1QRLA

A closer look at the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MQEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
total genus 76
structure length 214
sequence length 214
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrlA00
2OEGA 1T3DA 2W0VA 3IGJA 1FXJA 2NPOA 4HZDA 4MZUA 3TV0A 3OU9A 3R5CA 2V0JA 3PMOA 3FOQA 4AC3A 4DCLA 3GUEA 1QRLA 2WLDA 5DG3A 2QIVX 4IHGA 2V0KA 3MQHA 3BSSA 1YP2A 1KK5A 4E79A 4HUSA 2JF2A 2QKXA 1QRMA 3FS8A 3KWCA 2WLCA 4HURA 3C8VA 3DJ4A 4R7PA 1S80A 4M2BA 3D8VA 3TIOA 4EA8A 4N27A 1KRUA 1QQ0A 2WLEA 1OCXA 1SSQA 3EEVA 4E75A 3VBLA 2OI6A 2VHEA 5DEPA 2IU9A 5F42A 1KK4A 2QIAA 3FSBA 4EGGA 1G95A 3OUPA 1SSMA 3R0SA 3SRTA 2TDTA 3IXCA 4M99A 3I3AA 4J18A 2W0WA 4R37A 4ISXA 2JF3A 3JQYA 5AFUV 2GGQA 2OI5A 3CJ8A 4N6AA 1HM8A 4E6UA 3R5BA 4KQLA 3BXYA 3VBNA 4FCEA 3FSYA 2RIJA 3Q1XA 3FWWA 4MFGA 3VBKA 5ADXU 2GGOA 4KNRA 3GOSA 2V0IA 2OEFA 1V3WA 3I3XA 3VBIA 3TISA 1HM0A 2IC7A 1KQAA 2XATA 3P47A 4H7OA 1KGQA 4G3PA 4M9CA 3KWEA 4MYOA 4AA7A 3FSCA 2V0LA 3BRKX 2VD4A 3MC4A 2Q4JA 3EG4A 5E3QA 3GVDA 4KNXA 3KWDA 5ADXV 1HV9A 1XATA 3V4EA 1QRGA 3R5AA 1MRLA 2AQ9A 3TDTA 3R1WA 4N6BA 3FTTA 4G3SA 1FWYA 1MR7A 3R8YA 3DHOA 3HJJA 1J2ZA 3R5DA 1LXAA 3VNPA 1KRRA 4M98A 4EAAA 3FSXA 5E3PA 2ICXA 2P2OA 1TDTA 1THJA 4G3QA 3ECTA 3DK5A 3P1BA 4IHFA 2FKOA 1SSTA 4KPZA 4E6TA 4N69A 2I5KA 4EQYA 3HSQA 2IU8A 3T57A 3BSYA 3F1XA 3TK8A 3VBJA 1Z90A 1KK6A 2WLGA 4HCQA 4KPXA 4M2AA 1KHRA 1KGTA 4G87A 2V0HA 2IUAA 3BFPA 3EH0A 3TWDA 3OTZA 4HZCA 4J09A 3OW5A 4K6RA 1MR9A 1QRFA 3D98A 4R36A 4E1KA 2WLFA 5L6VA 3BSWA 1XHDA 1V67A 1YP4A 3NZ2A 5E3RA 3ST8A 2ICYA 4M28A 4IHHA 3MQGA 4EA7A 3R3IA 1HM9A 1QREA 3R2WA 4EABA 5AFUU 3R3RA 4EA9A 3SPTA 3OTMA 1G97A 2OI7A 5DEMA 5L6SA 3VBMA 5U2KA 4AAWA 1KRVA 1YP3A 3VBPA
chains in the Genus database with same CATH superfamily
