1XATA

Structure of the hexapeptide xenobiotic acetyltransferase from pseudomonas aeruginosa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
208
structure length
208
Chain Sequence
NYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPAFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQHWKQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetyltransferase
molecule keywords XENOBIOTIC ACETYLTRANSFERASE
publication title Structure of the hexapeptide xenobiotic acetyltransferase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 64
structure length 208
sequence length 208
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1998-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1xatA00
3P47A 3VBJA 4EA9A 2FKOA 3I3AA 2WLEA 4FCEA 4G87A 4HCQA 4M98A 3VNPA 3KWDA 3IXCA 5F42A 2Q4JA 3CJ8A 1MR9A 2WLFA 1T3DA 3Q1XA 3EEVA 4M2BA 1QRGA 3TIOA 3JQYA 2W0VA 3FTTA 1KQAA 3PMOA 2WLDA 1MR7A 1QRFA 1LXAA 4ISXA 4N6AA 5E3PA 3SRTA 4E6UA 1HM8A 3R1WA 3BFPA 4HZCA 1SSQA 4E6TA 3R8YA 4HUSA 5DEPA 2W0WA 3BXYA 2IC7A 4KNXA 3VBIA 4AAWA 1HV9A 4J09A 4EAAA 3OUPA 1QREA 5AFUU 1YP4A 2OEGA 4EQYA 1TDTA 4IHHA 3ST8A 3TV0A 4HURA 3TWDA 3KWEA 1S80A 4HZDA 3TDTA 2IU8A 1QQ0A 1G95A 3BRKX 3BSYA 4KPXA 4IHGA 1HM0A 4MYOA 3V4EA 3VBMA 3VBLA 1KK4A 4R7PA 4K6RA 3EH0A 2WLGA 1QRMA 3P1BA 1J2ZA 4H7OA 2GGQA 4N69A 5U2KA 3R5DA 4E79A 1KRUA 3I3XA 3R0SA 5AFUV 2JF2A 4E1KA 4R37A 2V0JA 3FSXA 3TK8A 3GUEA 2IUAA 3DHOA 2ICYA 4MZUA 3GOSA 4DCLA 2WLCA 3DK5A 3EG4A 1KK6A 3FSBA 3R5AA 1MRLA 4EA7A 1FWYA 1THJA 2RIJA 5ADXU 2XATA 3GVDA 4E75A 2IU9A 2VHEA 1KRRA 2OEFA 3FSCA 5E3RA 4KQLA 3VBPA 4KPZA 3FS8A 2VD4A 2GGOA 1G97A 4IHFA 1OCXA 2QIVX 3OU9A 3OTZA 1SSMA 3VBNA 5ADXV 1HM9A 2QKXA 2P2OA 4M28A 3C8VA 2OI6A 1KRVA 4M9CA 3R5CA 3D98A 3IGJA 3OTMA 1XATA 3FWWA 3OW5A 4G3SA 4M2AA 1Z90A 4N27A 4EGGA 2NPOA 2AQ9A 1KK5A 4MFGA 3VBKA 1KGTA 1V3WA 3MC4A 2TDTA 1XHDA 2I5KA 2V0KA 1YP3A 3BSWA 1YP2A 1KGQA 2OI7A 4G3PA 4M99A 4J18A 2OI5A 4AC3A 4R36A 1SSTA 3FSYA 4EABA 2V0HA 5DG3A 3HJJA 4N6BA 3F1XA 3HSQA 2ICXA 3MQHA 3SPTA 3TISA 5L6SA 3FOQA 3R2WA 3T57A 5DEMA 1QRLA 1FXJA 3R5BA 4G3QA 3MQGA 2QIAA 3NZ2A 2V0IA 3BSSA 3KWCA 4KNRA 3ECTA 4EA8A 3D8VA 1KHRA 2V0LA 5L6VA 4AA7A 3DJ4A 1V67A 2JF3A 5E3QA 3R3IA 3R3RA
