 4J9QA 1K1SA 4QQBA 3CCES 1JLCA 3KWDA 3QT8A 4NI2A 2BX6A 2H51B 2IVMA 3D1OA 2HVHA 2IC7A 1PKUA 2BJDA 4F02A 3CDBA 3UPFA 3FSCA 3VBKA 1Z90A 3ICLA 2WOMB 5F41A 3SCKE 4DUTA 1N48A 3SDEA 2W0VA 3ZTPA 1EB0A 3RUBL 2FC9A 3F0NA 1NHVA 2AMCB 1JKHB 4ES3A 1HD0A 2WLGA 4CO5A 5FJ4A 3SI8A 3FCHA 3GIRA 2B6AB 2YKPA 2M8HA 3AOBA 1RLDA 1UAWA 2FVSA 1YJWS 4JI8J 2UUWA 4CT8A 4F50A 1HQUB 3NL0A 3PFEA 1REVA 2IRYA 5D4NA 5ETOA 5IFMA 1HYSB 1HNXJ 3QRRA 1U6FA 2J9EA 3B78A 5IC6B 1X4EA 2DNLA 3IO1A 2D9PA 2QT7A 1H72C 1T9UA 2GVZB 4Y6IA 3VNPA 2FGOA 2XB2D 4XDCA 3ZZZA 3GIJA 2EFVA 4I0WA 1TTHB 3S01A 3FFIB 3QBCA 3SFGA 3OV7A 1HHTP 1LW0B 2ZH5A 1U1NA 4DL3A 2J0QD 1G97A 2DGTA 4CM2A 4M94A 3BF4A 1GEHA 1R0CB 4IHHA 4WTYA 1Z4UA 3R5DA 3C14A 3S7RA 4CLYA 1UCNA 3NG8A 1KQSR 2RQ4A 3CC4S 3P3DA 2MMYA 1NRKA 1J5EF 3WX4A 1FCAA 3MMCA 1AYEA 2VQEJ 3OH3A 1YJ7A 3A8EA 3Q8YA 3HFKA 1FXDA 4PZVA 4A8SA 3RW6A 2C3MA 3QRPA 4M5DB 3TAMA 1ZPWX 2D74B 4LRDA 1NH8A 1SV5A 2YWKA 1ZM3A 3AT1B 3CCVS 2ZD1A 1HQEA 3CSKA 3BGFA 3MCNA 4DCOB 4DLGA 2ACYA 1WC6A 2GGOA 2MZRA 4I6AA 3CMES 2CNNB 3VAHA 4A8WA 2LQBA 3D1HA 3IS9B 4IUFA 1FRLA 1RA6A 2CJBA 2FGCA 4KV8A 2EFGA 4QWEA 4J90A 5JMNA 1CULB 3MM7B 1APSA 1RT7B 1R8CA 5KFHA 1SC4B 1H7XA 3NEKA 3T41A 1KRPA 4JI0J 2GIFA 3UCUP 1RQ0A 4KIAA 1NJXA 4DI6A 1SC6A 2GS8A 2EG2A 1AZSA 2HBZB 2V6AA 3I5CA 4BWMA 1J5OA 4QR2A 4B9LA 2BE2A 3G6XA 3H4DA 2IA0A 1J5EJ 1IVZA 2ALYB 2ZBCA 1I51B 3CCWA 3QYYA 4TKTA 4ZLPA 3HPOA 3GONA 2NXJA 1ZPVA 3ENWA 2YWGA 3TARA 3D54A 4Y2CA 1S79A 1NSKL 2W2PP 1H2TZ 1IQZA 3PXGa 4ECYA 1I1GA 3BGRB 4USVA 2HFNA 1WHWA 3IG1B 1QLNA 2VFVA 4F25A 1N5VA 4UOFA 1BQMB 1LFPA 2YNHB 3KMQA 2GJIA 2E9RX 2XSFA 3ENVA 3FK4A 4WP3A 1R8BA 5CYMA 3VZHA 4DPUA 3V4EA 3TUIC 4NI2B 3JSYA 3V4MA 2QKXA 1UVJA 5AT1B 3QIPA 2LXUA 2VBYA 4J09A 3R7BB 2K1RB 4TYAA 2BJ1A 4PAAA 5SZTA 3TWDA 3M30B 1WORA 2DBBA 3FCWA 1GAOA 1KQGB 1KQAA 3JQYA 2NYHA 3SCJE 1HFEL 2HNYB 4OHWA 4ECQA 3CJ0A 4F67A 5B09A 3CD0A 4HL9A 3D6MB 3Q8VA 3G6ES 2N3LA 4F4AA 1ZAXA 3MMBB 3D2WA 1FA0A 1ZA1B 1RWPB 3CUNA 2F1FA 2YWWA 2QIVX 2IC3A 4HDHA 1Q78A 5ETLA 4HURA 4YB7A 5L1IA 4K5RA 3IRXA 4QJVA 4RUHA 4IDKB 2PMWA 3MI7X 2CJQA 4CLKA 3DLBA 2RRNA 3EPIA 3CB4A 1AT1B 2V2QA 1HV9A 2M0GB 2MDAA 3QRQA 2B51A 4X4UA 2X1BA 3DRRA 1OYDA 4RW9B 2ZUGA 4OX8A 2MQLA 4DQQA 4LF8F 3MM6B 3GIMA 1WWHA 2RQCA 2YWHA 2CFXA 5CZVA 5DDQC 3NMRA 1NDKA 1O51A 2XSJA 2OPQA 1G2EA 3CCMS 4YB5A 3QGPA 2C2RA 1NM2A 3NOCA 1GTHA 4X64J 2V8HA 5CCLA 4USJC 1W2BR 2ZE2A 1O5JA 2V4RA 1S10A 4NRUA 1XATA 4I1TA 3D1QA 1CBKA 2VOPA 3SCIE 1HPZB 4DUYJ 1JXVA 1U4BA 1WNEA 2K7JA 1YKWA 2I9SA 3AXKA 3QPIA 4MFBA 2P9GA 1UVKA 3D6TB 2QFIA 3R7NB 5IV4A 2Y1IA 2GCFA 2Z2YB 5LSOA 1LWFA 4GKKJ 3D0IE 3GQCA 5JUMA 4LF9J 4K4YA 2NQPA 3VQSA 2O3DA 2JF2A 3FZBA 2GX8A 3HHKA 4J9UE 1WG5A 1FI4A 3I3AA 2ZBRA 4UUXA 4KB7A 1TK0A 2YQ0A 3KWEA 4WU3A 4N7TA 3BBCA 1C0UB 2DGUA 2NYIA 4ZCMA 4UW2A 1H6KX 2OKQA 4K5SA 4Z7YA 3UD3P 1JLAA 1N4LA 1VC6A 2QIFA 3WC0A 1NXIA 3TJ9A 3OR1A 2W7OA 1NBEB 3T5LA 2JL9A 3KJVA 2CKWA 4ITSA 1RWNB 1NJWA 2DNMA 2XS2A 2UUAJ 2DGVA 2J0XA 3L7OA 1VIXA 2ROEA 2V4JA 2BZ2A 3ZO7A 4JI4J 2CAJA 5GMDA 1CJVA 1VQNS 3MDFA 2BRLA 2O1PA 1X4CA 1S1WB 3JSMB 5LMUF 4OL8A 4OYIA 2A6OA 3NP5A 4M5KA 2AQ4A 3W63A 3LOUA 3NGSA 2XLIA 3FGVA 4ED7A 1Q8BA 1N8RT 2IA6A 1R31A 1RT6B 2EKYA 2L9DA 1GNKA 1MLAA 1OQ3A 3VWSA 1WC4A 3G96A 2NXCA 2DPJA 3R6GB 2J7KA 2WONB 1NLKL 5L1LA 2WLDA 1S7HA 2VDHA 4LF2A 1OO0B 5EWFA 1QSLA 1HW8A 5AXLA 3KUEA 1VJQA 2G2YA 4ZMMA 4DPXA 5GAHI 2VG6B 4CT9A 1T03A 1JJ4A 4K4UA 5I3PA 1KHRA 4X65F 2OI6A 4NLDA 2ROGA 3VAMA 4ECUA 2YTCA 4KH0B 4DV3F 4IDKA 4FKYA 4DEZA 4U95A 4JV2A 4C6AA 3FBCA 3CDEA 3TRGA 3AA9A 3DOMA 2ADCA 1VC5A 1JX4A 3KJFB 4IFYA 5KG4A 3HFVA 2B9EA 2CDRB 5F3TA 4DX5A 2VH7A 1RP5A 2PSZA 3MEEB 1SB6A 2M5YA 1Q7YT 3CNQP 3DN9A 2QIAA 1EZZB 1RTJB 2KXFA 4TLRA 4FNHA 5C25A 4EA7A 4H4KA 2YPYA 3SFUA 5H9FK 2MKCA 3KLVA 3N5BA 4ZPTR 2QL5B 4I7FA 1MN7A 2QLBB 3HZEA 2MLXA 2E1AA 2VUGA 4DF4A 1UTAA 3T1AA 4DUZJ 1YIJS 3U1MA 3QJLA 1T95A 3I5AA 6FDRA 4ED4A 5J2PA 2PFFB 2VASA 3ISZA 4LIRA 1PC5A 4CLWA 2XYGB 1MG7A 1RAGB 3J81U 5GAGU 1RT6A 4ZP7A 3MR6A 2BDPA 4JI3F 3CJKA 3IAM9 2ZM6J 1NJZA 2JHEA 4UOCA 2UVRA 4CM0A 4EBDA 2L9WA 2XZTB 1MWZA 4KPYA 1KC8T 4B3SJ 1FFGB 3KK2A 5L46A 5AXMA 2K3IA 4F2SA 3SRTA 3P47A 1X4AA 1IR0A 2V8VA 4X64F 4YR3A 5ETNA 3RRGA 3RR7A 4O3SA 4GKJF 2DHHA 4OZNA 1N52B 2G0CA 3EZOA 1RKJA 5HVHA 4OLOA 2EG1A 1HWKA 3IA0A 4R37A 3IC1A 4DV0J 1L3TA 1M1KT 1YWXA 4DS4A 4U7UD 1YK9A 3UD4P 3BQ1A 2AJFE 2E5JA 4P73A 4DPTA 3TEHB 2VU5A 2MQMA 6AT1B 3K5OA 2XY5A 2E1RA 1NK7A 2HFSA 3ZFVA 1N33J 2OIHA 1IN0A 2X1GA 3W61A 3MURP 4Q8EA 2AYEA 3MFHA 2M70A 3SYZA 2IYGA 2YKMB 2IM1A 1L3UA 5CH7B 2ZD1B 4NLQA 4XTTA 2XG8A 3LWLA 1OQ6A 1TL4A 2IVYA 5A6WA 2H48B 5HP1A 3DNCA 3MF5A 4MJKA 3DK5A 4B3RF 4G1QA 1WKLA 3U7JA 4J91A 1S6QA 1KEKA 2OEGA 3ZZUA 4B9MA 1FRXA 3T1HF 3FSBA 4NLVA 1H38A 1FDAA 2GGPA 2RNEA 3MM5B 4O4RA 3G8TA 4OZ0A 4MTPA 4S0MA 2XGPA 2I5KA 3QGHA 1V5VA 1X4FA 3SCLE 2HHUA 4PQUB 3MEDB 5U2KA 3SXLA 3AHPA 1TQLA 3ZZOA 1OY9A 3AOAA 3LGHA 3M05A 3POTA 5B7WA 2PMHA 3M8ZA 3HXMA 3G82B 2CXEA 1ZAVA 2DHAA 2CQDA 1BHNA 1KTVA 2RS2A 2FKOA 2DRAA 4G1IA 2ZZMA 3LAKA 2NLWA 4HI2A 4NYPA 4J9VA 4LRCA 4WE1B 4Y2AA 4OMFG 2R8KA 2D41A 4IQMA 2J9DE 1JB0C 1Q16B 3TX0A 3MD3A 4UY8T 4WZMA 3DC2A 4QBUA 2H1YA 4HR2A 4N6AA 2JLFA 1U26A 3E51A 4P6QA 5DQHA 2Q79A 4IR1A 1T05A 2YKAA 4EZ9A 1GX6A 1UPPA 2OP5A 4X84A 2NZCA 3WC2A 2VOOA 2IDLA 1SKUB 4TN2A 1YVFA 1N6QB 1HNIA 2XYHB 2R7TA 1V6HA 2AJQA 1S1XA 2XMTA 2VL1A 4Q5VA 3DLKB 4DDFA 2LXIA 4XPEA 2BW7A 3AB2B 3RB4A 2EEYA 2G1HA 4R8UA 3VBMA 3T3FA 3B82A 4M5IA 4DV7F 1G1XA 2VFTA 4V19J 2ZWOA 4WZQA 4USWA 4U8VA 1C1BA 4R7PA 2IM2A 3PO5A 1VQ7S 4NCBA 4JYAF 1GQEA 4X62F 1BD6A 5F0WA 1WOPA 1WI6A 4QZVB 1BE4A 4DSIA 1EWWA 5KFPA 4W4MA 4DU8A 1QY7A 2CPEA 1N5YA 1OSDA 4FNIA 4CH1A 2XMJA 1C0TB 3MEEA 2VG5B 3RU0A 3GV8B 5KFYA 2HHHF 2J7WA 3IGJA 2DRBA 4PG6A 4NLTA 2BQ3A 1HNWJ 5F8HA 3OHAA 3KLFB 3HSJA 4LVNP 1OYEA 5HO4A 4J9LA 4I7FB 4EBEA 2IMWP 1XK8A 2FZGB 3QGGA 2Z56B 4HTJA 4ZVHA 4HYKA 1MWYA 2LKZA 5A0YA 1URRA 1O6XA 1MNEA 1V67A 2BM0A 4A8MP 4JI1F 2YQ3A 5CAAA 5B0GA 2AW0A 1OIAA 1R6YA 3DM2B 2CZ9A 1F9EB 1DTQA 4DZDA 5KAKA 1XNRJ 1AB8A 1NHUA 2V9KA 2XSJB 3W66A 1Z2LA 4C48A 2UVWA 1S9EB 1IBMJ 3EGZA 1TKTA 2XWYA 1OS5A 3FMWA 5K8MA 1UWBA 3HULA 4HEA9 1NEEA 2B4VA 5KG6A 2ZH4A 2RU9A 3OTBA 3HVTB 2RU3A 3MUMP 4ECVA 1U8SA 3D0HE 3BB5A 3DGPA 1CULA 2XMUA 2AEJA 4KYZA 4RJVA 3VQTA 3I32A 1FK9A 2WSEC 3KG0A 4MFBB 4A46A 4F3QA 4XIUA 4OX6A 4J18A 3DHXA 3NY0A 4RNFA 3I3XA 1LQ9A 3MM5A 4OI6A 4CDIA 5BJRA 4Q43A 4DR5J 2KO1A 3TP2A 4ECRA 1VQPS 3MCMA 1SKSA 1VQ8S 4LF6J 3HJJA 3ZZYA 3MPYA 4ZIVA 2QFJA 1RWOB 4P75A 4ZP9A 2HQCA 2Z30B 2HG4A 3HSGA 3O44A 2WAQD 4ICLB 3AODA 4PXDA 4CTAB 4WCEQ 3K57A 3GU0A 5ETSA 1RJJA 3D3BJ 5HI7A 5FLXY 4C0HA 1I94F 2D69A 2QSFA 1WKJA 4ID5A 3MAAB 5E0OA 3K5MA 3OVSA 3I9V9 4G3QA 4LF4F 1UWAA 3C14B 3D67A 4WE1A 5K5MA 3PX6A 4LFCJ 5CHCB 5FD1A 1U6BA 4OX7A 2DO0A 1YLXA 2W4DA 3ISNC 3CD7A 5IM0A 1S5ZA 5DM6Q 3FSIA 3EWGA 2JEFA 4DSLA 2AGQA 4O0IA 4LF9F 3FSXA 2F8MA 1CLFA 2WOMA 2WVBA 1X0PA 1U1KA 1NK4A 2Y3YA 5EWEA 2WSCC 1TAUA 2DIUA 1NK9A 2HK3A 6FD1A 1WF1A 5LL6d 1RHKB 1ULRA 3SQGB 5H9EK 4RW8B 2V0LA 1ZA2B 3KLHB 1Q81T 1RTIA 4LFBF 2R8HA 3CULA 1WF0A 3RR8A 2W01A 1B99A 4JUZA 3MHYA 1VRTA 1Y5IB 1KTQA 2LA4A 2VD3A 3DRXA 3DRSB 1HIYA 4J7CA 5C25B 5KOXA 1MMNA 2HRUA 3W9IA 1VQLS 3E2EA 1N56A 5H1SV 3POTB 4WU2A 4Q45A 4C11B 1VQ6S 1F2GA 1Z2ZA 5A76A 3IR5B 5M2UA 1IBKF 3HHLC 4OYXA 4PQAA 3BN7A 2RDJA 4IRDA 2XM3A 3QQCD 1F1BB 2VC0A 4F4KA 4HZDA 3TAPA 1XR5A 5CABA 1RKIA 1NK0A 2DO4A 3MCOA 3C66A 3D28A 4U96A 5J2QA 4OZLA 2EFOA 3M2UB 1SIWB 2RMLA 5KFLA 3SV3A 3M6XA 3M1VB 5J1EA 3DXSX 1RAEB 1RT2A 3ZTQA 1T05B 5MLCV 2BOPA 2PGCA 2MQPA 1U0HA 2X1AA 5ADXU 3OD2A 1VQ9S 3EGVA 4RW4A 3KNAA 4FYDA 3J7YI 1BWEA 4M5DA 3D98A 3VAJA 2OPSA 3BSAA 2IPOB 2MY7A 2I5JA 2LU2A 1F5AA 2VPXB 2R2TA 2X1FA 3NWRA 4BS2A 4ANCA 3FTTA 4OZ3A 5BXIA 5C42A 4BCAA 3MR3A 4X66F 3MAQA 1JXLA 3WZ0A 4ANEA 4DSFA 1FFSB 1Y11A 1Y4ZB 4ECXA 1RUSA 2FB0A 1PAUB 2HGLA 2QO3A 2JNJA 3ZNJ1 1RWVB 5DETA 3LWMA 2G2ZA 4IRKA 5KG2A 3KDNA 1RTIB 1H74A 1M5KC 5IZHA 1X4BA 2GHWA 5C24B 1E6YA 3MUTP 4I4BA 2ZNZA 2YPZA 3KK3A 4LF8J 5KOWA 3OFEA 5GAEU 3GPAA 2DGSA 4QWCA 3HVWA 1HM9A 4IHFA 1IKYB 4NCGB 4NLWA 1H2VZ 4DFKA 4JI1J 1UVLA 1HQ2A 3L7PA 3V6DA 3KDOA 4P7VA 2IHR1 5HQMA 1Q79A 2JEIA 1GXLA 4O0NA 4DHVA 3NKYA 3KXDA 3UO0A 5AE2A 4DR3F 2QL9B 3L9ZA 2A18A 2RHQB 4FPIA 5AFUU 1ZTWA 4C2MA 