1QRLA

A closer look at the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MQEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 76
structure length 214
sequence length 214
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrlA00
3BSWA 1QREA 3NZ2A 3T57A 3BFPA 3GVDA 3FSYA 1YP2A 3FWWA 3MC4A 4E75A 2WLGA 3CJ8A 1SSMA 4N27A 4J09A 5U2KA 3TV0A 3FSXA 2XATA 3FOQA 3TDTA 4EQYA 2ICXA 3OUPA 5E3PA 1KGQA 1QRMA 2ICYA 1Z90A 1HM9A 3ECTA 4KNXA 1KHRA 4E6TA 2OEFA 1SSTA 1FXJA 1YP3A 3OTMA 5E3QA 2V0HA 3JQYA 4EA9A 2TDTA 4EA7A 2QIVX 4EGGA 4M2BA 4DCLA 1QQ0A 4G87A 1SSQA 4AA7A 3TK8A 4E79A 1TDTA 2Q4JA 3HSQA 3R2WA 3TISA 2W0VA 4N6BA 4R36A 4ISXA 1HM8A 3R5AA 1FWYA 4AC3A 3R0SA 1HM0A 1OCXA 1KRUA 2GGQA 3GOSA 2RIJA 3OTZA 4H7OA 2IUAA 4IHGA 3KWDA 3HJJA 3SRTA 4M98A 1QRFA 5E3RA 1G97A 2JF3A 4R37A 1HV9A 2IU9A 5L6SA 3TWDA 1YP4A 1S80A 4KQLA 2V0IA 4G3QA 1V67A 1THJA 2OI6A 3R5BA 3DJ4A 3KWEA 2GGOA 3D8VA 4R7PA 2VD4A 1KK5A 5DG3A 4EA8A 3IGJA 3BSSA 2FKOA 2NPOA 3ST8A 3PMOA 3OU9A 3R5CA 4KNRA 4M28A 3IXCA 3VBLA 4M99A 4M9CA 4HCQA 5DEPA 3MQHA 3R5DA 4MYOA 3R3RA 3VBMA 1XATA 3TIOA 2WLCA 3BRKX 4J18A 3FSBA 1MR7A 5F42A 3VBNA 1XHDA 2VHEA 5DEMA 3VNPA 1MR9A 3I3XA 4G3SA 3BXYA 3R8YA 1KRVA 3KWCA 4KPZA 1QRLA 3EG4A 3VBPA 4E6UA 4EABA 4EAAA 4AAWA 1KGTA 5AFUV 2P2OA 2JF2A 3VBKA 1J2ZA 1KQAA 2OEGA 3C8VA 2V0KA 3VBIA 3P1BA 3V4EA 4K6RA 3FTTA 4G3PA 2OI7A 3SPTA 4HZDA 1T3DA 4HZCA 3BSYA 1KK4A 3MQGA 5ADXU 3D98A 2W0WA 1MRLA 4HUSA 2OI5A 4KPXA 4HURA 3F1XA 2QKXA 2I5KA 1G95A 2AQ9A 2V0JA 4MZUA 3EH0A 3Q1XA 4MFGA 1V3WA 3R1WA 4N6AA 1LXAA 2V0LA 2WLDA 3OW5A 5AFUU 4IHHA 2IU8A 3GUEA 5ADXV 3FSCA 3R3IA 1KK6A 1QRGA 4FCEA 3VBJA 3FS8A 4E1KA 5L6VA 2QIAA 3EEVA 4IHFA 3DHOA 3I3AA 3P47A 4M2AA 3DK5A 1KRRA 4N69A 2WLFA 2WLEA 2IC7A
chains in the Genus database with same CATH superfamily