2OEGA 1T3DA 2W0VA 3IGJA 1FXJA 2NPOA 4HZDA 4MZUA 3TV0A 3OU9A 3R5CA 3OH3A 2V0JA 3PMOA 3FOQA 4AC3A 4DCLA 3GUEA 1QRLA 2WLDA 5DG3A 2QIVX 3GQ7A 4IHGA 2V0KA 3MQHA 3BSSA 1YP2A 1KK5A 4E79A 4HUSA 2JF2A 2QKXA 1QRMA 3FS8A 3KWCA 2WLCA 3OH4A 4HURA 3C8VA 3DJ4A 4R7PA 1S80A 4M2BA 3D8VA 3TIOA 4EA8A 4N27A 1KRUA 1QQ0A 2WLEA 1OCXA 1SSQA 3EEVA 4E75A 3VBLA 2OI6A 2VHEA 5DEPA 2IU9A 5F42A 1KK4A 2QIAA 3FSBA 4EGGA 1G95A 3OUPA 1SSMA 3R0SA 3SRTA 2TDTA 3IXCA 4M99A 3I3AA 4J18A 2W0WA 4R37A 4ISXA 2JF3A 3JQYA 5AFUV 2GGQA 2OI5A 3CJ8A 4N6AA 1HM8A 4E6UA 3R5BA 4KQLA 3BXYA 3GQAA 3VBNA 4FCEA 3FSYA 1N4IA 2RIJA 3FWWA 3Q1XA 4MFGA 3SUCA 3VBKA 5ADXU 2GGOA 4KNRA 3GOSA 2V0IA 2OEFA 1V3WA 3I3XA 3VBIA 3TISA 1HM0A 2IC7A 1KQAA 2XATA 3P47A 4H7OA 1KGQA 4G3PA 4M9CA 3KWEA 4MYOA 4AA7A 3FSCA 2V0LA 3BRKX 2VD4A 3OGZA 3MC4A 2Q4JA 3EG4A 5E3QA 3GVDA 3OH0A 3KWDA 4KNXA 5ADXV 1HV9A 1XATA 3V4EA 1QRGA 3R5AA 1MRLA 2AQ9A 3TDTA 3R1WA 4N6BA 3FTTA 4G3SA 1FWYA 1MR7A 3OH1A 3R8YA 3DHOA 3HJJA 1J2ZA 3R5DA 1L0SA 1LXAA 3VNPA 1KRRA 4M98A 4EAAA 3FSXA 5E3PA 2ICXA 2P2OA 1TDTA 1THJA 4G3QA 3ECTA 3DK5A 3P1BA 4IHFA 2FKOA 1SSTA 4KPZA 4E6TA 4N69A 2I5KA 4EQYA 3HSQA 2IU8A 3T57A 3BSYA 3F1XA 3TK8A 3VBJA 1Z90A 1KK6A 1Z2FA 2WLGA 3GQ8A 4HCQA 1EWWA 4KPXA 4M2AA 1KHRA 1KGTA 4G87A 2V0HA 2IUAA 3BFPA 3EH0A 3TWDA 3OTZA 4HZCA 4J09A 3OW5A 4K6RA 3GQ9A 1MR9A 1QRFA 3D98A 4R36A 4E1KA 2WLFA 5L6VA 3BSWA 1XHDA 1V67A 1YP4A 3NZ2A 5E3RA 3ST8A 2ICYA 4M28A 4IHHA 3MQGA 4EA7A 3R3IA 1HM9A 1QREA 3R2WA 4EABA 5AFUU 3R3RA 4EA9A 3SPTA 3OTMA 1G97A 2OI7A 5DEMA 3OH2A 5L6SA 3VBMA 1M8NA 5U2KA 4AAWA 1KRVA 1YP3A 3VBPA
chains in the Genus database with same CATH topology
2OEGA 1T3DA 2W0VA 3IGJA 1FXJA 2NPOA 4HZDA 4MZUA 3TV0A 3OU9A 3R5CA 2V0JA 3PMOA 3FOQA 4AC3A 4DCLA 3GUEA 1QRLA 2WLDA 5DG3A 2QIVX 4IHGA 2V0KA 3MQHA 3BSSA 1YP2A 1KK5A 4E79A 4HUSA 2JF2A 2QKXA 1QRMA 3FS8A 3KWCA 2WLCA 4HURA 3C8VA 3DJ4A 4R7PA 1S80A 4M2BA 3D8VA 3TIOA 4EA8A 4N27A 1KRUA 1QQ0A 2WLEA 1OCXA 1SSQA 3EEVA 4E75A 3VBLA 2OI6A 2VHEA 5DEPA 2IU9A 5F42A 1KK4A 2QIAA 3FSBA 4EGGA 1G95A 3OUPA 1SSMA 3R0SA 3SRTA 2TDTA 3IXCA 4M99A 3I3AA 4J18A 2W0WA 4R37A 4ISXA 2JF3A 3JQYA 5AFUV 2GGQA 2OI5A 3CJ8A 4N6AA 1HM8A 4E6UA 3R5BA 4KQLA 3BXYA 