4DR5F 4PWDB 1QD1A 3M8WA 2NXEA 2IRXA 1ZYQA 1KWMA 5DGAA 4B9VA 3H2UB 2HBQB 4N27A 1SUQA 1YP4A 4LT6A 2G0JA 2HHQA 4PG7A 1VRUA 1D9AA 5AFUV 1T11A 3HKZD 3OH2A 5KFWA 1RSCA 4DL6A 4IYQA 1MRLA 2VBXA 2PE8A 4HT7A 3FC9A 4RL1A 3ZZRA 4NOHA 1L3VA 1D9DA 4YS2A 4YHHF 2M88A 3WHIA 4KHPF 2DYAA 2UXDJ 2RDIA 1ZM4A 2DNGA 3HDSA 3JQMA 3X3UA 3Q8QB 4PUOB 2MLYA 3OL8A 1NSPA 4FYVB 3GOSA 5HQLA 3Q8RB 2HNDA 2BBEA 2B9XA 1JLQB 1VHIA 3T5KA 3QJPA 3IBCB 2WHOA 4OYAA 2OPRB 2M9KA 4E0DA 2E1MC 3PIPQ 4ED5A 2MTLA 3G8QA 5DQGA 4C8YA 1SJRA 3WBZA 5KFDA 1UETA 2RVJA 4QPXA 2K8GA 5A0YB 2Y1JA 4X4VA 3CO0P 4U6PA 3K0JA 1HWJA 2CNKB 2R7SA 4YFUA 4DOZA 2HW3A 4ZOSA 1DQ9A 1GXUA 2I6WA 3BO2A 3BBBA 1WEYA 3B54A 2FJXA 2GGPB 4K59A 5KT2A 4QWBA 4ZCLA 3MTJA 4Q44A 2YKOA 3CGIA 3G4SS 2QYCA 1XC9A 3OTCA 2OTJS 2BJ3A 4LSNB 1EKSA 2VB6A 4GVLA 4M5JA 3M6UA 5EUHA 2MZSA 3BDEA 3PYFA 3Q2SC 3RBZA 1RTJA 3FDSA 5DDPC 5BR8F 2VJVA 1RU1A 2UUAF 4L75A 5AXNA 1J27A 1TDTA 2HFUA 3G9CA 2NPOA 4I6WA 4KKOB 1Q95G 3TISA 1RZMA 5G0RB 3WDOA 2UU9F 1JLGA 2NR0A 3VGVA 2CA9A 5I4MA 2B8PA 1F5CA 2ATCB 3JS9A 1FNMA 5KFAA 2XO7A 3M32B 3R5CA 5GVQA 2DNYA 2XEXA 2J7UA 3NNCA 3BQ2A 4WKYA 2KI2A 3M2VA 3OR2B 2GGQA 4XAKA 4IO1A 4H4OA 1LWFB 4FZVA 3GFZA 5IQQA 1ZM2A 2LLZA 1T7PA 1J2VA 3BSSA 2FHJD 5E3AA 1AA1B 1RTDA 4QIVA 3GFYA 2DITA 5CYQB 2VQEF 3GUEA 3OT9A 5IT9Y 4AYBD 3L7UA 1UEKA 3CCQS 2VFUA 2WONA 3CEDA 2ZJPQ
chains in the Genus database with same CATH topology
2QKXA 4KPZA 5E3PA 2G1HA 3VBMA 3VBLA 2RIJA 3D98A 4HUSA 4J09A 5DEMA 4DCLA 1YP3A 3DJ4A 1HM8A 1KK4A 3OW5A 3SPTA 2P5ZX 1J2ZA 4R7PA 3TWDA 2ICYA 2JFKA 3ECTA 4E6UA 1MR7A 4MFGA 3HHDA 3FTTA 5L6SA 2WLCA 1KQAA 3JQYA 3DHOA 1KGQA 2QIAA 2V0IA 2JF3A 4EA9A 3HJVA 1MR9A 1QREA 4EA7A 2IU9A 4MZUA 3TIOA 3BFPA 3OU9A 3R5BA 2IU8A 2P2OA 3IGJA 3MQGA 1V3WA 1T3DA 4EAAA 2G2ZA 4HCQA 4M99A 4G3SA 2QIVX 2OEFA 4E1KA 1KRVA 2V0HA 4HURA 4M28A 2VD4A 3FS8A 1QRGA 3OTMA 1QRFA 3KWCA 2OI7A 3KWDA 4N6BA 2TDTA 3PTWA 1HM9A 3EH0A 4IHFA 2IC7A 1YP2A 2Q4JA 3EG4A 2OI5A 3FSYA 3FSCA 1Z90A 3VBKA 4M2BA 4EABA 1HV9A 3CJ8A 2IUAA 1SSMA 3G87A 1V67A 3TDTA 3TZXA 2W0VA 4EQYA 3EEVA 3IM9A 2WLFA 2WLGA 3R5AA 5DG3A 4RR5A 4IHGA 3OTZA 5DZ7A 3BXYA 3C8VA 5AFUU 3D8VA 4E79A 3R3RA 3IXCA 3SRTA 3P47A 2G2OA 4H7OA 1OCXA 3GVDA 4KNRA 4E75A 4N27A 1NM2A 1YP4A 4ISXA 3BSYA 3EZOA 5F42A 3VNPA 4J18A 5AFUV 4R37A 1XATA 3I3XA 4N69A 3TZYA 3BV8A 3TV0A 1MRLA 3R8YA 4K6RA 4AAWA 4AA7A 4RL1A 3HJJA 2WLEA 4M98A 1G97A 3BSWA 4AC3A 4IHHA 4KPXA 3R5DA 3QATA 2QC3A 3R2WA 2JFDA 3R97A 3SBMA 2JF2A 4M9CA 5E3QA 2QJ3A 3I3AA 3VBNA 3GOSA 3KWEA 3ST8A 4G3QA 3K89A 3DK5A 3FOQA 1S80A 4E6TA 3VBPA 2OEGA 3R1WA 1KK5A 3FSXA 3FWWA 2GGOA 3FSBA 3PMOA 1KRUA 3Q1XA 3VBIA 4G3PA 3BRKX 4EA8A 5ADXV 3TZZA 2I5KA 4KQLA 2W0WA 2V0JA 5L6VA 3H0PA 5E3RA 5U2KA 4HZCA 1KK6A 1SSQA 4KNXA 2V0LA 2VHEA 3MQHA 3F1XA 1QRLA 1SSTA 3TK8A 1TDTA 2AQ9A 4R36A 1THJA 3NZ2A 2NPOA 3R0SA 2FKOA 4M2AA 5DEPA 3RGIA 3TISA 3OUPA 3T57A 3R5CA 2CUYA 3IM8A 1MLAA 1KGTA 4QBUA 1QQ0A 3HSQA 2H1YA 4N6AA 3R3IA 4HZDA 2GGQA 4G87A 4EGGA 2WLDA 2C2NA 4FCEA 3BSSA 1FXJA 1HM0A 1LXAA 2ICXA 1QRMA 3MC4A 3VBJA 1G95A 2G2YA 1XHDA 3TQEA 3TZWA 3GUEA 2V0KA 2XATA 1KHRA 2OI6A 5DZ6A 1KRRA 4MYOA 3V4EA 3P1BA 1FWYA 5ADXU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKX A;  4KPZ A;  5E3P A;  2G1H A;  3VBM A;  3VBL A;  2RIJ A;  3D98 A;  4HUS A;  4J09 A;  5DEM A;  4DCL A;  1YP3 A;  3DJ4 A;  1HM8 A;  1KK4 A;  3OW5 A;  3SPT A;  2P5Z X;  1J2Z A;  4R7P A;  3TWD A;  2ICY A;  2JFK A;  3ECT A;  4E6U A;  1MR7 A;  4MFG A;  3HHD A;  3FTT A;  5L6S A;  2WLC A;  1KQA A;  3JQY A;  3DHO A;  1KGQ A;  2QIA A;  2V0I A;  2JF3 A;  4EA9 A;  3HJV A;  1MR9 A;  1QRE A;  4EA7 A;  2IU9 A;  4MZU A;  3TIO A;  3BFP A;  3OU9 A;  3R5B A;  2IU8 A;  2P2O A;  3IGJ A;  3MQG A;  1V3W A;  1T3D A;  4EAA A;  2G2Z A;  4HCQ A;  4M99 A;  4G3S A;  2QIV X;  2OEF A;  4E1K A;  1KRV A;  2V0H A;  4HUR A;  4M28 A;  2VD4 A;  3FS8 A;  1QRG A;  3OTM A;  1QRF A;  3KWC A;  2OI7 A;  3KWD A;  4N6B A;  2TDT A;  3PTW A;  1HM9 A;  3EH0 A;  4IHF A;  2IC7 A;  1YP2 A;  2Q4J A;  3EG4 A;  2OI5 A;  3FSY A;  3FSC A;  1Z90 A;  3VBK A;  4M2B A;  4EAB A;  1HV9 A;  3CJ8 A;  2IUA A;  1SSM A;  3G87 A;  1V67 A;  3TDT A;  3TZX A;  2W0V A;  4EQY A;  3EEV A;  3IM9 A;  2WLF A;  2WLG A;  3R5A A;  5DG3 A;  4RR5 A;  4IHG A;  3OTZ A;  5DZ7 A;  3BXY A;  3C8V A;  5AFU U;  3D8V A;  4E79 A;  3R3R A;  3IXC A;  3SRT A;  3P47 A;  2G2O A;  4H7O A;  1OCX A;  3GVD A;  4KNR A;  4E75 A;  4N27 A;  1NM2 A;  1YP4 A;  4ISX A;  3BSY A;  3EZO A;  5F42 A;  3VNP A;  4J18 A;  5AFU V;  4R37 A;  1XAT A;  3I3X A;  4N69 A;  3TZY A;  3BV8 A;  3TV0 A;  1MRL A;  3R8Y A;  4K6R A;  4AAW A;  4AA7 A;  4RL1 A;  3HJJ A;  2WLE A;  4M98 A;  1G97 A;  3BSW A;  4AC3 A;  4IHH A;  4KPX A;  3R5D A;  3QAT A;  2QC3 A;  3R2W A;  2JFD A;  3R97 A;  3SBM A;  2JF2 A;  4M9C A;  5E3Q A;  2QJ3 A;  3I3A A;  3VBN A;  3GOS A;  3KWE A;  3ST8 A;  4G3Q A;  3K89 A;  3DK5 A;  3FOQ A;  1S80 A;  4E6T A;  3VBP A;  2OEG A;  3R1W A;  1KK5 A;  3FSX A;  3FWW A;  2GGO A;  3FSB A;  3PMO A;  1KRU A;  3Q1X A;  3VBI A;  4G3P A;  3BRK X;  4EA8 A;  5ADX V;  3TZZ A;  2I5K A;  4KQL A;  2W0W A;  2V0J A;  5L6V A;  3H0P A;  5E3R A;  5U2K A;  4HZC A;  1KK6 A;  1SSQ A;  4KNX A;  2V0L A;  2VHE A;  3MQH A;  3F1X A;  1QRL A;  1SST A;  3TK8 A;  1TDT A;  2AQ9 A;  4R36 A;  1THJ A;  3NZ2 A;  2NPO A;  3R0S A;  2FKO A;  4M2A A;  5DEP A;  3RGI A;  3TIS A;  3OUP A;  3T57 A;  3R5C A;  2CUY A;  3IM8 A;  1MLA A;  1KGT A;  4QBU A;  1QQ0 A;  3HSQ A;  2H1Y A;  4N6A A;  3R3I A;  4HZD A;  2GGQ A;  4G87 A;  4EGG A;  2WLD A;  2C2N A;  4FCE A;  3BSS A;  1FXJ A;  1HM0 A;  1LXA A;  2ICX A;  1QRM A;  3MC4 A;  3VBJ A;  1G95 A;  2G2Y A;  1XHD A;  3TQE A;  3TZW A;  3GUE A;  2V0K A;  2XAT A;  1KHR A;  2OI6 A;  5DZ6 A;  1KRR A;  4MYO A;  3V4E A;  3P1B A;  1FWY A;  5ADX U; 
#chains in the Genus database with same CATH topology
 4B9N A;  1UEV A;  5DG8 A;  3QJJ A;  3W7B A;  3CCR S;  2W7A A;  4UF4 A;  4ZVP B;  5GAE I;  1T9X A;  9RUB A;  1S9G B;  2W4C A;  3PRD A;  3LPE A;  2I0X A;  3W2W B;  3IBF B;  1J2Z A;  1HBN B;  4YN3 B;  1YHQ S;  3IWL A;  2FLL A;  3HVT A;  4NML A;  1HMV B;  3MM9 A;  3I6P A;  2WLC A;  1LNQ A;  2UXB F;  3I56 S;  1U7L A;  2CJY B;  1TUG B;  2F9J A;  3DRP B;  3DI6 B;  4JV0 A;  1TKX B;  1P9Q C;  2RS8 A;  1JLE B;  2HZC A;  4TY8 B;  2W8L A;  3VGS A;  1EQM A;  2ZBQ A;  2YBV A;  4RW8 A;  3MQG A;  1FFW B;  1TV6 B;  4F0K A;  3C46 A;  3IGN A;  1SJF A;  1V5I B;  2PA3 A;  1N6Q A;  5KG5 A;  3PRB A;  4A8O A;  1Y9O A;  3CMQ A;  4CIO A;  3ONQ A;  1IR1 A;  5LT5 A;  2IJF A;  1Q1K A;  4JI6 F;  5D4P A;  3H7H B;  2XMA A;  2CG4 A;  3JQJ A;  2E5H A;  2P6S A;  2DNK A;  1IKV B;  2RKI B;  1S1U B;  3C6T B;  1SSM A;  2H5J B;  3HD2 A;  4KR0 B;  1UEU A;  1N33 F;  3JXO A;  3LP0 A;  4LF7 F;  2ZDO A;  4RWW A;  4TU8 A;  1T9W A;  5DG3 A;  3VF0 B;  4QIF A;  1Q8K A;  4IH5 A;  3DRP A;  2HQG A;  4UOH A;  4UST A;  2MYF A;  1JJC B;  4FYY B;  3U1L A;  1R7I A;  1QAI A;  1VQ4 S;  4PG5 A;  4M5L A;  1L5U A;  4PXB A;  1SJ3 P;  4YOE A;  1SIZ A;  2FJV A;  2AJ1 A;  4RW4 B;  2RD5 C;  5HMW A;  2DNO A;  2KFN A;  3ETM A;  2K06 A;  4MMO A;  1ARO P;  3I4H X;  5GME A;  3DGV A;  4DR7 J;  4C98 A;  2ZDP A;  3R2D J;  2ZWP A;  2BXJ A;  4AA7 A;  1GFW B;  1LKZ A;  1OSC A;  2HQ3 A;  3V81 A;  4Q0B A;  4M5G A;  1S6Q B;  4P52 A;  3DLH A;  4YDX A;  2GQC A;  1B70 B;  1S97 A;  1WAC A;  2HBY B;  1XR6 A;  1S72 S;  4RO0 A;  3PNI A;  1BQN A;  5B0F A;  1FRK A;  7FDR A;  2BYC A;  2BJE A;  3SBM A;  4M9C A;  2W24 A;  8AT1 B;  1F60 B;  3D68 A;  3PM9 A;  3BGR A;  3TEG A;  2KB2 A;  4WFA Q;  2B5J B;  3GJR B;  4N8N A;  5IM0 B;  4R0E A;  3IR6 B;  3UN3 A;  5F8G A;  3QZ7 A;  2XLJ A;  3TAQ A;  1X8D A;  2EWH A;  2OD4 A;  1S80 A;  1FRJ A;  2GV1 A;  3LA0 A;  1WHV A;  4RW7 A;  5B0A A;  3KKF A;  4Q8F A;  1RU2 A;  1HNZ F;  3DLK A;  2FHK A;  4J9S A;  5CYM B;  1H98 A;  1FES A;  1VJW A;  2DR8 A;  1X4G A;  2PII A;  3I96 A;  2Y9H A;  4R5P B;  1KRU A;  2WVD A;  2UZA A;  4MT1 A;  5CYJ A;  4DL2 A;  2R7O A;  4UOG A;  3P45 B;  1P27 B;  2HRY A;  4I69 A;  5M2R A;  3KLE A;  2WVE A;  3I55 S;  3BSO A;  4RLE A;  3MTK A;  1TUV A;  4M1K A;  2BQR A;  2O5D A;  2HZV A;  1IBC B;  1YJR A;  2VFS A;  4F0M A;  3KOA A;  3PY8 A;  1CQN A;  1TFW A;  4NA2 A;  4P7T A;  