chains in the Genus database with same CATH superfamily
3P47A 3VBJA 4EA9A 2FKOA 3I3AA 2WLEA 4FCEA 4G87A 4HCQA 4M98A 3VNPA 3KWDA 3IXCA 5F42A 2Q4JA 3OH2A 3CJ8A 1MR9A 2WLFA 1T3DA 3Q1XA 3EEVA 4M2BA 1QRGA 3TIOA 3JQYA 2W0VA 3FTTA 1KQAA 3PMOA 2WLDA 1MR7A 1QRFA 1LXAA 4ISXA 4N6AA 5E3PA 3SRTA 4E6UA 1HM8A 3R1WA 3BFPA 4HZCA 1SSQA 4E6TA 3GQ8A 3R8YA 4HUSA 5DEPA 2W0WA 3BXYA 2IC7A 3OH4A 4KNXA 3VBIA 4AAWA 1HV9A 4J09A 4EAAA 3OUPA 1QREA 5AFUU 1YP4A 2OEGA 4EQYA 1TDTA 4IHHA 3ST8A 3TV0A 4HURA 3TWDA 3KWEA 1EWWA 1S80A 4HZDA 3TDTA 2IU8A 1QQ0A 1G95A 3BRKX 3BSYA 4KPXA 4IHGA 1HM0A 4MYOA 3GQAA 3V4EA 3VBMA 1KK4A 4R7PA 3VBLA 3OH0A 4K6RA 3EH0A 2WLGA 1QRMA 3P1BA 1J2ZA 4H7OA 2GGQA 4N69A 5U2KA 3R5DA 4E79A 3GQ7A 1KRUA 3I3XA 3R0SA 5AFUV 2JF2A 4E1KA 1M8NA 4R37A 2V0JA 3FSXA 3TK8A 3GUEA 2IUAA 3DHOA 2ICYA 4MZUA 3GOSA 4DCLA 2WLCA 3DK5A 3EG4A 1KK6A 3FSBA 3R5AA 1MRLA 4EA7A 1FWYA 1THJA 2RIJA 5ADXU 2XATA 3GVDA 1Z2FA 3OH1A 4E75A 2IU9A 2VHEA 1KRRA 2OEFA 3FSCA 5E3RA 4KQLA 3VBPA 4KPZA 3FS8A 2VD4A 2GGOA 1G97A 4IHFA 1OCXA 2QIVX 3OU9A 3OTZA 1SSMA 3VBNA 5ADXV 1HM9A 2QKXA 2P2OA 4M28A 3C8VA 2OI6A 1KRVA 4M9CA 3R5CA 3OH3A 3D98A 3SUCA 3IGJA 3OTMA 1XATA 3FWWA 3OW5A 4G3SA 4M2AA 1Z90A 4N27A 4EGGA 2NPOA 2AQ9A 1KK5A 4MFGA 3VBKA 1KGTA 1V3WA 3MC4A 2TDTA 1XHDA 2I5KA 2V0KA 1YP3A 3BSWA 1YP2A 1KGQA 2OI7A 4G3PA 4M99A 4J18A 2OI5A 4AC3A 4R36A 1SSTA 3FSYA 4EABA 2V0HA 5DG3A 3HJJA 4N6BA 3F1XA 3HSQA 2ICXA 3MQHA 3SPTA 3TISA 5L6SA 3FOQA 3R2WA 3T57A 1L0SA 5DEMA 1QRLA 3OGZA 1FXJA 3R5BA 4G3QA 3MQGA 2QIAA 3NZ2A 2V0IA 3BSSA 3KWCA 4KNRA 3ECTA 4EA8A 3D8VA 1KHRA 2V0LA 5L6VA 4AA7A 3GQ9A 3DJ4A 1V67A 2JF3A 1N4IA 5E3QA 3R3IA 3R3RA
chains in the Genus database with same CATH topology