3VBNA 4FCEA 3FSYA 2RIJA 3Q1XA 3FWWA 4MFGA 3VBKA 5ADXU 2GGOA 4KNRA 3GOSA 2V0IA 2OEFA 1V3WA 3I3XA 3VBIA 3TISA 1HM0A 2IC7A 1KQAA 2XATA 3P47A 4H7OA 1KGQA 4G3PA 4M9CA 3KWEA 4MYOA 4AA7A 3FSCA 2V0LA 3BRKX 2VD4A 3MC4A 2Q4JA 3EG4A 5E3QA 3GVDA 4KNXA 3KWDA 5ADXV 1HV9A 1XATA 3V4EA 1QRGA 3R5AA 1MRLA 2AQ9A 3TDTA 3R1WA 4N6BA 3FTTA 4G3SA 1FWYA 1MR7A 3R8YA 3DHOA 3HJJA 1J2ZA 3R5DA 1LXAA 3VNPA 1KRRA 4M98A 4EAAA 3FSXA 5E3PA 2ICXA 2P2OA 1TDTA 1THJA 4G3QA 3ECTA 3DK5A 3P1BA 4IHFA 2FKOA 1SSTA 4KPZA 4E6TA 4N69A 2I5KA 4EQYA 3HSQA 2IU8A 3T57A 3BSYA 3F1XA 3TK8A 3VBJA 1Z90A 1KK6A 2WLGA 4HCQA 4KPXA 4M2AA 1KHRA 1KGTA 4G87A 2V0HA 2IUAA 3BFPA 3EH0A 3TWDA 3OTZA 4HZCA 4J09A 3OW5A 4K6RA 1MR9A 1QRFA 3D98A 4R36A 4E1KA 2WLFA 5L6VA 3BSWA 1XHDA 1V67A 1YP4A 3NZ2A 5E3RA 3ST8A 2ICYA 4M28A 4IHHA 3MQGA 4EA7A 3R3IA 1HM9A 1QREA 3R2WA 4EABA 5AFUU 3R3RA 4EA9A 3SPTA 3OTMA 1G97A 2OI7A 5DEMA 5L6SA 3VBMA 5U2KA 4AAWA 1KRVA 1YP3A 3VBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEG A;  1T3D A;  2W0V A;  3IGJ A;  1FXJ A;  2NPO A;  4HZD A;  4MZU A;  3TV0 A;  3OU9 A;  3R5C A;  2V0J A;  3PMO A;  3FOQ A;  4AC3 A;  4DCL A;  3GUE A;  1QRL A;  2WLD A;  5DG3 A;  2QIV X;  4IHG A;  2V0K A;  3MQH A;  3BSS A;  1YP2 A;  1KK5 A;  4E79 A;  4HUS A;  2JF2 A;  2QKX A;  1QRM A;  3FS8 A;  3KWC A;  2WLC A;  4HUR A;  3C8V A;  3DJ4 A;  4R7P A;  1S80 A;  4M2B A;  3D8V A;  3TIO A;  4EA8 A;  4N27 A;  1KRU A;  1QQ0 A;  2WLE A;  1OCX A;  1SSQ A;  3EEV A;  4E75 A;  3VBL A;  2OI6 A;  2VHE A;  5DEP A;  2IU9 A;  5F42 A;  1KK4 A;  2QIA A;  3FSB A;  4EGG A;  1G95 A;  3OUP A;  1SSM A;  3R0S A;  3SRT A;  2TDT A;  3IXC A;  4M99 A;  3I3A A;  4J18 A;  2W0W A;  4R37 A;  4ISX A;  2JF3 A;  3JQY A;  5AFU V;  2GGQ A;  2OI5 A;  3CJ8 A;  4N6A A;  1HM8 A;  4E6U A;  3R5B A;  4KQL A;  3BXY A;  3VBN A;  4FCE A;  3FSY A;  2RIJ A;  3Q1X A;  3FWW A;  4MFG A;  3VBK A;  5ADX U;  2GGO A;  4KNR A;  3GOS A;  2V0I A;  2OEF A;  1V3W A;  3I3X A;  3VBI A;  3TIS A;  1HM0 A;  2IC7 A;  