2P8I A;  2Y1L B;  4DMZ A;  3OTO F;  4MK8 A;  1RLC L;  1JLG B;  2GML A;  4F4X A;  2M4M A;  5AE1 A;  1UPM B;  2ZBP A;  1IBM F;  3C2P A;  4WFB Q;  4OZ2 A;  4LBI A;  1FKP A;  5D0E A;  1R8A A;  3MR5 A;  1RAI B;  4DR2 J;  4JI4 F;  1HWU A;  2H9Z A;  3G86 A;  2CUY A;  4PPZ A;  4F36 A;  3BSC A;  3P49 B;  1QDU B;  1YZ6 A;  4J9M A;  4AXI A;  4DLE A;  2IY5 B;  1R0B G;  3FKB A;  1BLU A;  1KLM B;  2OFH X;  4MIA A;  4ZVF A;  5IT9 U;  3W2V A;  4FCE A;  3VBJ A;  3TQE A;  4RZR A;  3F44 A;  1XHD A;  2V8P A;  3P4U B;  4K4W A;  1HNW F;  5C7P A;  4CLT A;  4H4O B;  4MYO A;  1TEL A;  3QWU A;  4Y65 A;  1NND A;  3W8G A;  3M2U A;  3TNV A;  2GZO A;  1FDB A;  2JEJ A;  3NGD A;  1I3O B;  2EXU A;  3UDL A;  2SXL A;  2FLO A;  4IH6 A;  1B0P A;  8ATC B;  3R7S B;  5AE3 A;  4FF3 A;  1PSD A;  5ETR A;  4ED1 A;  2HWI A;  5I3U B;  1SVD A;  2ZOM A;  1FF2 A;  5JVH Q;  5E41 A;  2DEI A;  4DG1 A;  4MFG A;  1JLE A;  3BH7 B;  2UV8 G;  2EFP A;  3DHO A;  4OI4 A;  2E44 A;  1CPZ A;  4JI5 J;  2BE2 B;  2HPU A;  2R2R A;  4AL5 A;  3UVJ A;  3HJV A;  1UKU A;  1Q53 A;  3BM7 A;  3NGK A;  3QT7 A;  4AQY J;  3T5H A;  4CZC A;  1U2C A;  2AF6 A;  4KGV B;  4OYZ A;  1ZTT A;  3R5B A;  2HK2 A;  2RQM A;  4OYM A;  5CD4 H;  1V3W A;  2NPI A;  5D8H B;  1GXT A;  2OEF A;  2R8I A;  1JXE A;  3BZQ A;  5J2M B;  5LMU J;  2V0H A;  5M2P A;  3PAC A;  3FS8 A;  2AU0 A;  3KWC A;  1EP4 B;  1TVR A;  2IFX A;  1X5S A;  3CJ2 A;  1HYS A;  1E6Y B;  4C8K A;  3V6J A;  3OQ2 A;  4K50 A;  3BRE A;  3X1L B;  2BV3 A;  2X51 A;  4URS A;  4DU7 A;  3CVK A;  2WLF A;  2CQ1 A;  5EX0 A;  3H25 A;  1GTE A;  1JLF B;  2IJR A;  4PXE A;  2C2D A;  1KVJ A;  1FWK A;  4K4T A;  1N32 J;  2V69 A;  4BC7 A;  5D15 A;  4RUC A;  3R3R A;  1QVF R;  1X5T A;  1LV5 A;  2J0S D;  3K5P A;  3MXH P;  4H7O A;  1OCX A;  2CQ3 A;  4N5S A;  4ATN A;  4RNO A;  1KS2 A;  4FXD A;  3CO9 A;  4J9P A;  2UVV A;  1YSJ A;  1U02 A;  3Q24 A;  3EUN A;  2V68 A;  1I94 J;  4C8L A;  4KE5 A;  2W2M P;  2WVC A;  3BKU A;  4LSN A;  1TL7 A;  2V8G A;  1FWL A;  2VPW B;  2QSW A;  2XMK A;  2JZ5 A;  2YKN B;  2B4U A;  1IKY A;  3BV8 A;  3HLU A;  1HPZ A;  1KP6 A;  1MMD A;  2WLE A;  2CQG A;  2KHC A;  1S4E A;  3P5B P;  1R43 A;  1VGY A;  3DMJ B;  3HSD A;  4K8R A;  3OUY A;  1SL0 A;  2CWK A;  2B56 A;  2QN6 B;  3QAT A;  3M8Q B;  2ASJ A;  4Y2K A;  4C8N A;  4O3Q A;  4AND A;  4DPY A;  2VG7 B;  1T8E A;  5E3Q A;  2AHO B;  2R3V A;  3UDC A;  2HQD A;  1VLO A;  4FXV A;  4PCQ A;  4B02 A;  1UWB B;  2GIR A;  5E3C A;  4U8Y A;  2GMH A;  5K9F A;  1M1H A;  4PWW A;  4CLS A;  1M0S A;  4NCA A;  3W1Y C;  4ZVG A;  1XMQ J;  5KFB A;  4B9S A;  2UXD F;  1HI1 A;  4OHV A;  1RT2 B;  2DGO A;  3GCX P;  4EYI B;  4QU7 A;  3ET6 B;  1S1U A;  3TVZ A;  3H40 A;  1CJT B;  3I82 A;  2MST A;  3NWG A;  3PDN A;  2VPZ B;  3FNN A;  2VPY B;  3UDV A;  4CRJ A;  2LQ8 A;  1BGX T;  3LTO A;  3ILI A;  3IRW P;  2YNG B;  2MKI A;  3PW0 A;  2CPF A;  3AJ1 A;  4OLP A;  4ILM A;  1FT8 A;  2UV8 A;  3C15 A;  2CJX B;  4HZC A;  4IG3 A;  2IC3 B;  4JBC A;  3FFI A;  1U0S A;  1UW4 A;  1Y00 A;  3O6Q A;  3PEH A;  3N9U C;  2CRL A;  2DNH A;  1D1U A;  4NX9 A;  1S9F A;  3NCR A;  2HVE A;  2KG1 A;  2CG8 A;  3S8S A;  4GVB B;  1VBZ A;  1PC4 A;  4M2A A;  2HND B;  5DRK A;  4DR3 J;  3A4T A;  4GMK A;  3TOQ A;  2VQF J;  3BGO P;  4GC6 A;  4OYW A;  1NME B;  3F41 A;  2W9C A;  4OZ1 A;  2CPX A;  3MEK A;  4RU9 A;  2ALZ A;  4J9O A;  1QQ0 A;  1C1B B;  2Z58 B;  5D3G A;  5FII A;  2XYP B;  4FXW A;  4CLZ A;  1DTT A;  1U6Z A;  4EGG A;  4IOC Q;  1HWL A;  2XZD B;  1X9S A;  1T02 A;  3MMA B;  2F9D A;  1U25 A;  2E5L F;  1EJ7 L;  3IXQ A;  3PHT A;  3CMA S;  2NZ4 A;  4K4S A;  2V0K A;  3SQG A;  2EK1 A;  3PYG A;  3IFE A;  4L3K A;  1RTD B;  2MEW A;  5E3P A;  2YNH A;  3CCT A;  3VBL A;  4ZPB A;  3VZI A;  4DCL A;  1R8H A;  5K8O A;  2P9C A;  3KJV B;  4KHP J;  2P5Z X;  4PWD A;  3DOL B;  2J9C A;  4QR0 A;  1PG5 B;  4OQJ A;  3C19 A;  4ZJO A;  4PG8 A;  3DOK B;  4GC7 A;  1B7F A;  1TMM A;  2Z2Z A;  3BR9 A;  4ED0 A;  1WD6 A;  3HHD A;  3AOC A;  5LSR A;  3HSZ A;  2D1C A;  1C2P A;  1VQM S;  3LAM A;  1KBR A;  1S1W A;  2LXF A;  2W1B A;  2JF3 A;  3TA0 A;  2YWF A;  3AJ2 A;  1RAF B;  3SDE B;  4URG A;  2NRE A;  2IU9 A;  4MZU A;  2CWX A;  4PRF A;  4OV1 A;  3VR1 A;  1YJU A;  2P2O A;  4WTO B;  5LOQ A;  1CVJ A;  2KRR A;  4HCQ A;  2V0N A;  3NBP B;  3M4X A;  2GVD B;  4Y34 A;  2FY1 A;  2ASD A;  2E9T A;  3TA2 A;  1X5P A;  2C2Z B;  2DTJ A;  4F3O A;  2KYX A;  3H2V E;  2HHP A;  3R3T A;  4LSL A;  3SEO A;  2FVC A;  4LR9 A;  4MKV A;  2FYX A;  2NUH A;  3MCS A;  2ZH6 A;  2WB1 D;  4PWU A;  3GR1 A;  4BWJ A;  2Q43 A;  3PO4 A;  4JV5 J;  1VCT A;  1JLB B;  3TZX A;  2ZE2 B;  3W3S A;  5GAH U;  5SUH A;  3IM9 A;  4FP9 A;  4KHR A;  3TI0 A;  3BO4 A;  2B43 A;  1FJE B;  1N54 B;  1XMO F;  1X31 C;  2DT9 A;  2HUR A;  2LP4 A;  2FHM A;  3BXY A;  3C8V A;  2Q6B A;  4NLX A;  3AXM A;  3QFH A;  3L4B C;  2W25 A;  3OSP A;  2B0G A;  1YRT A;  1IBL J;  2B9W A;  2X3D A;  2BE9 B;  4LFB J;  3GVD A;  4KNR A;  1K0V A;  4RUA A;  2GAH C;  4Q0B B;  4N56 A;  3VVT A;  3W64 A;  3W5Z A;  2KL8 A;  1XER A;  4K2X A;  5E5N A;  3KHH A;  1CJV B;  3DMJ A;  1IWA A;  1XBW A;  2KJW A;  2KXH A;  2OHD A;  2E7V A;  2CPJ A;  3MEC A;  4CWB A;  1KDN A;  5HN0 A;  5KFC A;  5ETT A;  4UZB A;  2Z4P A;  3TAN A;  2EW9 A;  2NXN A;  4N76 A;  3L3C A;  2JLE A;  4CI0 B;  5DG7 A;  5FLX U;  4LUB A;  4AC3 A;  3VGT A;  4LF5 J;  2G9O A;  2BKN A;  3PJ9 A;  2MQO A;  1NJY A;  2LEP A;  3R2W A;  2VA3 A;  1TKD A;  2BKO A;  2ATL A;  2AX1 A;  2HNZ B;  3CD5 A;  2KZM A;  2A3J A;  1JK9 B;  2DCU B;  1XQI A;  3TX8 A;  1TL1 B;  1UFK A;  1WJ9 A;  4DR4 F;  1S9G A;  3BPS P;  1U1P A;  4FKX A;  4DL5 A;  4NEZ A;  5B0D A;  3PEJ A;  3BH6 B;  2UUT A;  4Y00 A;  2QE5 A;  2QGF B;  2YQ1 A;  3MM9 B;  5KFV A;  1N5S A;  3O1L A;  5F8I A;  3RAX A;  4MYU A;  2UXC J;  5GAD U;  1BUX A;  3UN2 A;  2HVD A;  2ILZ A;  1YBA A;  2RAQ A;  5IWA F;  4BDP A;  5A2Q Y;  2R7X A;  1Q5Y A;  1UZD A;  3JSR A;  1ACM B;  4ED8 A;  2KRB A;  2W0W A;  1XJW B;  2IBK A;  4R5P A;  2W2N P;  2YNI B;  3IG1 A;  1Q86 T;  4MIB A;  2V9W A;  3W5Y A;  3NS5 A;  4RNM A;  1ICE B;  1RBA A;  4N8O A;  5L9X A;  4EO8 A;  3PVX A;  3LF0 A;  3MQH A;  2V63 A;  4O4G B;  2QG9 B;  1JJ2 R;  2FIU A;  3DI6 A;  3D66 A;  5FDL A;  3CJQ A;  3KLI A;  1V3S A;  1FEH A;  3TK8 A;  1FWP A;  2HNY A;  5A8R A;  1TFY A;  4FS1 A;  2OEK A;  4RWX A;  2OEJ A;  3EGN A;  5D4O A;  1U1M A;  3RW7 A;  1FVQ A;  1RAA B;  4DV6 J;  4B3S F;  5HMZ A;  4AL6 A;  3Q2T C;  4ED6 A;  2L41 A;  4AQY F;  1Y3J A;  3CJT A;  3H59 A;  3H2L A;  1XWL A;  1VI7 A;  3JTP A;  4DPW A;  3CJ3 A;  3GYX B;  4UUW A;  1NSA A;  4OX9 F;  1DY3 A;  1JLC B;  1EX8 A;  3CJ4 A;  4JOU A;  5HAN A;  4NCG A;  4ZDN A;  4ES2 A;  5DLG A;  3SSS A;  2ADB A;  2IDE A;  2J6U A;  3SSR A;  1IKV A;  2RF2 A;  2RKI A;  3C6T A;  3BYR A;  1MWQ A;  1S76 D;  1PJ5 A;  1KR4 A;  2FHO B;  3HFZ B;  1T03 B;  3P1B A;  4NXN J;  4ZN3 A;  1P6T A;  1KQK A;  2HFZ A;  2JRS A;  2OEL A;  2RUG A;  1NB7 A;  2KDO A;  3U02 A;  1QSS A;  2IIH A;  3OW5 A;  3GQ8 A;  1RBL A;  3GWC A;  3ET6 A;  3H5U A;  4LF1 A;  1NKE A;  1REV B;  2ICY A;  2JFK A;  3CT9 A;  1NDC A;  2CPH A;  2XHC A;  1WOS A;  3B4M A;  5EX3 A;  1PO6 A;  3H98 A;  4I2Q A;  2C3P A;  3C16 B;  4K4V A;  4TQR A;  2V34 A;  5LJ3 Y;  4DL4 A;  3SV4 A;  5CQG A;  1YGY A;  2ASY A;  3AJD A;  1NB2 A;  1MR9 A;  3FRZ A;  3ZTS A;  2HMI A;  4ZVU B;  4ZLN A;  1LW0 A;  4EAA A;  4OI3 A;  3RYL A;  5K8P A;  1QE1 B;  2JLG A;  3OFH A;  1H3D A;  2XHW A;  1EIY B;  1REG X;  1U47 A;  1XR7 A;  2VHG A;  1FTC A;  3CJR A;  1KVI A;  4H4M A;  5J1N A;  1WEL A;  4X4R A;  2XUL A;  4B9U A;  1FD8 A;  1W7W A;  3T6J A;  4ZPA A;  3GG1 A;  1ZOT A;  5THW A;  4K4X A;  2UUC F;  5A8K A;  3MEG B;  1A0O B;  1RAH B;  1VRU B;  4NWB A;  1C4A A;  4AL7 A;  2CQH A;  4O44 B;  1D9F A;  1DTT B;  2B6A A;  1S99 A;  2DB1 A;  4P2F A;  5KT6 A;  1Q82 T;  2VBZ A;  1JKH A;  1N5T A;  5F9N A;  4DR2 F;  1KNZ A;  2ZH8 A;  4LBH A;  2VDI A;  2WTF A;  1HQU A;  1VS3 A;  1TL1 A;  4WWS A;  2LEB A;  2OML A;  4OZJ A;  4E2F B;  4PUO A;  2MQN A;  3BGL A;  3RRK A;  1FKO B;  3EX7 B;  3K8W A;  5B0E A;  2V5H G;  1N34 J;  2ZBI A;  4ZPD A;  4EWT A;  1WHX A;  4FYW B;  3GTY X;  4LIW A;  1S1T B;  4F0H