3P47A 3VBJA 4EA9A 2FKOA 3I3AA 2WLEA 4FCEA 4G87A 4HCQA 4M98A 3VNPA 3KWDA 3IXCA 5F42A 2Q4JA 3CJ8A 1MR9A 2WLFA 1T3DA 3Q1XA 3EEVA 4M2BA 1QRGA 3TIOA 3JQYA 2W0VA 3FTTA 1KQAA 3PMOA 2WLDA 1MR7A 1QRFA 1LXAA 4ISXA 4N6AA 5E3PA 3SRTA 4E6UA 1HM8A 3R1WA 3BFPA 4HZCA 1SSQA 4E6TA 3R8YA 4HUSA 5DEPA 2W0WA 3BXYA 2IC7A 4KNXA 3VBIA 4AAWA 1HV9A 4J09A 4EAAA 3OUPA 1QREA 5AFUU 1YP4A 2OEGA 4EQYA 1TDTA 4IHHA 3ST8A 3TV0A 4HURA 3TWDA 3KWEA 1S80A 4HZDA 3TDTA 2IU8A 1QQ0A 1G95A 3BRKX 3BSYA 4KPXA 4IHGA 1HM0A 4MYOA 3V4EA 3VBMA 3VBLA 1KK4A 4R7PA 4K6RA 3EH0A 2WLGA 1QRMA 3P1BA 1J2ZA 4H7OA 2GGQA 4N69A 5U2KA 3R5DA 4E79A 1KRUA 3I3XA 3R0SA 5AFUV 2JF2A 4E1KA 4R37A 2V0JA 3FSXA 3TK8A 3GUEA 2IUAA 3DHOA 2ICYA 4MZUA 3GOSA 4DCLA 2WLCA 3DK5A 3EG4A 1KK6A 3FSBA 3R5AA 1MRLA 4EA7A 1FWYA 1THJA 2RIJA 5ADXU 2XATA 3GVDA 4E75A 2IU9A 2VHEA 1KRRA 2OEFA 3FSCA 5E3RA 4KQLA 3VBPA 4KPZA 3FS8A 2VD4A 2GGOA 1G97A 4IHFA 1OCXA 2QIVX 3OU9A 3OTZA 1SSMA 3VBNA 5ADXV 1HM9A 2QKXA 2P2OA 4M28A 3C8VA 2OI6A 1KRVA 4M9CA 3R5CA 3D98A 3IGJA 3OTMA 1XATA 3FWWA 3OW5A 4G3SA 4M2AA 1Z90A 4N27A 4EGGA 2NPOA 2AQ9A 1KK5A 4MFGA 3VBKA 1KGTA 1V3WA 3MC4A 2TDTA 1XHDA 2I5KA 2V0KA 1YP3A 3BSWA 1YP2A 1KGQA 2OI7A 4G3PA 4M99A 4J18A 2OI5A 4AC3A 4R36A 1SSTA 3FSYA 4EABA 2V0HA 5DG3A 3HJJA 4N6BA 3F1XA 3HSQA 2ICXA 3MQHA 3SPTA 3TISA 5L6SA 3FOQA 3R2WA 3T57A 5DEMA 1QRLA 1FXJA 3R5BA 4G3QA 3MQGA 2QIAA 3NZ2A 2V0IA 3BSSA 3KWCA 4KNRA 3ECTA 4EA8A 3D8VA 1KHRA 2V0LA 5L6VA 4AA7A 3DJ4A 1V67A 2JF3A 5E3QA 3R3IA 3R3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P47 A;  3VBJ A;  4EA9 A;  2FKO A;  3I3A A;  2WLE A;  4FCE A;  4G87 A;  4HCQ A;  4M98 A;  3VNP A;  3KWD A;  3IXC A;  5F42 A;  2Q4J A;  3CJ8 A;  1MR9 A;  2WLF A;  1T3D A;  3Q1X A;  3EEV A;  4M2B A;  1QRG A;  3TIO A;  3JQY A;  2W0V A;  3FTT A;  1KQA A;  3PMO A;  2WLD A;  1MR7 A;  1QRF A;  1LXA A;  4ISX A;  4N6A A;  5E3P A;  3SRT A;  4E6U A;  1HM8 A;  3R1W A;  3BFP A;  4HZC A;  1SSQ A;  4E6T A;  3R8Y A;  4HUS A;  5DEP A;  2W0W A;  3BXY A;  2IC7 A;  4KNX A;  3VBI A;  4AAW A;  1HV9 A;  4J09 A;  4EAA A;  3OUP A;  1QRE A;  5AFU U;  1YP4 A;  2OEG A;  4EQY A;  1TDT A;  4IHH A;  3ST8 A;  3TV0 A;  4HUR A;  3TWD A;  3KWE A;  1S80 A;  4HZD A;  3TDT A;  2IU8 A;  1QQ0 A;  1G95 A;  3BRK X;  3BSY A;  4KPX A;  4IHG A;  1HM0 A;  4MYO A;  3V4E