1KQA A;  2XAT A;  3P47 A;  4H7O A;  1KGQ A;  4G3P A;  4M9C A;  3KWE A;  4MYO A;  4AA7 A;  3FSC A;  2V0L A;  3BRK X;  2VD4 A;  3MC4 A;  2Q4J A;  3EG4 A;  5E3Q A;  3GVD A;  4KNX A;  3KWD A;  5ADX V;  1HV9 A;  1XAT A;  3V4E A;  1QRG A;  3R5A A;  1MRL A;  2AQ9 A;  3TDT A;  3R1W A;  4N6B A;  3FTT A;  4G3S A;  1FWY A;  1MR7 A;  3R8Y A;  3DHO A;  3HJJ A;  1J2Z A;  3R5D A;  1LXA A;  3VNP A;  1KRR A;  4M98 A;  4EAA A;  3FSX A;  5E3P A;  2ICX A;  2P2O A;  1TDT A;  1THJ A;  4G3Q A;  3ECT A;  3DK5 A;  3P1B A;  4IHF A;  2FKO A;  1SST A;  4KPZ A;  4E6T A;  4N69 A;  2I5K A;  4EQY A;  3HSQ A;  2IU8 A;  3T57 A;  3BSY A;  3F1X A;  3TK8 A;  3VBJ A;  1Z90 A;  1KK6 A;  2WLG A;  4HCQ A;  4KPX A;  4M2A A;  1KHR A;  1KGT A;  4G87 A;  2V0H A;  2IUA A;  3BFP A;  3EH0 A;  3TWD A;  3OTZ A;  4HZC A;  4J09 A;  3OW5 A;  4K6R A;  1MR9 A;  1QRF A;  3D98 A;  4R36 A;  4E1K A;  2WLF A;  5L6V A;  3BSW A;  1XHD A;  1V67 A;  1YP4 A;  3NZ2 A;  5E3R A;  3ST8 A;  2ICY A;  4M28 A;  4IHH A;  3MQG A;  4EA7 A;  3R3I A;  1HM9 A;  1QRE A;  3R2W A;  4EAB A;  5AFU U;  3R3R A;  4EA9 A;  3SPT A;  3OTM A;  1G97 A;  2OI7 A;  5DEM A;  5L6S A;  3VBM A;  5U2K A;  4AAW A;  1KRV A;  1YP3 A;  3VBP A; 
#chains in the Genus database with same CATH topology
 2OEG A;  1T3D A;  2W0V A;  3IGJ A;  1FXJ A;  2NPO A;  4HZD A;  4MZU A;  3TV0 A;  3OU9 A;  3R5C A;  3OH3 A;  2V0J A;  3PMO A;  3FOQ A;  4AC3 A;  4DCL A;  3GUE A;  1QRL A;  2WLD A;  5DG3 A;  2QIV X;  3GQ7 A;  4IHG A;  2V0K A;  3MQH A;  3BSS A;  1YP2 A;  1KK5 A;  4E79 A;  4HUS A;  2JF2 A;  2QKX A;  1QRM A;  3FS8 A;  3KWC A;  2WLC A;  3OH4 A;  4HUR A;  3C8V A;  3DJ4 A;  4R7P A;  1S80 A;  4M2B A;  3D8V A;  3TIO A;  4EA8 A;  4N27 A;  1KRU A;  1QQ0 A;  2WLE A;  1OCX A;  1SSQ A;  3EEV A;  4E75 A;  3VBL A;  2OI6 A;  2VHE A;  5DEP A;  2IU9 A;  5F42 A;  1KK4 A;  2QIA A;  3FSB A;  4EGG A;  1G95 A;  3OUP A;  1SSM A;  3R0S A;  3SRT A;  2TDT A;  3IXC A;  4M99 A;  3I3A A;  4J18 A;  2W0W A;  4R37 