A;  2Q66 A;  1HNV B;  3MM8 B;  1DQA A;  4KFB A;  1SH2 A;  1WSR A;  2F5G A;  1Q0N A;  2PMZ D;  3L95 X;  1DLO A;  2WBR A;  5KFS A;  2E1C A;  3M7V A;  1MRO A;  4C8O A;  3GE9 A;  3Q8P B;  4CLP A;  3J7A N;  1A7G E;  2KKH A;  1U1O A;  4N47 A;  4X4O A;  2CZ4 A;  2BOA A;  1VBY A;  4KO0 B;  1WSV A;  5F3Z A;  1U1L A;  4QW8 A;  2W9A A;  2DJW A;  5HJY A;  3HHL B;  1HNZ J;  1KQF B;  3GYN A;  2OO4 A;  3AD7 C;  3BGU A;  2B4P A;  3RBX A;  3CF5 Q;  2DNZ A;  4FVC A;  1P1T A;  1HHQ A;  3R5J B;  3TAM B;  1S6O A;  1ROF A;  4DV2 F;  4Z2X A;  1D3W A;  1Y7P A;  2MLZ A;  2Q6C A;  3M8Y A;  3US5 A;  2AJ4 A;  3LP2 A;  3TWZ A;  3AY0 A;  1P9Y A;  3BKF A;  3CCZ A;  5A2Q U;  3JSM A;  2HEK A;  4OI0 A;  2AEF A;  3PMO A;  4E98 A;  4TU7 A;  1F2H A;  2KT3 A;  4OI1 A;  1RT5 B;  3RTV A;  1FXL A;  1VDH A;  4ZVS B;  3E3X A;  5BYQ A;  4FS2 A;  5HRO A;  3EZ5 A;  4KQL A;  3H0P A;  2UXB J;  3OUY B;  1CJT A;  3FRY A;  4L6V 3;  4GO5 X;  1XMQ F;  4N41 A;  1ITP A;  4EZ6 A;  4Z37 A;  3SSQ A;  4KH1 B;  4TLQ A;  3V5R A;  2GC8 A;  2OJ3 A;  1U8W A;  2OEM A;  3GZ7 A;  4B3O B;  3F1X A;  1SJ4 P;  3GCW P;  4Y2I A;  2UUB F;  2CQ4 A;  2IAJ B;  2F4V J;  1YTY A;  1SUQ B;  4NZ6 A;  2C3Y A;  3PZP A;  3M8R A;  4ECZ A;  2ZZN A;  3OUP A;  1FTR A;  1YI2 S;  4KGX B;  2LVW A;  3P6Y C;  1Y10 A;  3W9H A;  2OPP B;  4YB1 P;  1X7V A;  3J7Y U;  1PJ6 A;  1R8P A;  3EVO A;  4I2P B;  4DN0 A;  1E6V A;  1VQS A;  5D0H A;  2LEA A;  3O8W A;  3EMT A;  4ER8 A;  1QSY A;  4JI3 J;  5HK4 A;  4IQX A;  4DSJ A;  1OY8 A;  1RWM B;  3N4W A;  2HQI A;  3JAM U;  1HM0 A;  3LAL A;  5L39 A;  3CJ5 A;  3H20 A;  4JI7 J;  2XAT A;  5IC4 B;  4MYT A;  4CYU A;  1S57 A;  2RRB A;  1RYS A;  3ZTO A;  2OTL S;  3FVY A;  1KLM A;  1C0T A;  3ITH A;  2G4B A;  4BC9 A;  2DKO B;  3TVY A;  5L1K A;  1DAR A;  2RIJ A;  2J5A A;  1S0O A;  1A6L A;  3LP1 A;  1YP3 A;  1JIH A;  1UW9 A;  4DV5 J;  4B3M F;  2HHS A;  3SPT A;  3AAW B;  4NLR A;  5KG1 A;  4R0J A;  3KK2 B;  1U49 A;  1FKP B;  2NSC A;  3CCU S;  3EPG A;  1RT4 B;  1F3V A;  2LA6 A;  2WSF C;  3FBB A;  3M30 A;  3QZ8 A;  4DX8 H;  3DOL A;  3OFG A;  2DH9 A;  4AT1 B;  2B7C B;  7FD1 A;  3T6B A;  1T94 A;  1PIL A;  1RHM B;  2VV5 A;  3CJK B;  1IR2 A;  2FLN A;  1QRE A;  1DJ0 A;  1HBO A;  2AJ0 A;  3MAA A;  3N5F A;  1T3D A;  2ASL A;  1S7I A;  5IV3 A;  1XEZ A;  1YRX A;  3ILL A;  5C24 A;  1T3O A;  1QRF A;  5EDW A;  4WFZ A;  4ECS A;  3NMA A;  2HAF A;  4O3P A;  2E5G A;  3Q0A A;  4K0K J;  2N4C A;  4JI0 F;  2JSX A;  3UCZ P;  2MSS A;  4KSE B;  3H5X A;  2A0F B;  2XGQ A;  3KHR A;  4ZVR B;  3MD1 A;  2NSB A;  4TVA B;  4ZHR B;  2MKS A;  2CVE A;  1YJT A;  2GQQ A;  5JJB A;  4FF4 A;  3D4J A;  3R27 A;  5D78 A;  3ZTR A;  1G6B A;  1OPI A;  4V19 X;  1VBK A;  4NZ7 A;  3KK1 A;  2R4F A;  1L0S A;  3OTZ A;  2VQF F;  2UP1 A;  3R2C J;  3MOZ A;  2R7U A;  4E79 A;  3OLB A;  3ENQ A;  1PJ7 A;  1WG1 A;  1DAX A;  1YRU A;  2QZ8 A;  3IXC A;  1S49 A;  1BQN B;  5T41 A;  3RJM B;  2FUG 9;  4ICL A;  2DH8 A;  2BAN B;  3GMG A;  3VTI A;  4CTA A;  4UQG A;  1DTQ B;  2HWH A;  2CNL B;  3OTO J;  3K5N A;  1S0M A;  4ES1 A;  3N28 A;  4X4T A;  5F42 A;  1SH0 A;  2IMO A;  2AEM A;  3EYZ A;  4J5O A;  1EAR A;  3S6E A;  4KRW A;  4ZLL A;  3KJN B;  2ZVS A;  3DKD A;  4IFV A;  3CJS A;  3UDE A;  5J2Q B;  1B4S A;  3P96 A;  2HQF A;  4EYH B;  2QLX A;  1FNO A;  1RA7 A;  3WQP A;  4X66 J;  1RE1 B;  5J2N B;  1CJK A;  4LRB A;  5IQ6 A;  3QT6 A;  4I68 A;  1SL1 A;  3EE3 A;  3A8K A;  3R97 A;  1YDL A;  3IAS 9;  1TP7 A;  1S0N A;  3AD9 C;  1NU4 A;  4F4W A;  4WXW A;  2ZVI A;  1W2I A;  3AQP A;  2V67 A;  3PW2 A;  2F8H A;  4RW9 A;  3UFC X;  4ZCI A;  3ZZP A;  1GMW A;  4JV1 A;  4E6T A;  4H4K C;  4DFM A;  2AGP A;  4DFJ A;  3G82 A;  2V2Z A;  4OI2 A;  1F5B A;  1KK5 A;  3FWW A;  2BVZ A;  1RI7 A;  4PG4 A;  4EGL A;  2FLP A;  4C8Z A;  3DLG A;  4ENO A;  2XS5 A;  4RNN A;  2DXF A;  4R8U B;  4YR2 A;  4X4N A;  3UQS A;  5L6V A;  1UA0 A;  2QMU B;  3TUZ C;  3NBP A;  3IR7 B;  1ZZF A;  2Y0S D;  3GFX A;  5ETQ A;  2KN4 A;  5D3G B;  1IBK J;  2H4W B;  1R27 B;  4YME A;  3K5L A;  4QYZ J;  1F9F A;  5T7L B;  2DRD A;  2QTW A;  5H9F J;  5L9N A;  4DQR A;  4EEY A;  1NSQ A;  4NLG A;  4Y28 C;  3KFW X;  3RBE A;  2JC1 A;  2XS7 A;  3FEZ A;  2KJV A;  3NOG A;  4USI A;  1RT1 B;  3RGI A;  2WK4 A;  4P9S A;  1UFW A;  3RBD A;  2GHV C;  2C3O A;  2HLU A;  5LMN J;  1X9W A;  3QMQ A;  5HVG A;  4NYZ A;  4UQT A;  4YY3 J;  2DEJ A;  3FBF A;  2OSR A;  3P8B B;  4HAC B;  5KFT A;  1KOO A;  1RT7 A;  2E9Z A;  1D8Z A;  1DZ5 A;  1RAJ A;  3KG1 A;  3K58 A;  1FER A;  2W2Q P;  1VQO S;  3OTD A;  1AZS B;  1FHT A;  1YBU A;  1VBX A;  2IM3 A;  3MC4 A;  2I2Y A;  2J8A A;  4DV6 F;  3I5B A;  1YZ7 A;  5D0G A;  4EUV A;  2AV5 A;  1X5O A;  2YKQ A;  1RB0 A;  2RF2 B;  3ELH A;  1K9M T;  2QMW A;  4KV8 B;  2HS3 A;  2YH1 A;  3ADA C;  4GKK F;  2D9O A;  1RWK B;  2GVD A;  3C16 A;  3IWX A;  1LW2 B;  3M6W A;  4KC5 A;  2QMX A;  4M5H A;  1G3O A;  2HIY A;  3UN5 A;  9ATC B;  5KTQ A;  1RWU A;  4CP5 A;  4QWD A;  8RUC A;  4ELT A;  1WKK A;  4RKU C;  2UXC F;  4DUY F;  2U2F A;  3N0V A;  4LR7 A;  4G1Q B;  3B6B A;  2DNP A;  3HMJ G;  1KGQ A;  3TA1 A;  1L3S A;  1S77 D;  5ADZ A;  4ZLJ A;  5IS2 A;  3BS9 A;  4I6Y A;  3WIU A;  3BFP A;  2AX0 A;  4IG3 B;  1IBL F;  1DLO B;  2DHX A;  3P5T L;  3PKY A;  4F3M A;  1CSJ A;  3DYA B;  2NXU A;  4UT4 A;  3RAM A;  1RIS A;  2ZOF A;  4NLP A;  3DDK A;  5KFU A;  5AJ3 F;  5H9E J;  3EVW A;  4RBV A;  4KJI A;  1JJH A;  4HTI A;  4LQ3 A;  5HLF A;  1SBR A;  5IT0 A;  1XMO J;  1WC3 A;  4NL5 A;  1U2R A;  4HDG A;  3TR5 A;  3BO3 A;  2GA7 A;  1WUU A;  4A8K A;  2TDT A;  1WI8 A;  4J9K A;  1M90 T;  2VON A;  4UTG A;  2DXE A;  2J6T A;  1EKR A;  4M2B A;  2W9B B;  3PRV A;  4DR6 J;  2G0I A;  4J9N A;  2A6M A;  4LF5 F;  2BJ8 A;  2G13 A;  3BKT A;  1LK5 A;  1X9M A;  2HYI B;  3DLL Q;  1AXQ A;  2IBO A;  1GX5 A;  4RR5 A;  2XCP A;  3Q8U A;  3OXL A;  4A8Y A;  3U27 A;  4O44 A;  1MU2 B;  1CQM A;  2CJ9 A;  1O0P A;  1YIT S;  1HKA A;  4NXM F;  4IRC A;  5U47 A;  4LR8 A;  4ZCK A;  4U9R A;  3BDP A;  1V9O A;  4M5N A;  4KKO A;  4TY9 A;  3OSN A;  1ELO A;  1YQH A;  2YNI A;  4WYL A;  2CYY A;  2U1A A;  2HS4 A;  3G71 S;  5K14 B;  1MRO B;  4DX7 A;  5ITH A;  5HLF B;  4W90 B;  3WX8 A;  5KFQ A;  1F3F A;  1GMU A;  3N01 A;  3BEG B;  3TZY A;  3AH6 A;  2AT1 B;  4F4Y A;  1RWX B;  4OYP A;  5D77 A;  2DR9 A;  2I38 A;  4ELU A;  1S1T A;  2I1R A;  4R25 A;  3CTR A;  5E2Q A;  1BMQ B;  3PJW A;  1VFJ A;  2H4Y B;  4F04 B;  2HHX A;  1LXJ A;  3EDR B;  1NPK A;  1NDL A;  3D6H B;  3N6M A;  1IKW B;  1WC0 A;  3OPK A;  4PEO A;  3MPV A;  3UVJ B;  5KFG A;  1P8G A;  7AT1 B;  1RCX B;  3WIV A;  5DO2 A;  2ZHA A;  1Y5N B;  1UFL A;  2OPP A;  3HT0 A;  2JJ4 D;  2QJ3 A;  2AZ3 A;  3OXF A;  1MU2 A;  1IWG A;  3OL6 A;  2ZHB A;  1AUD A;  2DIS A;  4K2J A;  4CCH A;  1YBT A;  3LP2 B;  1S48 A;  2FPH X;  3FEX B;  3ZZ0 A;  3PR5 B;  1HL6 A;  1B3T A;  2E5L J;  2BKP A;  5BYS A;  5GAG I;  4Q7A A;  5HP1 B;  1ZM9 A;  2DK2 A;  3FOQ A;  2I8E A;  3UI3 A;  3VHQ A;  3R6L B;  1DQ8 A;  3M9M B;  4OZ5 A;  5FDL B;  4DX6 A;  2CPZ A;  4DPO A;  3H42 A;  2KM8 C;  1NK8 A;  3T1Y F;  4DR7 F;  2KZZ A;  3IMQ J;  3HX9 A;  1VR6 A;  2XCA A;  1HW9 A;  3VBI A;  4G3P A;  3I0R B;  3QGI A;  2MZ1 A;  2IJN A;  4YDD B;  2EBE A;  3THT A;  2HIQ A;  1QE1 A;  2OD6 A;  2WRM A;  1M5V C;  1FRM A;  2FD2 A;  5B0C A;  2EI5 A;  3M8P A;  1NKC A;  2BAC A;  4DV5 F;  1QRL A;  2GJ2 A;  3NAH A;  3JYT B;  1M5O C;  2R8G A;  3LW5 C;  4ILL A;  3BN4 A;  1FJG F;  4R36 A;  2AQ9 A;  1MML A;  3GG0 A;  4B3T J;  3RRH A;  3H8Y A;  3ISN D;  4LRF A;  4X4P A;  4FBU A;  3LUY A;  1RT3 A;  4YHH J;  1DUR A;  2X7I A;  4NLY A;  4C0O C;  3OHB A;  3UNG C;  1LOU A;  2KT2 A;  2ZJQ Q;  1QM9 A;  3IM8 A;  2LMI A;  1PAE X;  2N7C A;  4LF7 J;  3GYG A;  4DR6 F;  4O3R A;  3LAN A;  2CQ0 A;  2BJ7 A;  2OMO A;  3W2W A;  4WF9 Q;  2MPU A;  5C5J A;  1CJK B;  2OI2 A;  4F2R A;  1R0A A;  2QEX S;  5BYR A;  3ITH B;  1SI9 A;  5A8K B;  3GJS B;  3GIK A;  3MGJ A;  2HFV A;  1U09 A;  3OR1 B;  1ZS6 A;  4XK8 C;  1SXL A;  3MOJ B;  3IP0 A;  1PCA A;  4NLS A;  1NUE A;  1RAO A;  3A8I A;  5LSL A;  1RCO B;  2A10 A;  1DRZ A;  2J9D A;  2E66 A;  3AFG A;  4RW6 B;  2VJU A;  1N0U A;  3T9N A;  3TJA A;  5C2C A;  1PGZ A;  4HHJ A;  3EIC A;  2PI4 