3BSWA 1QREA 3NZ2A 3T57A 3BFPA 3GVDA 3GQ7A 3FSYA 1YP2A 3FWWA 3MC4A 4E75A 2WLGA 3CJ8A 1SSMA 1EWWA 4N27A 4J09A 5U2KA 3TV0A 3FSXA 2XATA 3FOQA 3TDTA 4EQYA 2ICXA 3OUPA 5E3PA 1KGQA 1QRMA 2ICYA 1Z90A 1HM9A 3ECTA 4KNXA 1KHRA 4E6TA 2OEFA 1SSTA 1FXJA 1YP3A 1Z2FA 3OTMA 5E3QA 2V0HA 3JQYA 3SUCA 4EA9A 2TDTA 4EA7A 2QIVX 4EGGA 4M2BA 4DCLA 1QQ0A 4G87A 3OH2A 1SSQA 1M8NA 4AA7A 3TK8A 4E79A 1TDTA 2Q4JA 3HSQA 3R2WA 3TISA 2W0VA 4N6BA 4R36A 4ISXA 1HM8A 3OH4A 3R5AA 1FWYA 3GQAA 4AC3A 3R0SA 1HM0A 1OCXA 1KRUA 2GGQA 3GOSA 2RIJA 3OTZA 4H7OA 2IUAA 4IHGA 3KWDA 3HJJA 3SRTA 4M98A 1QRFA 5E3RA 1G97A 2JF3A 4R37A 1HV9A 2IU9A 5L6SA 3TWDA 1YP4A 1S80A 4KQLA 2V0IA 3OH0A 4G3QA 1V67A 1THJA 2OI6A 3R5BA 3DJ4A 3KWEA 2GGOA 3D8VA 4R7PA 2VD4A 1KK5A 5DG3A 4EA8A 3IGJA 3BSSA 2FKOA 2NPOA 3ST8A 3PMOA 3OU9A 3R5CA 4KNRA 4M28A 3IXCA 3VBLA 4M99A 4M9CA 4HCQA 5DEPA 3MQHA 3R5DA 4MYOA 3R3RA 3VBMA 1XATA 3TIOA 2WLCA 3GQ8A 3BRKX 4J18A 3FSBA 1MR7A 5F42A 3VBNA 1XHDA 2VHEA 5DEMA 3VNPA 1MR9A 3I3XA 4G3SA 1N4IA 3BXYA 3R8YA 1KRVA 3KWCA 4KPZA 1QRLA 3EG4A 3OGZA 3VBPA 4E6UA 4EABA 4AAWA 1KGTA 4EAAA 1L0SA 5AFUV 2P2OA 2JF2A 3VBKA 1J2ZA 1KQAA 2OEGA 3C8VA 2V0KA 3VBIA 3P1BA 3V4EA 4K6RA 3FTTA 4G3PA 2OI7A 3SPTA 4HZDA 1T3DA 4HZCA 3BSYA 1KK4A 3MQGA 5ADXU 3D98A 2W0WA 1MRLA 4HUSA 2OI5A 4KPXA 4HURA 3F1XA 2QKXA 2I5KA 1G95A 2AQ9A 2V0JA 4MZUA 3EH0A 3Q1XA 4MFGA 1V3WA 3OH3A 3R1WA 1LXAA 2V0LA 2WLDA 3OW5A 4N6AA 5AFUU 4IHHA 2IU8A 3GUEA 3OH1A 5ADXV 3FSCA 3R3IA 1KK6A 1QRGA 4FCEA 3VBJA 3FS8A 4E1KA 5L6VA 2QIAA 3EEVA 4IHFA 3DHOA 3I3AA 3P47A 4M2AA 3DK5A 1KRRA 4N69A 3GQ9A 2WLFA 2WLEA 2IC7A
chains in the Genus database with same CATH topology
3BSWA 1QREA 3NZ2A 3T57A 3BFPA 3GVDA 3FSYA 1YP2A 3FWWA 3MC4A 4E75A 2WLGA 3CJ8A 1SSMA 4N27A 4J09A 5U2KA 3TV0A 3FSXA 2XATA 3FOQA 3TDTA 4EQYA 2ICXA 3OUPA 5E3PA 1KGQA 1QRMA 2ICYA 1Z90A 1HM9A 3ECTA 4KNXA 1KHRA 4E6TA 2OEFA 1SSTA 1FXJA 1YP3A 3OTMA 5E3QA 2V0HA 3JQYA 4EA9A 2TDTA 4EA7A 2QIVX 4EGGA 4M2BA 4DCLA 1QQ0A 4G87A 1SSQA 4AA7A 3TK8A 4E79A 1TDTA 2Q4JA 3HSQA 3R2WA 3TISA 2W0VA 4N6BA 4R36A 4ISXA 1HM8A 3R5AA 1FWYA 4AC3A 3R0SA 1HM0A 1OCXA 1KRUA 2GGQA 3GOSA 2RIJA 3OTZA 4H7OA 2IUAA 4IHGA 3KWDA 3HJJA 3SRTA 4M98A 1QRFA 5E3RA 1G97A 2JF3A 