A;  3VBM A;  3VBL A;  1KK4 A;  4R7P A;  4K6R A;  3EH0 A;  2WLG A;  1QRM A;  3P1B A;  1J2Z A;  4H7O A;  2GGQ A;  4N69 A;  5U2K A;  3R5D A;  4E79 A;  1KRU A;  3I3X A;  3R0S A;  5AFU V;  2JF2 A;  4E1K A;  4R37 A;  2V0J A;  3FSX A;  3TK8 A;  3GUE A;  2IUA A;  3DHO A;  2ICY A;  4MZU A;  3GOS A;  4DCL A;  2WLC A;  3DK5 A;  3EG4 A;  1KK6 A;  3FSB A;  3R5A A;  1MRL A;  4EA7 A;  1FWY A;  1THJ A;  2RIJ A;  5ADX U;  2XAT A;  3GVD A;  4E75 A;  2IU9 A;  2VHE A;  1KRR A;  2OEF A;  3FSC A;  5E3R A;  4KQL A;  3VBP A;  4KPZ A;  3FS8 A;  2VD4 A;  2GGO A;  1G97 A;  4IHF A;  1OCX A;  2QIV X;  3OU9 A;  3OTZ A;  1SSM A;  3VBN A;  5ADX V;  1HM9 A;  2QKX A;  2P2O A;  4M28 A;  3C8V A;  2OI6 A;  1KRV A;  4M9C A;  3R5C A;  3D98 A;  3IGJ A;  3OTM A;  1XAT A;  3FWW A;  3OW5 A;  4G3S A;  4M2A A;  1Z90 A;  4N27 A;  4EGG A;  2NPO A;  2AQ9 A;  1KK5 A;  4MFG A;  3VBK A;  1KGT A;  1V3W A;  3MC4 A;  2TDT A;  1XHD A;  2I5K A;  2V0K A;  1YP3 A;  3BSW A;  1YP2 A;  1KGQ A;  2OI7 A;  4G3P A;  4M99 A;  4J18 A;  2OI5 A;  4AC3 A;  4R36 A;  1SST A;  3FSY A;  4EAB A;  2V0H A;  5DG3 A;  3HJJ A;  4N6B A;  3F1X A;  3HSQ A;  2ICX A;  3MQH A;  3SPT A;  3TIS A;  5L6S A;  3FOQ A;  3R2W A;  3T57 A;  5DEM A;  1QRL A;  1FXJ A;  3R5B A;  4G3Q A;  3MQG A;  2QIA A;  3NZ2 A;  2V0I A;  3BSS A;  3KWC A;  4KNR A;  3ECT A;  4EA8 A;  3D8V A;  1KHR A;  2V0L A;  5L6V A;  4AA7 A;  3DJ4 A;  1V67 A;  2JF3 A;  5E3Q A;  3R3I A;  3R3R A; 
#chains in the Genus database with same CATH topology
 3P47 A;  3VBJ A;  4EA9 A;  2FKO A;  3I3A A;  2WLE A;  4FCE A;  4G87 A;  4HCQ A;  4M98 A;  3VNP A;  3KWD A;  3IXC A;  5F42 A;  2Q4J A;  3OH2 A;  3CJ8 A;  1MR9 A;  2WLF A;  1T3D A;  3Q1X A;  3EEV A;  4M2B A;  1QRG A;  3TIO A;  3JQY A;  2W0V A;  3FTT A;  1KQA A;  3PMO A;  2WLD A;  1MR7 A;  1QRF A;  1LXA A;  4ISX A;  4N6A A;  5E3P A;  3SRT A;  4E6U A;  1HM8 A;  3R1W A;  3BFP A;  4HZC A;  1SSQ A;  4E6T A;  3GQ8 A;  3R8Y A;  4HUS A;  5DEP A;  2W0W A;  3BXY A;  2IC7 A;  3OH4 A;  4KNX A;  3VBI A;  4AAW A;  1HV9 A;  4J09 A;  4EAA A;  3OUP