A;  1RHR B;  2KYZ A;  4ZP6 A;  1TKZ A;  1KOH A;  2RT3 A;  3R1L A;  4NYO A;  1UP1 A;  5KT3 A;  1Q8I A;  3UW1 A;  1VLY A;  1G7C B;  2XMV A;  2GQ2 A;  4EA9 A;  1CC8 A;  3SMZ A;  2W7P A;  2DGW A;  4DCP B;  3MEG A;  2DHG A;  3CIM A;  3DCA A;  2WCX A;  2QLF B;  3TIO A;  4WP8 A;  1SL2 A;  2XLK A;  2ABY A;  3LP0 B;  5I3Q A;  2ZJR Q;  4IFV B;  4NEY A;  5K20 B;  4V1A k;  5ETV A;  3UR0 A;  3KLG A;  3T1H J;  4HKQ A;  3GJT B;  3HVR A;  1HR0 F;  2AWZ A;  1KRV A;  3DOM B;  2E1P A;  3ZC4 A;  4PYD A;  4TU9 A;  4M28 A;  3G8S A;  2V4Q A;  3OTM A;  2XTJ P;  4DV2 J;  4DFP A;  2OI7 A;  1NPP A;  1VMB A;  3J81 j;  2H54 B;  4ZK7 M;  3K17 A;  3PFO A;  1SC3 B;  2POK A;  2Q4J A;  1RT5 A;  2VKR A;  2VG6 A;  2OI5 A;  4EAB A;  2BE7 D;  3DLE A;  1LFW A;  3M6V A;  4MH8 A;  2AIR B;  3MPU B;  2IUA A;  3CC2 S;  1IM4 A;  3D5M A;  1HI0 P;  4AUK A;  1Z2F A;  3EEV A;  4TXS A;  3QFW A;  4RBT A;  4WKR A;  4I2Q B;  1SV5 B;  3M2R B;  2OPQ B;  4KGZ B;  4DCJ B;  4CO2 A;  2KT5 A;  4ZIT A;  3LH2 S;  4ZHR A;  2MZJ A;  2ZC4 A;  2PO4 A;  1TKT B;  4CNY A;  4RPF A;  4WJB A;  2G2O A;  2VKZ G;  2F4V F;  3HHL A;  4E75 A;  1JWW A;  1X0F A;  3EGW B;  4LSZ B;  2FVQ A;  1T9Y A;  3VAL A;  2FJW A;  2QL7 B;  3JAM Y;  1B64 A;  2JVR A;  3DRR B;  1QAX A;  3OXG A;  1U24 A;  3M1V A;  2B9Y A;  1RAD B;  3MMJ A;  4ID8 A;  1LWX A;  4OJG A;  5J1E B;  3KLH A;  2AD9 A;  2V4J B;  2BQU A;  2GW8 A;  2V94 A;  1RBO B;  4FDF A;  2GNK A;  4K6R A;  2WW8 A;  3EM1 A;  3W2V B;  2YKN A;  4E8U A;  4X4Q A;  2AYG A;  1W25 A;  2K3K A;  1EHW A;  1S59 A;  5LMN F;  4USU A;  1YX2 A;  3R9L A;  1SKR A;  4IOA Q;  1C1C B;  5HVF A;  2KG0 A;  4OFZ A;  4B08 A;  1WC1 A;  1WEX A;  4G6V B;  2CJK A;  1T0T V;  4I2P A;  1Q7L B;  1T3N A;  4I56 A;  5B08 A;  4WP9 A;  2HRT A;  3T9Z A;  4KO0 A;  1RT3 B;  2D3Z A;  3O5T B;  4DSE A;  3HJF A;  2APO A;  2CJA A;  3K2Y A;  2E5I A;  4HH1 A;  4CNZ A;  1RTZ A;  4QIE A;  5L1J A;  4JI5 F;  4MKY A;  3O3L A;  4LFA J;  2ACM A;  2IAJ A;  4JI2 F;  4IG0 A;  5KFI A;  1K73 T;  4OJH A;  3A1Y G;  5D0R A;  4CLU A;  1RK8 A;  2LQ5 A;  4KFB B;  4QU6 A;  2Z0G A;  1T9V A;  4A47 A;  5KFF A;  1TUW A;  5ADX V;  1ZAW A;  3QIP B;  3HM9 A;  3MM7 A;  5AXK A;  5KG7 A;  2XMW A;  2V0J A;  3NLC A;  3Q86 A;  5F8N A;  2B7B B;  5I42 B;  1U1R A;  4K4Z A;  4DV3 J;  1KK6 A;  2KTQ A;  2F40 A;  3I0R A;  1SSQ A;  2BMB A;  3QO9 B;  4O3O A;  4RNH A;  4ZPC A;  2QYG A;  2LQJ A;  1Q4R A;  2O66 A;  1K8A T;  1GMW D;  5KFN A;  1FE0 A;  3HT3 A;  1SST A;  4GRS A;  5DEP A;  5D6G A;  1IQT A;  1Y5L B;  3MR7 A;  2AZ1 A;  3QLH B;  1OY6 A;  2C2K B;  3C6U B;  4WK1 A;  1IJF B;  5KT4 A;  2D3U A;  3QID A;  4WIQ A;  1S9E A;  1YJ9 S;  2DR5 A;  3KTQ A;  4TQS A;  2BJ9 A;  2DGQ A;  2MZT A;  2W2O P;  3L09 A;  3A3N B;  1TL5 A;  3QAU A;  4U67 Q;  5I3U A;  3RB0 A;  1FDN A;  4DQI A;  4LFA F;  4OX9 J;  4G87 A;  1X60 A;  5E7O B;  4C7Q A;  3MFI A;  4AXJ A;  5HRO B;  3J80 Y;  3CPW R;  1PIE A;  5HSP A;  3OJS A;  2ICX A;  3FCV A;  3IN5 A;  1QUV A;  2XBP A;  3FQL A;  1B7Y B;  2RE1 A;  3A13 A;  2FZK B;  4NPO A;  5CZX A;  5L38 A;  5KFE A;  1CS4 B;  5LXR A;  3PG9 A;  4Q2L A;  3ETO A;  4ZP8 A;  1TL7 B;  4PKD B;  5LXY A;  4XDD A;  2BR0 A;  1FRH A;  2HMI B;  1VYA A;  2JEG A;  4IR9 A;  2H65 B;  4RU2 A;  3NS7 B;  5KFX A;  2RDD A;  5KFJ A;  4IH7 A;  5GMK a;  4DF8 A;  1KK4 A;  3IWN C;  3BBF A;  1CJU A;  1OPZ A;  2AP6 A;  2WZ1 A;  4Z7C A;  2DY1 A;  1H7W A;  4A48 A;  3VAG A;  3ECT A;  3ILJ A;  2WBM A;  2FY8 A;  2VG7 A;  4X62 J;  4QIW D;  3M2R A;  1U48 A;  2QA4 G;  1O8B A;  2OPR A;  1LK7 A;  3M8Q A;  4CLL A;  3MAH A;  3F73 A;  1AUS L;  3H5Y A;  1TK8 A;  1TL3 B;  3EXC X;  3EVM A;  2O01 C;  2BA9 A;  4WPA A;  1EQ0 A;  4KT0 C;  3OH0 A;  3CC7 S;  3QWP A;  3CW2 C;  2H5E A;  3T19 A;  4UY8 5;  5F8L A;  3KHL A;  5ETP A;  4G3S A;  2R8J A;  3G6Y A;  4JB8 B;  2J76 E;  2YVS A;  3C8Y A;  2ZH9 A;  5K8N A;  2VD4 A;  4CH7 A;  3HD1 A;  3KK3 B;  1N88 A;  2KVQ E;  3EH0 A;  1FE4 A;  3V6K A;  4EI2 A;  4F8R A;  2HZA A;  2X3G A;  4EBC A;  1UZH A;  3OTE A;  1HBU A;  1MN9 A;  1HNV A;  3MM8 A;  2KM8 B;  1B0T A;  4FF1 A;  2XO6 A;  5KFK A;  2DR6 A;  4WFY A;  3TUP A;  2DCL A;  3W62 A;  4DS5 A;  4Q2M A;  4JYA J;  1TZ0 A;  4IHG A;  1NZ8 A;  3CDW A;  1KFD A;  4RW7 B;  1TL3 A;  5D4L A;  2PDA A;  1F9H A;  2GHP A;  4MKA A;  1VOM A;  2ZH2 A;  1PBU A;  2QA4 S;  3TQ1 A;  1S0V A;  2MY8 A;  4PYA A;  4P74 A;  3OL7 A;  2FHJ A;  4ZKA A;  3W60 A;  2AJ2 A;  4CO0 A;  1JLF A;  2YH0 A;  3UE2 A;  2DHS A;  2FJA B;  4M5M A;  4ISX A;  2CQI A;  4NLO A;  3DHW C;  3D0G E;  3FJ2 A;  1Z1Z A;  2OFG X;  4PXC A;  2YX7 A;  3TV0 A;  3RAQ A;  2DIV A;  2COL A;  3HCX A;  4QPT A;  3GII A;  1UJ5 A;  2C3U A;  2WW4 A;  2ZHO A;  3CIZ A;  1LEO A;  4F7V A;  2ZH1 A;  2DXD A;  2EK6 A;  2RRA A;  4QIG A;  1NHK L;  3AB4 B;  2C2E A;  1GH8 A;  2QC3 A;  3VAI A;  1K1Q A;  2JDJ A;  3TJ8 A;  3GV7 B;  2J6S A;  2JFD A;  4ILR A;  3PIO Q;  1ZH5 A;  3KG4 A;  1F0X A;  2AGO A;  4HAC A;  3PKM A;  3VBN A;  3THV A;  2M7S A;  4DSK A;  4JI7 F;  1RTH A;  4LF4 J;  1ZET A;  2ZUA A;  3A8J A;  4HVZ A;  3QLH A;  4EU0 A;  5IXU A;  3V4I A;  1I5O B;  4OHY A;  1JLQ A;  4JP8 A;  2BUN A;  2GFF A;  1VRQ C;  2VF3 A;  5C42 B;  5KT5 A;  2PEH A;  2XC9 A;  2RJZ A;  3MED A;  3NCP A;  5HAO A;  2KHD A;  4YQW A;  3RB3 A;  4PQU A;  3Q1X A;  4WII A;  1EET A;  1SJQ A;  2M8D B;  4DQS A;  1FNX H;  3BR8 A;  1CEZ A;  3TZZ A;  3CDA A;  1FK9 B;  4A8Q A;  1OWX A;  2LDI A;  3DYA A;  2VIH A;  1CS4 A;  1UJ6 A;  4KNX A;  2VHE A;  4OHX A;  1IM6 A;  3RZA A;  1N34 F;  1OJ4 A;  3OLA A;  1FX4 A;  3M9O B;  1N36 F;  4M95 A;  4KGM A;  2FJB B;  3KUH A;  4J37 A;  5KFR A;  3GJQ B;  1N0V C;  3I87 A;  1GK8 A;  2OGU A;  2ZKU A;  3NZ2 A;  3R0S A;  4IOB A;  3VV2 B;  4U7U K;  2LEC A;  1NK6 A;  1M5S A;  3TO8 A;  3T57 A;  3OFF A;  1D8Y A;  4DQP A;  3OH4 A;  1LWE B;  1S6P A;  1X4D A;  4OHZ A;  2C2O B;  2R2S A;  1HNX F;  2FVP A;  2KXN B;  3SQO P;  3J80 U;  3JTO A;  2KFZ A;  1FJC A;  2AYB A;  3UCG A;  2E7W A;  3PX4 A;  2L48 A;  4DXL A;  4DWI A;  1LWC B;  2UUC J;  3KLF A;  4ELV A;  1FXR A;  4QYZ K;  1S12 A;  2RUS A;  5J2N A;  1RHU B;  2P5V A;  4QR1 A;  2EVZ A;  2L08 A;  5KG0 A;  2W9B A;  3W5X A;  4FN5 A;  1G95 A;  3OGZ A;  3NGR A;  1HHS A;  3GB0 A;  2XY7 A;  3VAF A;  5K14 A;  2JVO A;  4RX6 A;  4M8L A;  2KFY A;  4FYX B;  1WHY A;  2QRR A;  3PW5 A;  1HAR A;  1H2U X;  1X4H A;  5HL7 Q;  3DJ4 A;  1HM8 A;  2M3D A;  2PC6 A;  2NUU G;  1W26 A;  1PYO B;  3H5S A;  3IBW A;  3NRB A;  1HMV A;  4KY3 A;  1TU0 B;  1VK3 A;  5A6P A;  3MUV P;  3DRY A;  2FTR A;  4Y2M A;  1LWE A;  1NZA A;  1S6P B;  3IGV A;  1VRT B;  2RSQ A;  3KLI B;  5HBM A;  2XNR A;  4GO7 X;  4PAB A;  4C0B A;  2Q3P A;  3HP6 A;  4OV6 A;  3Q89 A;  3J7Z T;  5EWG A;  2RQK A;  3JSB A;  4WXO A;  3GLJ A;  3T1Y J;  1SH3 A;  1ZZN A;  3Q8S B;  4DV7 J;  3HKW A;  1UA1 A;  1F6T A;  3QNW B;  4E1K A;  5CD4 A;  3KLE B;  3DLE B;  1TK5 A;  1UL3 A;  1QRG A;  2DD8 S;  2FJD B;  3RG6 A;  3M2V B;  1IKX A;  3OR2 A;  3CXC R;  3N79 A;  4L74 A;  1D09 B;  3KWM A;  3PTW A;  4CO1 A;  2DNR A;  4YEA A;  4EK2 A;  2NPF A;  2W8K A;  3FSY A;  2QX0 A;  4NLU A;  2RIL A;  5MAO A;  1QAJ A;  3UD5 A;  2IRU A;  3CDU A;  4ZVE A;  4ERD A;  3R5A A;  1VHF A;  2HLT A;  3DGP B;  3PYE A;  1BXN A;  3TVK A;  5IT4 A;  3G6V A;  5HMY A;  2R7W A;  3DLJ A;  3B8H A;  3JYT A;  2ZOG A;  1FKA F;  1JLB A;  2A2C A;  4FBT A;  4IFY B;  2DNN A;  1Q8L A;  2P6T A;  2ZNY A;  3GQ7 A;  4P2M A;  3PHE A;  3KMS A;  2BM1 A;  3FQK A;  1R6V A;  3H90 A;  3CCS S;  1N36 J;  2YNG A;  2F7V A;  2VBW A;  4A8F A;  5G4D A;  3HF5 A;  2IM0 A;  2HVI A;  2W4P A;  4IG0 B;  4O4G A;  4N69 A;  2XZW A;  1TR0 A;  3QO9 A;  4KGK A;  3FUY A;  3R8Y A;  1TV6 A;  2CZV C;  2KU7 A;  2H3E B;  2R7Q A;  2N7Y A;  2F65 A;  2FZC B;  4M98 A;  2XWX A;  4TYB A;  3J7A 1;  1NCL A;  1QVG R;  3PV8 A;  1VIS A;  3HI9 A;  2HGN A;  3ZXW A;  2JWN A;  1RAC B;  2PA8 D;  1K0T A;  3ILO A;  4C11 A;  2MHN A;  1KFS A;  3K59 A;  1A9N B;  4YB6 A;  2DVI A;  2Z2M A;  4DR4 J;  2VG5 A;  3GQA A;  2CPI A;  4MK9 A;  3V6H A;  2VC1 A;  2C1E B;  2GJF A;  2MJU A;  3N6N A;  1U45 A;  2CQC A;  2HAI A;  3QAE A;  1NK5 A;  3KNG A;  2P9E A;  2RH3 A;  4A4J A;  1HWI A;  2FDN A;  1FDD A;  1TKZ B;  