4R37A 1HV9A 2IU9A 5L6SA 3TWDA 1YP4A 1S80A 4KQLA 2V0IA 4G3QA 1V67A 1THJA 2OI6A 3R5BA 3DJ4A 3KWEA 2GGOA 3D8VA 4R7PA 2VD4A 1KK5A 5DG3A 4EA8A 3IGJA 3BSSA 2FKOA 2NPOA 3ST8A 3PMOA 3OU9A 3R5CA 4KNRA 4M28A 3IXCA 3VBLA 4M99A 4M9CA 4HCQA 5DEPA 3MQHA 3R5DA 4MYOA 3R3RA 3VBMA 1XATA 3TIOA 2WLCA 3BRKX 4J18A 3FSBA 1MR7A 5F42A 3VBNA 1XHDA 2VHEA 5DEMA 3VNPA 1MR9A 3I3XA 4G3SA 3BXYA 3R8YA 1KRVA 3KWCA 4KPZA 1QRLA 3EG4A 3VBPA 4E6UA 4EABA 4EAAA 4AAWA 1KGTA 5AFUV 2P2OA 2JF2A 3VBKA 1J2ZA 1KQAA 2OEGA 3C8VA 2V0KA 3VBIA 3P1BA 3V4EA 4K6RA 3FTTA 4G3PA 2OI7A 3SPTA 4HZDA 1T3DA 4HZCA 3BSYA 1KK4A 3MQGA 5ADXU 3D98A 2W0WA 1MRLA 4HUSA 2OI5A 4KPXA 4HURA 3F1XA 2QKXA 2I5KA 1G95A 2AQ9A 2V0JA 4MZUA 3EH0A 3Q1XA 4MFGA 1V3WA 3R1WA 4N6AA 1LXAA 2V0LA 2WLDA 3OW5A 5AFUU 4IHHA 2IU8A 3GUEA 5ADXV 3FSCA 3R3IA 1KK6A 1QRGA 4FCEA 3VBJA 3FS8A 4E1KA 5L6VA 2QIAA 3EEVA 4IHFA 3DHOA 3I3AA 3P47A 4M2AA 3DK5A 1KRRA 4N69A 2WLFA 2WLEA 2IC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BSW A;  1QRE A;  3NZ2 A;  3T57 A;  3BFP A;  3GVD A;  3FSY A;  1YP2 A;  3FWW A;  3MC4 A;  4E75 A;  2WLG A;  3CJ8 A;  1SSM A;  4N27 A;  4J09 A;  5U2K A;  3TV0 A;  3FSX A;  2XAT A;  3FOQ A;  3TDT A;  4EQY A;  2ICX A;  3OUP A;  5E3P A;  1KGQ A;  1QRM A;  2ICY A;  1Z90 A;  1HM9 A;  3ECT A;  4KNX A;  1KHR A;  4E6T A;  2OEF A;  1SST A;  1FXJ A;  1YP3 A;  3OTM A;  5E3Q A;  2V0H A;  3JQY A;  4EA9 A;  2TDT A;  4EA7 A;  2QIV X;  4EGG A;  4M2B A;  4DCL A;  1QQ0 A;  4G87 A;  1SSQ A;  4AA7 A;  3TK8 A;  4E79 A;  1TDT A;  2Q4J A;  3HSQ A;  3R2W A;  3TIS A;  2W0V A;  4N6B A;  4R36 A;  4ISX A;  1HM8 A;  3R5A A;  1FWY A;  4AC3 A;  3R0S A;  1HM0 A;  1OCX A;  1KRU A;  2GGQ A;  3GOS A;  2RIJ A;  3OTZ A;  4H7O A;  2IUA A;  4IHG A;  3KWD A;  3HJJ A;  3SRT A;  4M98 A;  1QRF A;  5E3R A;  1G97 A;  2JF3 A;  4R37 A;  1HV9 A;  2IU9 A;  5L6S A;  3TWD A;  1YP4 A;  1S80 A;  4KQL A;  2V0I A;  4G3Q A;  1V67 A;  1THJ A;  2OI6 A;  3R5B A;  3DJ4 A;  3KWE A;  2GGO A;  3D8V A;  4R7P A;  2VD4 