A;  4ISX A;  2JF3 A;  3JQY A;  5AFU V;  2GGQ A;  2OI5 A;  3CJ8 A;  4N6A A;  1HM8 A;  4E6U A;  3R5B A;  4KQL A;  3BXY A;  3GQA A;  3VBN A;  4FCE A;  3FSY A;  1N4I A;  2RIJ A;  3FWW A;  3Q1X A;  4MFG A;  3SUC A;  3VBK A;  5ADX U;  2GGO A;  4KNR A;  3GOS A;  2V0I A;  2OEF A;  1V3W A;  3I3X A;  3VBI A;  3TIS A;  1HM0 A;  2IC7 A;  1KQA A;  2XAT A;  3P47 A;  4H7O A;  1KGQ A;  4G3P A;  4M9C A;  3KWE A;  4MYO A;  4AA7 A;  3FSC A;  2V0L A;  3BRK X;  2VD4 A;  3OGZ A;  3MC4 A;  2Q4J A;  3EG4 A;  5E3Q A;  3GVD A;  3OH0 A;  3KWD A;  4KNX A;  5ADX V;  1HV9 A;  1XAT A;  3V4E A;  1QRG A;  3R5A A;  1MRL A;  2AQ9 A;  3TDT A;  3R1W A;  4N6B A;  3FTT A;  4G3S A;  1FWY A;  1MR7 A;  3OH1 A;  3R8Y A;  3DHO A;  3HJJ A;  1J2Z A;  3R5D A;  1L0S A;  1LXA A;  3VNP A;  1KRR A;  4M98 A;  4EAA A;  3FSX A;  5E3P A;  2ICX A;  2P2O A;  1TDT A;  1THJ A;  4G3Q A;  3ECT A;  3DK5 A;  3P1B A;  4IHF A;  2FKO A;  1SST A;  4KPZ A;  4E6T A;  4N69 A;  2I5K A;  4EQY A;  3HSQ A;  2IU8 A;  3T57 A;  3BSY A;  3F1X A;  3TK8 A;  3VBJ A;  1Z90 A;  1KK6 A;  1Z2F A;  2WLG A;  3GQ8 A;  4HCQ A;  1EWW A;  4KPX A;  4M2A A;  1KHR A;  1KGT A;  4G87 A;  2V0H A;  2IUA A;  3BFP A;  3EH0 A;  3TWD A;  3OTZ A;  4HZC A;  4J09 A;  3OW5 A;  4K6R A;  3GQ9 A;  1MR9 A;  1QRF A;  3D98 A;  4R36 A;  4E1K A;  2WLF A;  5L6V A;  3BSW A;  1XHD A;  1V67 A;  1YP4 A;  3NZ2 A;  5E3R A;  3ST8 A;  2ICY A;  4M28 A;  4IHH A;  3MQG A;  4EA7 A;  3R3I A;  1HM9 A;  1QRE A;  3R2W A;  4EAB A;  5AFU U;  3R3R A;  4EA9 A;  3SPT A;  3OTM A;  1G97 A;  2OI7 A;  5DEM A;  3OH2 A;  5L6S A;  3VBM A;  1M8N A;  5U2K A;  4AAW A;  1KRV A;  1YP3 A;  3VBP A; 
#chains in the Genus database with same CATH homology