4GVB A;  2ZH7 A;  2A2D A;  3R1W A;  4CYU B;  3D9B A;  2V50 A;  5I42 A;  2BAB A;  1RAB B;  2DR7 A;  4ZS6 A;  4A8X A;  4EA8 A;  4P10 A;  3R5G A;  4KPC A;  4DL0 C;  4EO6 A;  3PYD A;  5E3R A;  4H4M B;  5F8M A;  2MB0 B;  3BPD A;  3GSI A;  1EET B;  3MMB A;  3HHN B;  2OLW A;  5DLF A;  3MPD A;  4D3G A;  2J0W A;  2G1D A;  2DY9 A;  2HFO A;  3MMA A;  1R0A B;  1PYS B;  1SPB P;  3OW2 R;  2XY6 A;  5CCM A;  3LGN A;  4CO3 A;  1XTZ A;  1WDT A;  3A3P B;  4WK3 A;  5AJ3 J;  3LPY A;  3AD8 C;  1BQX A;  2Z8Q A;  1N32 F;  1TMJ A;  4C3L A;  1CG2 A;  2Y8Y A;  3H4B A;  2WVF A;  4DV4 F;  2HNZ A;  4F4Z A;  1XMB A;  4O23 A;  3ZZT A;  3TYT A;  2VA2 A;  2JX2 A;  3M8S A;  4RW6 A;  3QSY B;  1U1Q A;  4ZJL A;  1MW7 A;  3QSI A;  2MJN A;  1EP4 A;  1TVR B;  5F9L A;  3C3L A;  1KKH A;  3GFH A;  2Y8W A;  1IKW A;  1LXN A;  2C2M B;  2CQ2 A;  3FBE A;  3RB6 A;  5DZ6 A;  1JNZ B;  2E7X A;  1QRM A;  3VCD A;  4OYB A;  2XI3 A;  3TZW A;  4IKA A;  2M2B A;  3BYP A;  2MKY A;  2HHW A;  3FEY B;  1WTF A;  2FQQ B;  4QW9 A;  1FWY A;  2XMM A;  4FVM A;  5F0U A;  3IRX B;  3SUC A;  1H73 A;  1V3R A;  4CO4 A;  4JI6 J;  3UWT A;  4G65 A;  4OYO A;  3G2X A;  1YG0 A;  3OVA A;  1NKB A;  2B3T B;  3D3C J;  1WC5 A;  1KSP A;  3T5J A;  4ECW A;  4DG1 B;  3PW4 A;  1UVN A;  1D0E A;  2ZH3 A;  1HQE B;  4AFF A;  4KBI A;  5HQ8 A;  1HLW A;  5KFZ A;  3KHG A;  1N5Y B;  2XI2 A;  3CD6 S;  3V2U C;  2JC0 A;  4XPC A;  2J8S A;  1L3K A;  4MIW A;  3U1N A;  5J1P A;  1J5O B;  4LFC F;  2WB4 A;  3AA8 A;  2GIQ A;  1U0H B;  3DRS A;  3I0S A;  4NA1 A;  3OU9 A;  1NDP A;  3M8P B;  1S1V B;  3DFE A;  1KHW A;  3GSD A;  5T7L A;  4YR0 A;  4DV1 F;  3W8P A;  1XNQ F;  2K1R A;  4BBY A;  1SQG A;  5DDO C;  3MR2 A;  4NZ0 A;  1U2F A;  4W98 A;  2BW2 A;  2QA2 A;  4FPR A;  3TUJ C;  4N6B A;  3PCO B;  5KFM A;  1SC1 B;  3KLG B;  2ROP A;  1FKO A;  5A8W A;  1R3N A;  1YP2 A;  1DBD A;  3KUG A;  2MGZ A;  4LF6 F;  1BY9 A;  2MKJ A;  1HNI B;  4C4W A;  3K7R A;  3J7Z 5;  4JV5 F;  4M63 A;  5EGY A;  2F8E X;  2NS1 B;  2HBR B;  2QLJ B;  4RUB A;  4X4S A;  4QWA A;  2EC0 A;  1LWC A;  4NE9 C;  3J81 Y;  2N3O A;  2ZKT A;  3CCL S;  4HT5 A;  2VIC A;  3NCQ A;  3DU5 A;  3MMC B;  4KAI A;  4QOT A;  5DZ7 A;  2W9C B;  3LQV A;  4KHM A;  4C9D A;  1HBN A;  3D8V A;  2KH9 A;  4I67 A;  4ALZ A;  2L9N A;  2DPI A;  2VZ9 A;  2I5J B;  2CIM A;  4WBF A;  5J2P B;  1XIQ A;  1NJI T;  2HHH J;  1P1L A;  2P2C B;  3NS6 A;  3SZ2 A;  3BQ0 A;  2PD1 A;  2FC8 A;  2OUG A;  4G3I A;  1XN9 A;  2V2V A;  1Y0H A;  2ILY A;  3A12 A;  3GR0 A;  3HHE A;  1KN6 A;  2CDQ A;  2PFD A;  5A8W B;  1B0V A;  4URQ U;  4B17 A;  2V8D A;  2MGZ B;  2DNQ A;  2V2K A;  1T9T A;  1XNR F;  4ED2 A;  2MHE A;  2OAU A;  3VAK A;  1M5P C;  2D3O R;  5HAT A;  4OJ1 A;  3PJX A;  1HBM B;  1C0U A;  4NMX A;  3OH1 A;  4JI2 J;  3QT5 A;  2MKK A;  1JMT A;  1IUJ A;  3D7S B;  1UVM A;  3I31 A;  4ID5 B;  3ZNU A;  1S1V A;  1QTM A;  4KTQ A;  2B8Q A;  2MQ8 A;  4P2S A;  3PW7 A;  4DR1 J;  1QUP A;  3NNA A;  3EZU A;  4EMD A;  1C1C A;  3KK1 B;  3EXY A;  3K89 A;  1UJ4 A;  1WG4 A;  3DM2 A;  4B3O A;  2KVI A;  3W65 A;  4ETZ A;  5A8R B;  2FVR A;  2YY3 A;  1GMV A;  3HVA A;  3ENA A;  2CVI A;  3JQK A;  3K8V A;  4UZC A;  3DXB A;  3F56 A;  4ZVQ B;  3BRK X;  5L8R C;  1KHV A;  4I64 A;  4ED3 A;  4CQ1 A;  2HHV A;  5J2M A;  3CWJ A;  4H54 A;  5B0B A;  2AKW B;  5DDR C;  3NGT A;  3PR4 A;  4XO0 A;  2YNF A;  4K0K F;  4NXM J;  4C3K A;  3CE8 A;  1QJH A;  2MZQ A;  2QA1 A;  1UVI A;  3E01 B;  1HD1 A;  4NA3 A;  3S1T A;  3MZI A;  2EPI A;  1IXK A;  1THJ A;  1HR0 J;  1RTH B;  1S6U A;  4L76 A;  3V6D B;  1I6J A;  1CC7 A;  2LQ9 A;  2LYV A;  1VK8 A;  2R2U A;  4CLF A;  1VIO A;  1PBA A;  1Q5V A;  3FZ2 A;  2L3M A;  4OIX A;  3KYL A;  3Q23 A;  4ECT A;  1V3Z A;  2B5J A;  1EAY C;  4BLG A;  1KD1 T;  2K2P A;  3B4D A;  3HSQ A;  1S4F A;  1NH7 A;  1NPR A;  1IKX B;  2MQQ A;  2LDY A;  5DM7 Q;  2Y0B B;  3D6F B;  2UUB J;  1HBU B;  2PT0 A;  2E29 A;  3FMB A;  2UU9 J;  3NGU A;  1KRR A;  1JNR B;  2Y1R I;  5KFO A;  1HBO B;  2IVF B;  4QYR A;  4B3R J;  1FVS A;  3DDI A;  4KPZ A;  5DJB A;  4HUS A;  1VQY A;  4OJ3 A;  2PEB A;  4HH0 A;  2DH7 A;  1WF2 A;  1JQG A;  1RGV A;  2LCW A;  1MSW D;  3C6U A;  2QV6 A;  2XNQ A;  2ZFH A;  4ZVO B;  3DOK A;  5JVG Q;  5L6S A;  2HWT A;  3I0S B;  1FRI A;  2V0I A;  5ETK A;  5HJX A;  4DZ6 A;  2EBG A;  1FEE A;  1SKW A;  4GKJ J;  3GP9 A;  1G4C A;  1WEZ A;  2IU8 A;  1SQE A;  2ZC3 A;  3N6L A;  3NXZ A;  2Q1L A;  4C97 A;  1RHJ B;  2BRK A;  2O67 A;  4B3T F;  1FJG J;  5KG3 A;  4D3H A;  5GAD I;  4WFX A;  1R89 A;  3DLG B;  1AFI A;  2AYM A;  5ETM A;  3NNH A;  4LSL B;  4Y3C A;  1AFJ A;  2BAN A;  4TNO A;  5CA5 A;  3DDN A;  3EG4 A;  1ZBT A;  4HHU A;  3G87 A;  2RHS B;  3CJ8 A;  4LJM A;  4AE5 A;  5EN1 A;  3TDT A;  4DV0 F;  1BWV A;  2JH3 A;  3MM6 A;  4EQY A;  1Y3K A;  5G0R A;  2HS0 A;  3MWB A;  3CCJ S;  1IJE B;  4HI1 A;  1QAY A;  1HI8 A;  3LO3 A;  3UR3 C;  4DJB A;  5HBM B;  1URN A;  1N5Q A;  4P2X A;  2D3O 1;  2HGM A;  3OBI A;  2OPS B;  2QLW A;  5JXS A;  1RT4 A;  2RB7 A;  4C8M A;  4X65 J;  1HA1 A;  5BR8 J;  1RT1 A;  4L72 B;  1FO1 A;  2GO9 A;  4DL7 A;  2LFV A;  4WYW A;  3Q83 A;  3NAI A;  4YP3 A;  3BSY A;  4O3N A;  2HHT A;  3LGM A;  4LQ9 A;  4W92 B;  4USM A;  3MEC B;  4LVO P;  2NCK L;  5DGB A;  2N82 B;  4NAS A;  2YX4 A;  2ZIT A;  2PI5 A;  1N4I A;  4PR6 A;  2ZZT A;  1KLN A;  2K7K A;  4AAW A;  4MAK A;  3GIL A;  2VFR A;  1WDD A;  2HSE B;  2M52 A;  1M1G A;  3W9J A;  3M9N B;  3JB9 k;  1SCJ B;  5E33 A;  5DQI A;  3BSW A;  1M5H A;  2IYI A;  4LMZ A;  2ZM6 F;  4KPX A;  1BQM A;  4MK7 A;  5T14 A;  1VC0 A;  2F3J A;  3MPW A;  1FX2 A;  2F4F A;  2HVZ A;  3Q22 A;  1YJN S;  4QCL A;  3HZG A;  4ZVT B;  3THP A;  2R9L A;  3PX0 A;  4TY8 A;  4Y0F A;  3ST8 A;  1JLA B;  2GO8 A;  3AQO A;  4DR1 F;  1TKX A;  2Z2L A;  1RYR A;  3OVB A;  1DHM A;  5LM7 E;  3TW0 A;  3OL9 A;  1YJV A;  4BHQ A;  4LBP A;  2EFQ A;  3VBP A;  1RHQ B;  1AW0 A;  3SIP B;  3ULH A;  4U7C A;  3GV5 B;  1VQK S;  2FJE B;  2EFN A;  2Z57 B;  4EFA C;  2H5I B;  4X2B A;  5EHH A;  2UVU A;  1M8N A;  2BEF A;  1KON A;  5F8J A;  4ETX A;  1RWW B;  1H0H B;  3UNY A;  2R7V A;  2YXL A;  2CAD A;  4ZN1 A;  2LU1 A;  1OMS A;  4YUD A;  3R1H A;  1RDR A;  3EJM A;  1E6V B;  4C3M A;  4NXN F;  3IS9 A;  1S1X B;  2EC2 A;  2EKN A;  3VVU A;  2YWE A;  4P71 A;  5C2G A;  2GMJ A;  4ZA1 A;  4G1P A;  2A1B A;  4PPD A;  3JTN A;  5IOL A;  3I4P A;  4L73 A;  3A3O B;  2C28 A;  1DFD A;  2HKE A;  3EDQ B;  1NAQ A;  2B4O A;  1XNQ J;  3V4I B;  5CXT A;  3HO1 A;  4JI8 F;  4AD6 A;  1UMJ A;  3E01 A;  3M32 A;  4B9T A;  5RUB A;  5DG9 A;  2N4D A;  1SJ1 A;  4L3N A;  2YX1 A;  3DU6 A;  1PYT A;  2MKH A;  3I9Z A;  1KGT A;  3LP1 B;  2YKM A;  4DN9 A;  2R42 A;  5KT7 A;  2OSQ A;  1CJU B;  2CQP A;  3C15 B;  1LW2 A;  1SQF A;  3R3I A;  2GAG C;  4MKB A;  4IO9 Q;  3HK2 A;  1FJ7 A;  1HBM A;  3V81 B;  4NRT A;  2C2N A;  5IWA J;  1BC6 A;  1FXJ A;  3GQ9 A;  1LXA A;  1K44 A;  5CYQ A;  4HLB A;  3VGU A;  4DBQ A;  4ZIW A;  5LJ5 Y;  4ZJQ A;  4DV4 J;  4FF2 A;  2OH2 A;  4USH A;  2CQB A;  2R7R A;  2C22 A;  2CPD A;  1FD2 A;  2DGX A;  4DUZ F;  4N77 A;  4USK A;  4P72 A;  3BJY A;  3HHL D;  2GVZ A;  4DV1 J;  2CPY A;  1WTB A;  5DEM A;  4J9R A;  1RXO B;  2MXY A;  1QTN B;  1TAQ A;  1C4C A;  2CNO B;  2PN6 A;  4LRE A;  4F26 A;  2D7S A;  3OJU A;  4E6U A;  1MR7 A;  1KVK A;  4HHH A;  1GT8 A;  2JOQ A;  5DS7 A;  4CH0 S;  3KJQ B;  3BSN A;  4YY3 F;  4B3M J;  4ZPV R;  4K7Q A;  1K47 A;  1VQ5 S;  2YNF B;  3O2I A;  1WOO A;  2ZEJ A;  2F63 A;  2ERR A;  2VOD A;  4LRA A;  1NO8 A;  4M99 A;  5HMX A;  4KQZ A;  4RBU A;  3E8O A;  4ZPW R;  2C42 A;  2XQC A;  4WFN Q;  4J9Q A;  1K1S A;  4QQB A;  3CCE S;  1JLC A;  3KWD A;  3QT8 A;  4NI2 A;  2BX6 A;  2H51 B;  2IVM A;  3D1O A;  2HVH A;  2IC7 A;  1PKU A;  2BJD A;  4F02 A;  3CDB A;  3UPF A;  3FSC A;  3VBK A;  1Z90 A;  3ICL A;  2WOM B;  5F41 A;  3SCK E;  4DUT A;  1N48 A;  3SDE A;  2W0V A;  3ZTP A;  1EB0 A;  3RUB L;  2FC9 A;  3F0N A;  1NHV A;  2AMC B;  1JKH B;  4ES3 A;  1HD0 A;  2WLG A;  4CO5 A;  5FJ4 A;  3SI8 A;  3FCH A;  3GIR A;  2B6A B;  2YKP A;  2M8H A;  3AOB A;  1RLD A;  1UAW A;  2FVS A;  1YJW S;  4JI8 J;  2UUW A;  4CT8 A;  4F50 A;  1HQU B;  3NL0 A;  3PFE A;  1REV A;  2IRY A;  5D4N A;  5ETO A;  5IFM