A;  1QRE A;  5AFU U;  1YP4 A;  2OEG A;  4EQY A;  1TDT A;  4IHH A;  3ST8 A;  3TV0 A;  4HUR A;  3TWD A;  3KWE A;  1EWW A;  1S80 A;  4HZD A;  3TDT A;  2IU8 A;  1QQ0 A;  1G95 A;  3BRK X;  3BSY A;  4KPX A;  4IHG A;  1HM0 A;  4MYO A;  3GQA A;  3V4E A;  3VBM A;  1KK4 A;  4R7P A;  3VBL A;  3OH0 A;  4K6R A;  3EH0 A;  2WLG A;  1QRM A;  3P1B A;  1J2Z A;  4H7O A;  2GGQ A;  4N69 A;  5U2K A;  3R5D A;  4E79 A;  3GQ7 A;  1KRU A;  3I3X A;  3R0S A;  5AFU V;  2JF2 A;  4E1K A;  1M8N A;  4R37 A;  2V0J A;  3FSX A;  3TK8 A;  3GUE A;  2IUA A;  3DHO A;  2ICY A;  4MZU A;  3GOS A;  4DCL A;  2WLC A;  3DK5 A;  3EG4 A;  1KK6 A;  3FSB A;  3R5A A;  1MRL A;  4EA7 A;  1FWY A;  1THJ A;  2RIJ A;  5ADX U;  2XAT A;  3GVD A;  1Z2F A;  3OH1 A;  4E75 A;  2IU9 A;  2VHE A;  1KRR A;  2OEF A;  3FSC A;  5E3R A;  4KQL A;  3VBP A;  4KPZ A;  3FS8 A;  2VD4 A;  2GGO A;  1G97 A;  4IHF A;  1OCX A;  2QIV X;  3OU9 A;  3OTZ A;  1SSM A;  3VBN A;  5ADX V;  1HM9 A;  2QKX A;  2P2O A;  4M28 A;  3C8V A;  2OI6 A;  1KRV A;  4M9C A;  3R5C A;  3OH3 A;  3D98 A;  3SUC A;  3IGJ A;  3OTM A;  1XAT A;  3FWW A;  3OW5 A;  4G3S A;  4M2A A;  1Z90 A;  4N27 A;  4EGG A;  2NPO A;  2AQ9 A;  1KK5 A;  4MFG A;  3VBK A;  1KGT A;  1V3W A;  3MC4 A;  2TDT A;  1XHD A;  2I5K A;  2V0K A;  1YP3 A;  3BSW A;  1YP2 A;  1KGQ A;  2OI7 A;  4G3P A;  4M99 A;  4J18 A;  2OI5 A;  4AC3 A;  4R36 A;  1SST A;  3FSY A;  4EAB A;  2V0H A;  5DG3 A;  3HJJ A;  4N6B A;  3F1X A;  3HSQ A;  2ICX A;  3MQH A;  3SPT A;  3TIS A;  5L6S A;  3FOQ A;  3R2W A;  3T57 A;  1L0S A;  5DEM A;  1QRL A;  3OGZ A;  1FXJ A;  3R5B A;  4G3Q A;  3MQG A;  2QIA A;  3NZ2 A;  2V0I A;  3BSS A;  3KWC A;  4KNR A;  3ECT A;  4EA8 A;  3D8V A;  1KHR A;  2V0L A;  5L6V A;  4AA7 A;  3GQ9 A;  3DJ4 A;  1V67 A;  2JF3 A;  1N4I A;  5E3Q A;  3R3I A;  3R3R A; 
#chains in the Genus database with same CATH homology