A;  1KK5 A;  5DG3 A;  4EA8 A;  3IGJ A;  3BSS A;  2FKO A;  2NPO A;  3ST8 A;  3PMO A;  3OU9 A;  3R5C A;  4KNR A;  4M28 A;  3IXC A;  3VBL A;  4M99 A;  4M9C A;  4HCQ A;  5DEP A;  3MQH A;  3R5D A;  4MYO A;  3R3R A;  3VBM A;  1XAT A;  3TIO A;  2WLC A;  3BRK X;  4J18 A;  3FSB A;  1MR7 A;  5F42 A;  3VBN A;  1XHD A;  2VHE A;  5DEM A;  3VNP A;  1MR9 A;  3I3X A;  4G3S A;  3BXY A;  3R8Y A;  1KRV A;  3KWC A;  4KPZ A;  1QRL A;  3EG4 A;  3VBP A;  4E6U A;  4EAB A;  4EAA A;  4AAW A;  1KGT A;  5AFU V;  2P2O A;  2JF2 A;  3VBK A;  1J2Z A;  1KQA A;  2OEG A;  3C8V A;  2V0K A;  3VBI A;  3P1B A;  3V4E A;  4K6R A;  3FTT A;  4G3P A;  2OI7 A;  3SPT A;  4HZD A;  1T3D A;  4HZC A;  3BSY A;  1KK4 A;  3MQG A;  5ADX U;  3D98 A;  2W0W A;  1MRL A;  4HUS A;  2OI5 A;  4KPX A;  4HUR A;  3F1X A;  2QKX A;  2I5K A;  1G95 A;  2AQ9 A;  2V0J A;  4MZU A;  3EH0 A;  3Q1X A;  4MFG A;  1V3W A;  3R1W A;  4N6A A;  1LXA A;  2V0L A;  2WLD A;  3OW5 A;  5AFU U;  4IHH A;  2IU8 A;  3GUE A;  5ADX V;  3FSC A;  3R3I A;  1KK6 A;  1QRG A;  4FCE A;  3VBJ A;  3FS8 A;  4E1K A;  5L6V A;  2QIA A;  3EEV A;  4IHF A;  3DHO A;  3I3A A;  3P47 A;  4M2A A;  3DK5 A;  1KRR A;  4N69 A;  2WLF A;  2WLE A;  2IC7 A; 
#chains in the Genus database with same CATH topology
 3BSW A;  1QRE A;  3NZ2 A;  3T57 A;  3BFP A;  3GVD A;  3GQ7 A;  3FSY A;  1YP2 A;  3FWW A;  3MC4 A;  4E75 A;  2WLG A;  3CJ8 A;  1SSM A;  1EWW A;  4N27 A;  4J09 A;  5U2K A;  3TV0 A;  3FSX A;  2XAT A;  3FOQ A;  3TDT A;  4EQY A;  2ICX A;  3OUP A;  5E3P A;  1KGQ A;  1QRM A;  2ICY A;  1Z90 A;  1HM9 A;  3ECT A;  4KNX A;  1KHR A;  4E6T A;  2OEF A;  1SST A;  1FXJ A;  1YP3 A;  1Z2F A;  3OTM A;  5E3Q A;  2V0H A;  3JQY A;  3SUC A;  4EA9 A;  2TDT A;  4EA7 A;  2QIV X;  4EGG A;  4M2B A;  4DCL A;  1QQ0 A;  4G87 A;  3OH2 A;  1SSQ A;  1M8N A;  4AA7 A;  3TK8 A;  4E79 A;  1TDT A;  2Q4J A;  3HSQ A;  3R2W A;  3TIS A;  2W0V A;  4N6B A;  4R36 A;  4ISX A;  1HM8 A;  3OH4 A;  3R5A A;  1FWY A;  3GQA A;  4AC3 