A;  1HYS B;  1HNX J;  3QRR A;  1U6F A;  2J9E A;  3B78 A;  5IC6 B;  1X4E A;  2DNL A;  3IO1 A;  2D9P A;  2QT7 A;  1H72 C;  1T9U A;  2GVZ B;  4Y6I A;  3VNP A;  2FGO A;  2XB2 D;  4XDC A;  3ZZZ A;  3GIJ A;  2EFV A;  4I0W A;  1TTH B;  3S01 A;  3FFI B;  3QBC A;  3SFG A;  3OV7 A;  1HHT P;  1LW0 B;  2ZH5 A;  1U1N A;  4DL3 A;  2J0Q D;  1G97 A;  2DGT A;  4CM2 A;  4M94 A;  3BF4 A;  1GEH A;  1R0C B;  4IHH A;  4WTY A;  1Z4U A;  3R5D A;  3C14 A;  3S7R A;  4CLY A;  1UCN A;  3NG8 A;  1KQS R;  2RQ4 A;  3CC4 S;  3P3D A;  2MMY A;  1NRK A;  1J5E F;  3WX4 A;  1FCA A;  3MMC A;  1AYE A;  2VQE J;  3OH3 A;  1YJ7 A;  3A8E A;  3Q8Y A;  3HFK A;  1FXD A;  4PZV A;  4A8S A;  3RW6 A;  2C3M A;  3QRP A;  4M5D B;  3TAM A;  1ZPW X;  2D74 B;  4LRD A;  1NH8 A;  1SV5 A;  2YWK A;  1ZM3 A;  3AT1 B;  3CCV S;  2ZD1 A;  1HQE A;  3CSK A;  3BGF A;  3MCN A;  4DCO B;  4DLG A;  2ACY A;  1WC6 A;  2GGO A;  2MZR A;  4I6A A;  3CME S;  2CNN B;  3VAH A;  4A8W A;  2LQB A;  3D1H A;  3IS9 B;  4IUF A;  1FRL A;  1RA6 A;  2CJB A;  2FGC A;  4KV8 A;  2EFG A;  4QWE A;  4J90 A;  5JMN A;  1CUL B;  3MM7 B;  1APS A;  1RT7 B;  1R8C A;  5KFH A;  1SC4 B;  1H7X A;  3NEK A;  3T41 A;  1KRP A;  4JI0 J;  2GIF A;  3UCU P;  1RQ0 A;  4KIA A;  1NJX A;  4DI6 A;  1SC6 A;  2GS8 A;  2EG2 A;  1AZS A;  2HBZ B;  2V6A A;  3I5C A;  4BWM A;  1J5O A;  4QR2 A;  4B9L A;  2BE2 A;  3G6X A;  3H4D A;  2IA0 A;  1J5E J;  1IVZ A;  2ALY B;  2ZBC A;  1I51 B;  3CCW A;  3QYY A;  4TKT A;  4ZLP A;  3HPO A;  3GON A;  2NXJ A;  1ZPV A;  3ENW A;  2YWG A;  3TAR A;  3D54 A;  4Y2C A;  1S79 A;  1NSK L;  2W2P P;  1H2T Z;  1IQZ A;  3PXG a;  4ECY A;  1I1G A;  3BGR B;  4USV A;  2HFN A;  1WHW A;  3IG1 B;  1QLN A;  2VFV A;  4F25 A;  1N5V A;  4UOF A;  1BQM B;  1LFP A;  2YNH B;  3KMQ A;  2GJI A;  2E9R X;  2XSF A;  3ENV A;  3FK4 A;  4WP3 A;  1R8B A;  5CYM A;  3VZH A;  4DPU A;  3V4E A;  3TUI C;  4NI2 B;  3JSY A;  3V4M A;  2QKX A;  1UVJ A;  5AT1 B;  3QIP A;  2LXU A;  2VBY A;  4J09 A;  3R7B B;  2K1R B;  4TYA A;  2BJ1 A;  4PAA A;  5SZT A;  3TWD A;  3M30 B;  1WOR A;  2DBB A;  3FCW A;  1GAO A;  1KQG B;  1KQA A;  3JQY A;  2NYH A;  3SCJ E;  1HFE L;  2HNY B;  4OHW A;  4ECQ A;  3CJ0 A;  4F67 A;  5B09 A;  3CD0 A;  4HL9 A;  3D6M B;  3Q8V A;  3G6E S;  2N3L A;  4F4A A;  1ZAX A;  3MMB B;  3D2W A;  1FA0 A;  1ZA1 B;  1RWP B;  3CUN A;  2F1F A;  2YWW A;  2QIV X;  2IC3 A;  4HDH A;  1Q78 A;  5ETL A;  4HUR A;  4YB7 A;  5L1I A;  4K5R A;  3IRX A;  4QJV A;  4RUH A;  4IDK B;  2PMW A;  3MI7 X;  2CJQ A;  4CLK A;  3DLB A;  2RRN A;  3EPI A;  3CB4 A;  1AT1 B;  2V2Q A;  1HV9 A;  2M0G B;  2MDA A;  3QRQ A;  2B51 A;  4X4U A;  2X1B A;  3DRR A;  1OYD A;  4RW9 B;  2ZUG A;  4OX8 A;  2MQL A;  4DQQ A;  4LF8 F;  3MM6 B;  3GIM A;  1WWH A;  2RQC A;  2YWH A;  2CFX A;  5CZV A;  5DDQ C;  3NMR A;  1NDK A;  1O51 A;  2XSJ A;  2OPQ A;  1G2E A;  3CCM S;  4YB5 A;  3QGP A;  2C2R A;  1NM2 A;  3NOC A;  1GTH A;  4X64 J;  2V8H A;  5CCL A;  4USJ C;  1W2B R;  2ZE2 A;  1O5J A;  2V4R A;  1S10 A;  4NRU A;  1XAT A;  4I1T A;  3D1Q A;  1CBK A;  2VOP A;  3SCI E;  1HPZ B;  4DUY J;  1JXV A;  1U4B A;  1WNE A;  2K7J A;  1YKW A;  2I9S A;  3AXK A;  3QPI A;  4MFB A;  2P9G A;  1UVK A;  3D6T B;  2QFI A;  3R7N B;  5IV4 A;  2Y1I A;  2GCF A;  2Z2Y B;  5LSO A;  1LWF A;  4GKK J;  3D0I E;  3GQC A;  5JUM A;  4LF9 J;  4K4Y A;  2NQP A;  3VQS A;  2O3D A;  2JF2 A;  3FZB A;  2GX8 A;  3HHK A;  4J9U E;  1WG5 A;  1FI4 A;  3I3A A;  2ZBR A;  4UUX A;  4KB7 A;  1TK0 A;  2YQ0 A;  3KWE A;  4WU3 A;  4N7T A;  3BBC A;  1C0U B;  2DGU A;  2NYI A;  4ZCM A;  4UW2 A;  1H6K X;  2OKQ A;  4K5S A;  4Z7Y A;  3UD3 P;  1JLA A;  1N4L A;  1VC6 A;  2QIF A;  3WC0 A;  1NXI A;  3TJ9 A;  3OR1 A;  2W7O A;  1NBE B;  3T5L A;  2JL9 A;  3KJV A;  2CKW A;  4ITS A;  1RWN B;  1NJW A;  2DNM A;  2XS2 A;  2UUA J;  2DGV A;  2J0X A;  3L7O A;  1VIX A;  2ROE A;  2V4J A;  2BZ2 A;  3ZO7 A;  4JI4 J;  2CAJ A;  5GMD A;  1CJV A;  1VQN S;  3MDF A;  2BRL A;  2O1P A;  1X4C A;  1S1W B;  3JSM B;  5LMU F;  4OL8 A;  4OYI A;  2A6O A;  3NP5 A;  4M5K A;  2AQ4 A;  3W63 A;  3LOU A;  3NGS A;  2XLI A;  3FGV A;  4ED7 A;  1Q8B A;  1N8R T;  2IA6 A;  1R31 A;  1RT6 B;  2EKY A;  2L9D A;  1GNK A;  1MLA A;  1OQ3 A;  3VWS A;  1WC4 A;  3G96 A;  2NXC A;  2DPJ A;  3R6G B;  2J7K A;  2WON B;  1NLK L;  5L1L A;  2WLD A;  1S7H A;  2VDH A;  4LF2 A;  1OO0 B;  5EWF A;  1QSL A;  1HW8 A;  5AXL A;  3KUE A;  1VJQ A;  2G2Y A;  4ZMM A;  4DPX A;  5GAH I;  2VG6 B;  4CT9 A;  1T03 A;  1JJ4 A;  4K4U A;  5I3P A;  1KHR A;  4X65 F;  2OI6 A;  4NLD A;  2ROG A;  3VAM A;  4ECU A;  2YTC A;  4KH0 B;  4DV3 F;  4IDK A;  4FKY A;  4DEZ A;  4U95 A;  4JV2 A;  4C6A A;  3FBC A;  3CDE A;  3TRG A;  3AA9 A;  3DOM A;  2ADC A;  1VC5 A;  1JX4 A;  3KJF B;  4IFY A;  5KG4 A;  3HFV A;  2B9E A;  2CDR B;  5F3T A;  4DX5 A;  2VH7 A;  1RP5 A;  2PSZ A;  3MEE B;  1SB6 A;  2M5Y A;  1Q7Y T;  3CNQ P;  3DN9 A;  2QIA A;  1EZZ B;  1RTJ B;  2KXF A;  4TLR A;  4FNH A;  5C25 A;  4EA7 A;  4H4K A;  2YPY A;  3SFU A;  5H9F K;  2MKC A;  3KLV A;  3N5B A;  4ZPT R;  2QL5 B;  4I7F A;  1MN7 A;  2QLB B;  3HZE A;  2MLX A;  2E1A A;  2VUG A;  4DF4 A;  1UTA A;  3T1A A;  4DUZ J;  1YIJ S;  3U1M A;  3QJL A;  1T95 A;  3I5A A;  6FDR A;  4ED4 A;  5J2P A;  2PFF B;  2VAS A;  3ISZ A;  4LIR A;  1PC5 A;  4CLW A;  2XYG B;  1MG7 A;  1RAG B;  3J81 U;  5GAG U;  1RT6 A;  4ZP7 A;  3MR6 A;  2BDP A;  4JI3 F;  3CJK A;  3IAM 9;  2ZM6 J;  1NJZ A;  2JHE A;  4UOC A;  2UVR A;  4CM0 A;  4EBD A;  2L9W A;  2XZT B;  1MWZ A;  4KPY A;  1KC8 T;  4B3S J;  1FFG B;  3KK2 A;  5L46 A;  5AXM A;  2K3I A;  4F2S A;  3SRT A;  3P47 A;  1X4A A;  1IR0 A;  2V8V A;  4X64 F;  4YR3 A;  5ETN A;  3RRG A;  3RR7 A;  4O3S A;  4GKJ F;  2DHH A;  4OZN A;  1N52 B;  2G0C A;  3EZO A;  1RKJ A;  5HVH A;  4OLO A;  2EG1 A;  1HWK A;  3IA0 A;  4R37 A;  3IC1 A;  4DV0 J;  1L3T A;  1M1K T;  1YWX A;  4DS4 A;  4U7U D;  1YK9 A;  3UD4 P;  3BQ1 A;  2AJF E;  2E5J A;  4P73 A;  4DPT A;  3TEH B;  2VU5 A;  2MQM A;  6AT1 B;  3K5O A;  2XY5 A;  2E1R A;  1NK7 A;  2HFS A;  3ZFV A;  1N33 J;  2OIH A;  1IN0 A;  2X1G A;  3W61 A;  3MUR P;  4Q8E A;  2AYE A;  3MFH A;  2M70 A;  3SYZ A;  2IYG A;  2YKM B;  2IM1 A;  1L3U A;  5CH7 B;  2ZD1 B;  4NLQ A;  4XTT A;  2XG8 A;  3LWL A;  1OQ6 A;  1TL4 A;  2IVY A;  5A6W A;  2H48 B;  5HP1 A;  3DNC A;  3MF5 A;  4MJK A;  3DK5 A;  4B3R F;  4G1Q A;  1WKL A;  3U7J A;  4J91 A;  1S6Q A;  1KEK A;  2OEG A;  3ZZU A;  4B9M A;  1FRX A;  3T1H F;  3FSB A;  4NLV A;  1H38 A;  1FDA A;  2GGP A;  2RNE A;  3MM5 B;  4O4R A;  3G8T A;  4OZ0 A;  4MTP A;  4S0M A;  2XGP A;  2I5K A;  3QGH A;  1V5V A;  1X4F A;  3SCL E;  2HHU A;  4PQU B;  3MED B;  5U2K A;  3SXL A;  3AHP A;  1TQL A;  3ZZO A;  1OY9 A;  3AOA A;  3LGH A;  3M05 A;  3POT A;  5B7W A;  2PMH A;  3M8Z A;  3HXM A;  3G82 B;  2CXE A;  1ZAV A;  2DHA A;  2CQD A;  1BHN A;  1KTV A;  2RS2 A;  2FKO A;  2DRA A;  4G1I A;  2ZZM A;  3LAK A;  2NLW A;  4HI2 A;  4NYP A;  4J9V A;  4LRC A;  4WE1 B;  4Y2A A;  4OMF G;  2R8K A;  2D41 A;  4IQM A;  2J9D E;  1JB0 C;  1Q16 B;  3TX0 A;  3MD3 A;  4UY8 T;  4WZM A;  3DC2 A;  4QBU A;  2H1Y A;  4HR2 A;  4N6A A;  2JLF A;  1U26 A;  3E51 A;  4P6Q A;  5DQH A;  2Q79 A;  4IR1 A;  1T05 A;  2YKA A;  4EZ9 A;  1GX6 A;  1UPP A;  2OP5 A;  4X84 A;  2NZC A;  3WC2 A;  2VOO A;  2IDL A;  1SKU B;  4TN2 A;  1YVF A;  1N6Q B;  1HNI A;  2XYH B;  2R7T A;  1V6H A;  2AJQ A;  1S1X A;  2XMT A;  2VL1 A;  4Q5V A;  3DLK B;  4DDF A;  2LXI A;  4XPE A;  2BW7 A;  3AB2 B;  3RB4 A;  2EEY A;  2G1H A;  4R8U A;  3VBM A;  3T3F A;  3B82 A;  4M5I A;  4DV7 F;  1G1X A;  2VFT A;  4V19 J;  2ZWO A;  4WZQ A;  4USW A;  4U8V A;  1C1B A;  4R7P A;  2IM2 A;  3PO5 A;  1VQ7 S;  4NCB A;  4JYA F;  1GQE A;  4X62 F;  1BD6 A;  5F0W A;  1WOP A;  1WI6 A;  4QZV B;  1BE4 A;  4DSI A;  1EWW A;  5KFP A;  4W4M A;  4DU8 A;  1QY7 A;  2CPE A;  1N5Y A;  1OSD A;  4FNI A;  4CH1 A;  2XMJ A;  1C0T B;  3MEE A;  2VG5 B;  3RU0 A;  3GV8 B;  5KFY A;  2HHH F;  2J7W A;  3IGJ A;  2DRB A;  4PG6 A;  4NLT A;  2BQ3 A;  1HNW J;  5F8H A;  3OHA A;  3KLF B;  3HSJ A;  4LVN P;  1OYE A;  5HO4 A;  4J9L A;  4I7F B;  4EBE A;  2IMW P;  1XK8 A;  2FZG B;  3QGG A;  2Z56 B;  4HTJ A;  4ZVH A;  4HYK A;  1MWY A;  2LKZ A;  5A0Y A;  1URR A;  1O6X A;  1MNE A;  1V67 