 2OEG A;  1T3D A;  2W0V A;  3IGJ A;  1FXJ A;  2NPO A;  4HZD A;  4MZU A;  3TV0 A;  3OU9 A;  3R5C A;  2V0J A;  3PMO A;  3FOQ A;  4AC3 A;  4DCL A;  3GUE A;  1QRL A;  2WLD A;  5DG3 A;  2QIV X;  4IHG A;  2V0K A;  3MQH A;  3BSS A;  1YP2 A;  1KK5 A;  4E79 A;  4HUS A;  2JF2 A;  2QKX A;  1QRM A;  3FS8 A;  3KWC A;  2WLC A;  4HUR A;  3C8V A;  3DJ4 A;  4R7P A;  1S80 A;  4M2B A;  3D8V A;  3TIO A;  4EA8 A;  4N27 A;  1KRU A;  1QQ0 A;  2WLE A;  1OCX A;  1SSQ A;  3EEV A;  4E75 A;  3VBL A;  2OI6 A;  2VHE A;  5DEP A;  2IU9 A;  5F42 A;  1KK4 A;  2QIA A;  3FSB A;  4EGG A;  1G95 A;  3OUP A;  1SSM A;  3R0S A;  3SRT A;  2TDT A;  3IXC A;  4M99 A;  3I3A A;  4J18 A;  2W0W A;  4R37 A;  4ISX A;  2JF3 A;  3JQY A;  5AFU V;  2GGQ A;  2OI5 A;  3CJ8 A;  4N6A A;  1HM8 A;  4E6U A;  3R5B A;  4KQL A;  3BXY A;  3VBN A;  4FCE A;  3FSY A;  2RIJ A;  3Q1X A;  3FWW A;  4MFG A;  3VBK A;  5ADX U;  2GGO A;  4KNR A;  3GOS A;  2V0I A;  2OEF A;  1V3W A;  3I3X A;  3VBI A;  3TIS A;  1HM0 A;  2IC7 A;  1KQA A;  2XAT A;  3P47 A;  4H7O A;  1KGQ A;  4G3P A;  4M9C A;  3KWE A;  4MYO A;  4AA7 A;  3FSC A;  2V0L A;  3BRK X;  2VD4 A;  3MC4 A;  2Q4J A;  3EG4 A;  5E3Q A;  3GVD A;  4KNX A;  3KWD A;  5ADX V;  1HV9 A;  1XAT A;  3V4E A;  1QRG A;  3R5A A;  1MRL A;  2AQ9 A;  3TDT A;  3R1W A;  4N6B A;  3FTT A;  4G3S A;  1FWY A;  1MR7 A;  3R8Y A;  3DHO A;  3HJJ A;  1J2Z A;  3R5D A;  1LXA A;  3VNP A;  1KRR A;  4M98 A;  4EAA A;  3FSX A;  5E3P A;  2ICX A;  2P2O A;  1TDT A;  1THJ A;  4G3Q A;  3ECT A;  3DK5 A;  3P1B A;  4IHF A;  2FKO A;  1SST A;  4KPZ A;  4E6T A;  4N69 A;  2I5K A;  4EQY A;  3HSQ A;  2IU8 A;  3T57 A;  3BSY A;  3F1X A;  3TK8 A;  3VBJ A;  1Z90 A;  1KK6 A;  2WLG A;  4HCQ A;  4KPX A;  4M2A A;  1KHR A;  1KGT A;  4G87 A;  2V0H A;  2IUA A;  3BFP A;  3EH0 A;  3TWD A;  3OTZ A;  4HZC A;  4J09 A;  3OW5 A;  4K6R A;  1MR9 A;  1QRF A;  3D98 A;  4R36 A;  4E1K A;  2WLF A;  5L6V A;  3BSW A;  1XHD A;  1V67 A;  1YP4 A;  3NZ2 A;  5E3R A;  3ST8 A;  2ICY A;  4M28 A;  4IHH A;  3MQG A;  4EA7 A;  3R3I A;  1HM9 A;  1QRE A;  3R2W A;  4EAB A;  5AFU U;  3R3R A;  4EA9 A;  3SPT A;  3OTM A;  1G97 A;  2OI7 A;  5DEM A;  5L6S A;  3VBM A;  5U2K A;  4AAW A;  1KRV A;  1YP3 A;  3VBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...