A;  3R0S A;  1HM0 A;  1OCX A;  1KRU A;  2GGQ A;  3GOS A;  2RIJ A;  3OTZ A;  4H7O A;  2IUA A;  4IHG A;  3KWD A;  3HJJ A;  3SRT A;  4M98 A;  1QRF A;  5E3R A;  1G97 A;  2JF3 A;  4R37 A;  1HV9 A;  2IU9 A;  5L6S A;  3TWD A;  1YP4 A;  1S80 A;  4KQL A;  2V0I A;  3OH0 A;  4G3Q A;  1V67 A;  1THJ A;  2OI6 A;  3R5B A;  3DJ4 A;  3KWE A;  2GGO A;  3D8V A;  4R7P A;  2VD4 A;  1KK5 A;  5DG3 A;  4EA8 A;  3IGJ A;  3BSS A;  2FKO A;  2NPO A;  3ST8 A;  3PMO A;  3OU9 A;  3R5C A;  4KNR A;  4M28 A;  3IXC A;  3VBL A;  4M99 A;  4M9C A;  4HCQ A;  5DEP A;  3MQH A;  3R5D A;  4MYO A;  3R3R A;  3VBM A;  1XAT A;  3TIO A;  2WLC A;  3GQ8 A;  3BRK X;  4J18 A;  3FSB A;  1MR7 A;  5F42 A;  3VBN A;  1XHD A;  2VHE A;  5DEM A;  3VNP A;  1MR9 A;  3I3X A;  4G3S A;  1N4I A;  3BXY A;  3R8Y A;  1KRV A;  3KWC A;  4KPZ A;  1QRL A;  3EG4 A;  3OGZ A;  3VBP A;  4E6U A;  4EAB A;  4AAW A;  1KGT A;  4EAA A;  1L0S A;  5AFU V;  2P2O A;  2JF2 A;  3VBK A;  1J2Z A;  1KQA A;  2OEG A;  3C8V A;  2V0K A;  3VBI A;  3P1B A;  3V4E A;  4K6R A;  3FTT A;  4G3P A;  2OI7 A;  3SPT A;  4HZD A;  1T3D A;  4HZC A;  3BSY A;  1KK4 A;  3MQG A;  5ADX U;  3D98 A;  2W0W A;  1MRL A;  4HUS A;  2OI5 A;  4KPX A;  4HUR A;  3F1X A;  2QKX A;  2I5K A;  1G95 A;  2AQ9 A;  2V0J A;  4MZU A;  3EH0 A;  3Q1X A;  4MFG A;  1V3W A;  3OH3 A;  3R1W A;  1LXA A;  2V0L A;  2WLD A;  3OW5 A;  4N6A A;  5AFU U;  4IHH A;  2IU8 A;  3GUE A;  3OH1 A;  5ADX V;  3FSC A;  3R3I A;  1KK6 A;  1QRG A;  4FCE A;  3VBJ A;  3FS8 A;  4E1K A;  5L6V A;  2QIA A;  3EEV A;  4IHF A;  3DHO A;  3I3A A;  3P47 A;  4M2A A;  3DK5 A;  1KRR A;  4N69 A;  3GQ9 A;  2WLF A;  2WLE A;  2IC7 A; 
#chains in the Genus database with same CATH homology