A;  2BM0 A;  4A8M P;  4JI1 F;  2YQ3 A;  5CAA A;  5B0G A;  2AW0 A;  1OIA A;  1R6Y A;  3DM2 B;  2CZ9 A;  1F9E B;  1DTQ A;  4DZD A;  5KAK A;  1XNR J;  1AB8 A;  1NHU A;  2V9K A;  2XSJ B;  3W66 A;  1Z2L A;  4C48 A;  2UVW A;  1S9E B;  1IBM J;  3EGZ A;  1TKT A;  2XWY A;  1OS5 A;  3FMW A;  5K8M A;  1UWB A;  3HUL A;  4HEA 9;  1NEE A;  2B4V A;  5KG6 A;  2ZH4 A;  2RU9 A;  3OTB A;  3HVT B;  2RU3 A;  3MUM P;  4ECV A;  1U8S A;  3D0H E;  3BB5 A;  3DGP A;  1CUL A;  2XMU A;  2AEJ A;  4KYZ A;  4RJV A;  3VQT A;  3I32 A;  1FK9 A;  2WSE C;  3KG0 A;  4MFB B;  4A46 A;  4F3Q A;  4XIU A;  4OX6 A;  4J18 A;  3DHX A;  3NY0 A;  4RNF A;  3I3X A;  1LQ9 A;  3MM5 A;  4OI6 A;  4CDI A;  5BJR A;  4Q43 A;  4DR5 J;  2KO1 A;  3TP2 A;  4ECR A;  1VQP S;  3MCM A;  1SKS A;  1VQ8 S;  4LF6 J;  3HJJ A;  3ZZY A;  3MPY A;  4ZIV A;  2QFJ A;  1RWO B;  4P75 A;  4ZP9 A;  2HQC A;  2Z30 B;  2HG4 A;  3HSG A;  3O44 A;  2WAQ D;  4ICL B;  3AOD A;  4PXD A;  4CTA B;  4WCE Q;  3K57 A;  3GU0 A;  5ETS A;  1RJJ A;  3D3B J;  5HI7 A;  5FLX Y;  4C0H A;  1I94 F;  2D69 A;  2QSF A;  1WKJ A;  4ID5 A;  3MAA B;  5E0O A;  3K5M A;  3OVS A;  3I9V 9;  4G3Q A;  4LF4 F;  1UWA A;  3C14 B;  3D67 A;  4WE1 A;  5K5M A;  3PX6 A;  4LFC J;  5CHC B;  5FD1 A;  1U6B A;  4OX7 A;  2DO0 A;  1YLX A;  2W4D A;  3ISN C;  3CD7 A;  5IM0 A;  1S5Z A;  5DM6 Q;  3FSI A;  3EWG A;  2JEF A;  4DSL A;  2AGQ A;  4O0I A;  4LF9 F;  3FSX A;  2F8M A;  1CLF A;  2WOM A;  2WVB A;  1X0P A;  1U1K A;  1NK4 A;  2Y3Y A;  5EWE A;  2WSC C;  1TAU A;  2DIU A;  1NK9 A;  2HK3 A;  6FD1 A;  1WF1 A;  5LL6 d;  1RHK B;  1ULR A;  3SQG B;  5H9E K;  4RW8 B;  2V0L A;  1ZA2 B;  3KLH B;  1Q81 T;  1RTI A;  4LFB F;  2R8H A;  3CUL A;  1WF0 A;  3RR8 A;  2W01 A;  1B99 A;  4JUZ A;  3MHY A;  1VRT A;  1Y5I B;  1KTQ A;  2LA4 A;  2VD3 A;  3DRX A;  3DRS B;  1HIY A;  4J7C A;  5C25 B;  5KOX A;  1MMN A;  2HRU A;  3W9I A;  1VQL S;  3E2E A;  1N56 A;  5H1S V;  3POT B;  4WU2 A;  4Q45 A;  4C11 B;  1VQ6 S;  1F2G A;  1Z2Z A;  5A76 A;  3IR5 B;  5M2U A;  1IBK F;  3HHL C;  4OYX A;  4PQA A;  3BN7 A;  2RDJ A;  4IRD A;  2XM3 A;  3QQC D;  1F1B B;  2VC0 A;  4F4K A;  4HZD A;  3TAP A;  1XR5 A;  5CAB A;  1RKI A;  1NK0 A;  2DO4 A;  3MCO A;  3C66 A;  3D28 A;  4U96 A;  5J2Q A;  4OZL A;  2EFO A;  3M2U B;  1SIW B;  2RML A;  5KFL A;  3SV3 A;  3M6X A;  3M1V B;  5J1E A;  3DXS X;  1RAE B;  1RT2 A;  3ZTQ A;  1T05 B;  5MLC V;  2BOP A;  2PGC A;  2MQP A;  1U0H A;  2X1A A;  5ADX U;  3OD2 A;  1VQ9 S;  3EGV A;  4RW4 A;  3KNA A;  4FYD A;  3J7Y I;  1BWE A;  4M5D A;  3D98 A;  3VAJ A;  2OPS A;  3BSA A;  2IPO B;  2MY7 A;  2I5J A;  2LU2 A;  1F5A A;  2VPX B;  2R2T A;  2X1F A;  3NWR A;  4BS2 A;  4ANC A;  3FTT A;  4OZ3 A;  5BXI A;  5C42 A;  4BCA A;  3MR3 A;  4X66 F;  3MAQ A;  1JXL A;  3WZ0 A;  4ANE A;  4DSF A;  1FFS B;  1Y11 A;  1Y4Z B;  4ECX A;  1RUS A;  2FB0 A;  1PAU B;  2HGL A;  2QO3 A;  2JNJ A;  3ZNJ 1;  1RWV B;  5DET A;  3LWM A;  2G2Z A;  4IRK A;  5KG2 A;  3KDN A;  1RTI B;  1H74 A;  1M5K C;  5IZH A;  1X4B A;  2GHW A;  5C24 B;  1E6Y A;  3MUT P;  4I4B A;  2ZNZ A;  2YPZ A;  3KK3 A;  4LF8 J;  5KOW A;  3OFE A;  5GAE U;  3GPA A;  2DGS A;  4QWC A;  3HVW A;  1HM9 A;  4IHF A;  1IKY B;  4NCG B;  4NLW A;  1H2V Z;  4DFK A;  4JI1 J;  1UVL A;  1HQ2 A;  3L7P A;  3V6D A;  3KDO A;  4P7V A;  2IHR 1;  5HQM A;  1Q79 A;  2JEI A;  1GXL A;  4O0N A;  4DHV A;  3NKY A;  3KXD A;  3UO0 A;  5AE2 A;  4DR3 F;  2QL9 B;  3L9Z A;  2A18 A;  2RHQ B;  4FPI A;  5AFU U;  1ZTW A;  4C2M A;  4DR5 F;  4PWD B;  1QD1 A;  3M8W A;  2NXE A;  2IRX A;  1ZYQ A;  1KWM A;  5DGA A;  4B9V A;  3H2U B;  2HBQ B;  4N27 A;  1SUQ A;  1YP4 A;  4LT6 A;  2G0J A;  2HHQ A;  4PG7 A;  1VRU A;  1D9A A;  5AFU V;  1T11 A;  3HKZ D;  3OH2 A;  5KFW A;  1RSC A;  4DL6 A;  4IYQ A;  1MRL A;  2VBX A;  2PE8 A;  4HT7 A;  3FC9 A;  4RL1 A;  3ZZR A;  4NOH A;  1L3V A;  1D9D A;  4YS2 A;  4YHH F;  2M88 A;  3WHI A;  4KHP F;  2DYA A;  2UXD J;  2RDI A;  1ZM4 A;  2DNG A;  3HDS A;  3JQM A;  3X3U A;  3Q8Q B;  4PUO B;  2MLY A;  3OL8 A;  1NSP A;  4FYV B;  3GOS A;  5HQL A;  3Q8R B;  2HND A;  2BBE A;  2B9X A;  1JLQ B;  1VHI A;  3T5K A;  3QJP A;  3IBC B;  2WHO A;  4OYA A;  2OPR B;  2M9K A;  4E0D A;  2E1M C;  3PIP Q;  4ED5 A;  2MTL A;  3G8Q A;  5DQG A;  4C8Y A;  1SJR A;  3WBZ A;  5KFD A;  1UET A;  2RVJ A;  4QPX A;  2K8G A;  5A0Y B;  2Y1J A;  4X4V A;  3CO0 P;  4U6P A;  3K0J A;  1HWJ A;  2CNK B;  2R7S A;  4YFU A;  4DOZ A;  2HW3 A;  4ZOS A;  1DQ9 A;  1GXU A;  2I6W A;  3BO2 A;  3BBB A;  1WEY A;  3B54 A;  2FJX A;  2GGP B;  4K59 A;  5KT2 A;  4QWB A;  4ZCL A;  3MTJ A;  4Q44 A;  2YKO A;  3CGI A;  3G4S S;  2QYC A;  1XC9 A;  3OTC A;  2OTJ S;  2BJ3 A;  4LSN B;  1EKS A;  2VB6 A;  4GVL A;  4M5J A;  3M6U A;  5EUH A;  2MZS A;  3BDE A;  3PYF A;  3Q2S C;  3RBZ A;  1RTJ A;  3FDS A;  5DDP C;  5BR8 F;  2VJV A;  1RU1 A;  2UUA F;  4L75 A;  5AXN A;  1J27 A;  1TDT A;  2HFU A;  3G9C A;  2NPO A;  4I6W A;  4KKO B;  1Q95 G;  3TIS A;  1RZM A;  5G0R B;  3WDO A;  2UU9 F;  1JLG A;  2NR0 A;  3VGV A;  2CA9 A;  5I4M A;  2B8P A;  1F5C A;  2ATC B;  3JS9 A;  1FNM A;  5KFA A;  2XO7 A;  3M32 B;  3R5C A;  5GVQ A;  2DNY A;  2XEX A;  2J7U A;  3NNC A;  3BQ2 A;  4WKY A;  2KI2 A;  3M2V A;  3OR2 B;  2GGQ A;  4XAK A;  4IO1 A;  4H4O A;  1LWF B;  4FZV A;  3GFZ A;  5IQQ A;  1ZM2 A;  2LLZ A;  1T7P A;  1J2V A;  3BSS A;  2FHJ D;  5E3A A;  1AA1 B;  1RTD A;  4QIV A;  3GFY A;  2DIT A;  5CYQ B;  2VQE F;  3GUE A;  3OT9 A;  5IT9 Y;  4AYB D;  3L7U A;  1UEK A;  3CCQ S;  2VFU A;  2WON A;  3CED A;  2ZJP Q; 
#chains in the Genus database with same CATH homology
 2QKX A;  4KPZ A;  5E3P A;  2G1H A;  3VBM A;  3VBL A;  2RIJ A;  3D98 A;  4HUS A;  4J09 A;  5DEM A;  4DCL A;  1YP3 A;  3DJ4 A;  1HM8 A;  1KK4 A;  3OW5 A;  3SPT A;  2P5Z X;  1J2Z A;  4R7P A;  3TWD A;  2ICY A;  2JFK A;  3ECT A;  4E6U A;  1MR7 A;  4MFG A;  3HHD A;  3FTT A;  5L6S A;  2WLC A;  1KQA A;  3JQY A;  3DHO A;  1KGQ A;  2QIA A;  2V0I A;  2JF3 A;  4EA9 A;  3HJV A;  1MR9 A;  1QRE A;  4EA7 A;  2IU9 A;  4MZU A;  3TIO A;  3BFP A;  3OU9 A;  3R5B A;  2IU8 A;  2P2O A;  3IGJ A;  3MQG A;  1V3W A;  1T3D A;  4EAA A;  2G2Z A;  4HCQ A;  4M99 A;  4G3S A;  2QIV X;  2OEF A;  4E1K A;  1KRV A;  2V0H A;  4HUR A;  4M28 A;  2VD4 A;  3FS8 A;  1QRG A;  3OTM A;  1QRF A;  3KWC A;  2OI7 A;  3KWD A;  4N6B A;  2TDT A;  3PTW A;  1HM9 A;  3EH0 A;  4IHF A;  2IC7 A;  1YP2 A;  2Q4J A;  3EG4 A;  2OI5 A;  3FSY A;  3FSC A;  1Z90 A;  3VBK A;  4M2B A;  4EAB A;  1HV9 A;  3CJ8 A;  2IUA A;  1SSM A;  3G87 A;  1V67 A;  3TDT A;  3TZX A;  2W0V A;  4EQY A;  3EEV A;  3IM9 A;  2WLF A;  2WLG A;  3R5A A;  5DG3 A;  4RR5 A;  4IHG A;  3OTZ A;  5DZ7 A;  3BXY A;  3C8V A;  5AFU U;  3D8V A;  4E79 A;  3R3R A;  3IXC A;  3SRT A;  3P47 A;  2G2O A;  4H7O A;  1OCX A;  3GVD A;  4KNR A;  4E75 A;  4N27 A;  1NM2 A;  1YP4 A;  4ISX A;  3BSY A;  3EZO A;  5F42 A;  3VNP A;  4J18 A;  5AFU V;  4R37 A;  1XAT A;  3I3X A;  4N69 A;  3TZY A;  3BV8 A;  3TV0 A;  1MRL A;  3R8Y A;  4K6R A;  4AAW A;  4AA7 A;  4RL1 A;  3HJJ A;  2WLE A;  4M98 A;  1G97 A;  3BSW A;  4AC3 A;  4IHH A;  4KPX A;  3R5D A;  3QAT A;  2QC3 A;  3R2W A;  2JFD A;  3R97 A;  3SBM A;  2JF2 A;  4M9C A;  5E3Q A;  2QJ3 A;  3I3A A;  3VBN A;  3GOS A;  3KWE A;  3ST8 A;  4G3Q A;  3K89 A;  3DK5 A;  3FOQ A;  1S80 A;  4E6T A;  3VBP A;  2OEG A;  3R1W A;  1KK5 A;  3FSX A;  3FWW A;  2GGO A;  3FSB A;  3PMO A;  1KRU A;  3Q1X A;  3VBI A;  4G3P A;  3BRK X;  4EA8 A;  5ADX V;  3TZZ A;  2I5K A;  4KQL A;  2W0W A;  2V0J A;  5L6V A;  3H0P A;  5E3R A;  5U2K A;  4HZC A;  1KK6 A;  1SSQ A;  4KNX A;  2V0L A;  2VHE A;  3MQH A;  3F1X A;  1QRL A;  1SST A;  3TK8 A;  1TDT A;  2AQ9 A;  4R36 A;  1THJ A;  3NZ2 A;  2NPO A;  3R0S A;  2FKO A;  4M2A A;  5DEP A;  3RGI A;  3TIS A;  3OUP A;  3T57 A;  3R5C A;  2CUY A;  3IM8 A;  1MLA A;  1KGT A;  4QBU A;  1QQ0 A;  3HSQ A;  2H1Y A;  4N6A A;  3R3I A;  4HZD A;  2GGQ A;  4G87 A;  4EGG A;  2WLD A;  2C2N A;  4FCE A;  3BSS A;  1FXJ A;  1HM0 A;  1LXA A;  2ICX A;  1QRM A;  3MC4 A;  3VBJ A;  1G95 A;  2G2Y A;  1XHD A;  3TQE A;  3TZW A;  3GUE A;  2V0K A;  2XAT A;  1KHR A;  2OI6 A;  5DZ6 A;  1KRR A;  4MYO A;  3V4E A;  3P1B A;  1FWY A;  5ADX U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...