 3P47 A;  3VBJ A;  4EA9 A;  2FKO A;  3I3A A;  2WLE A;  4FCE A;  4G87 A;  4HCQ A;  4M98 A;  3VNP A;  3KWD A;  3IXC A;  5F42 A;  2Q4J A;  3CJ8 A;  1MR9 A;  2WLF A;  1T3D A;  3Q1X A;  3EEV A;  4M2B A;  1QRG A;  3TIO A;  3JQY A;  2W0V A;  3FTT A;  1KQA A;  3PMO A;  2WLD A;  1MR7 A;  1QRF A;  1LXA A;  4ISX A;  4N6A A;  5E3P A;  3SRT A;  4E6U A;  1HM8 A;  3R1W A;  3BFP A;  4HZC A;  1SSQ A;  4E6T A;  3R8Y A;  4HUS A;  5DEP A;  2W0W A;  3BXY A;  2IC7 A;  4KNX A;  3VBI A;  4AAW A;  1HV9 A;  4J09 A;  4EAA A;  3OUP A;  1QRE A;  5AFU U;  1YP4 A;  2OEG A;  4EQY A;  1TDT A;  4IHH A;  3ST8 A;  3TV0 A;  4HUR A;  3TWD A;  3KWE A;  1S80 A;  4HZD A;  3TDT A;  2IU8 A;  1QQ0 A;  1G95 A;  3BRK X;  3BSY A;  4KPX A;  4IHG A;  1HM0 A;  4MYO A;  3V4E A;  3VBM A;  3VBL A;  1KK4 A;  4R7P A;  4K6R A;  3EH0 A;  2WLG A;  1QRM A;  3P1B A;  1J2Z A;  4H7O A;  2GGQ A;  4N69 A;  5U2K A;  3R5D A;  4E79 A;  1KRU A;  3I3X A;  3R0S A;  5AFU V;  2JF2 A;  4E1K A;  4R37 A;  2V0J A;  3FSX A;  3TK8 A;  3GUE A;  2IUA A;  3DHO A;  2ICY A;  4MZU A;  3GOS A;  4DCL A;  2WLC A;  3DK5 A;  3EG4 A;  1KK6 A;  3FSB A;  3R5A A;  1MRL A;  4EA7 A;  1FWY A;  1THJ A;  2RIJ A;  5ADX U;  2XAT A;  3GVD A;  4E75 A;  2IU9 A;  2VHE A;  1KRR A;  2OEF A;  3FSC A;  5E3R A;  4KQL A;  3VBP A;  4KPZ A;  3FS8 A;  2VD4 A;  2GGO A;  1G97 A;  4IHF A;  1OCX A;  2QIV X;  3OU9 A;  3OTZ A;  1SSM A;  3VBN A;  5ADX V;  1HM9 A;  2QKX A;  2P2O A;  4M28 A;  3C8V A;  2OI6 A;  1KRV A;  4M9C A;  3R5C A;  3D98 A;  3IGJ A;  3OTM A;  1XAT A;  3FWW A;  3OW5 A;  4G3S A;  4M2A A;  1Z90 A;  4N27 A;  4EGG A;  2NPO A;  2AQ9 A;  1KK5 A;  4MFG A;  3VBK A;  1KGT A;  1V3W A;  3MC4 A;  2TDT A;  1XHD A;  2I5K A;  2V0K A;  1YP3 A;  3BSW A;  1YP2 A;  1KGQ A;  2OI7 A;  4G3P A;  4M99 A;  4J18 A;  2OI5 A;  4AC3 A;  4R36 A;  1SST A;  3FSY A;  4EAB A;  2V0H A;  5DG3 A;  3HJJ A;  4N6B A;  3F1X A;  3HSQ A;  2ICX A;  3MQH A;  3SPT A;  3TIS A;  5L6S A;  3FOQ A;  3R2W A;  3T57 A;  5DEM A;  1QRL A;  1FXJ A;  3R5B A;  4G3Q A;  3MQG A;  2QIA A;  3NZ2 A;  2V0I A;  3BSS A;  3KWC A;  4KNR A;  3ECT A;  4EA8 A;  3D8V A;  1KHR A;  2V0L A;  5L6V A;  4AA7 A;  3DJ4 A;  1V67 A;  2JF3 A;  5E3Q A;  3R3I A;  3R3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...