 3BSW A;  1QRE A;  3NZ2 A;  3T57 A;  3BFP A;  3GVD A;  3FSY A;  1YP2 A;  3FWW A;  3MC4 A;  4E75 A;  2WLG A;  3CJ8 A;  1SSM A;  4N27 A;  4J09 A;  5U2K A;  3TV0 A;  3FSX A;  2XAT A;  3FOQ A;  3TDT A;  4EQY A;  2ICX A;  3OUP A;  5E3P A;  1KGQ A;  1QRM A;  2ICY A;  1Z90 A;  1HM9 A;  3ECT A;  4KNX A;  1KHR A;  4E6T A;  2OEF A;  1SST A;  1FXJ A;  1YP3 A;  3OTM A;  5E3Q A;  2V0H A;  3JQY A;  4EA9 A;  2TDT A;  4EA7 A;  2QIV X;  4EGG A;  4M2B A;  4DCL A;  1QQ0 A;  4G87 A;  1SSQ A;  4AA7 A;  3TK8 A;  4E79 A;  1TDT A;  2Q4J A;  3HSQ A;  3R2W A;  3TIS A;  2W0V A;  4N6B A;  4R36 A;  4ISX A;  1HM8 A;  3R5A A;  1FWY A;  4AC3 A;  3R0S A;  1HM0 A;  1OCX A;  1KRU A;  2GGQ A;  3GOS A;  2RIJ A;  3OTZ A;  4H7O A;  2IUA A;  4IHG A;  3KWD A;  3HJJ A;  3SRT A;  4M98 A;  1QRF A;  5E3R A;  1G97 A;  2JF3 A;  4R37 A;  1HV9 A;  2IU9 A;  5L6S A;  3TWD A;  1YP4 A;  1S80 A;  4KQL A;  2V0I A;  4G3Q A;  1V67 A;  1THJ A;  2OI6 A;  3R5B A;  3DJ4 A;  3KWE A;  2GGO A;  3D8V A;  4R7P A;  2VD4 A;  1KK5 A;  5DG3 A;  4EA8 A;  3IGJ A;  3BSS A;  2FKO A;  2NPO A;  3ST8 A;  3PMO A;  3OU9 A;  3R5C A;  4KNR A;  4M28 A;  3IXC A;  3VBL A;  4M99 A;  4M9C A;  4HCQ A;  5DEP A;  3MQH A;  3R5D A;  4MYO A;  3R3R A;  3VBM A;  1XAT A;  3TIO A;  2WLC A;  3BRK X;  4J18 A;  3FSB A;  1MR7 A;  5F42 A;  3VBN A;  1XHD A;  2VHE A;  5DEM A;  3VNP A;  1MR9 A;  3I3X A;  4G3S A;  3BXY A;  3R8Y A;  1KRV A;  3KWC A;  4KPZ A;  1QRL A;  3EG4 A;  3VBP A;  4E6U A;  4EAB A;  4EAA A;  4AAW A;  1KGT A;  5AFU V;  2P2O A;  2JF2 A;  3VBK A;  1J2Z A;  1KQA A;  2OEG A;  3C8V A;  2V0K A;  3VBI A;  3P1B A;  3V4E A;  4K6R A;  3FTT A;  4G3P A;  2OI7 A;  3SPT A;  4HZD A;  1T3D A;  4HZC A;  3BSY A;  1KK4 A;  3MQG A;  5ADX U;  3D98 A;  2W0W A;  1MRL A;  4HUS A;  2OI5 A;  4KPX A;  4HUR A;  3F1X A;  2QKX A;  2I5K A;  1G95 A;  2AQ9 A;  2V0J A;  4MZU A;  3EH0 A;  3Q1X A;  4MFG A;  1V3W A;  3R1W A;  4N6A A;  1LXA A;  2V0L A;  2WLD A;  3OW5 A;  5AFU U;  4IHH A;  2IU8 A;  3GUE A;  5ADX V;  3FSC A;  3R3I A;  1KK6 A;  1QRG A;  4FCE A;  3VBJ A;  3FS8 A;  4E1K A;  5L6V A;  2QIA A;  3EEV A;  4IHF A;  3DHO A;  3I3A A;  3P47 A;  4M2A A;  3DK5 A;  1KRR A;  4N69 A;  2WLF A;  2WLE A;  2IC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...