2XATA

Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
NYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPAFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQHWKQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hexapeptide xenobiotic acetyltransferase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Acetyltransferase
molecule keywords XENOBIOTIC ACETYLTRANSFERASE
total genus 61
structure length 208
sequence length 208
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1998-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2xatA00
2I5KA 4KPZA 3F1XA 3P47A 2V0KA 5L6SA 3FOQA 3BSWA 3VBJA 4KPXA 1G97A 3IXCA 4N27A 3R3RA 4DCLA 3TV0A 1T3DA 3KWDA 3OUPA 2VD4A 4AA7A 5E3PA 1KRVA 4M98A 2RIJA 3SPTA 3BXYA 4AAWA 3JQYA 2GGOA 5ADXV 1MRLA 3EH0A 4M99A 1SSMA 4IHGA 4R36A 4R7PA 3VBIA 1TDTA 1Z90A 1QQ0A 4EQYA 2NPOA 3T57A 2Q4JA 4KNXA 3D8VA 2QIAA 2QIVX 1KK6A 2W0VA 1V67A 3P1BA 3R1WA 4N6AA 1HV9A 3FSBA 3OU9A 2IC7A 2IU8A 2TDTA 3BSYA 4H7OA 4N69A 3FS8A 5E3QA 1XHDA 3FTTA 1MR9A 3FWWA 3I3AA 1KRUA 1FXJA 3EEVA 1KK5A 2OI6A 1MR7A 2JF2A 2VHEA 1YP4A 3GOSA 4MFGA 3V4EA 3DK5A 4E75A 3KWCA 1QRFA 5ADXU 4HCQA 3OW5A 3MQGA 1S80A 1V3WA 1HM8A 4ISXA 1FWYA 2V0IA 4IHHA 4E6TA 3FSXA 1QREA 2OI7A 3VBKA 3R5CA 2P2OA 3R5DA 3TK8A 3R0SA 4HZDA 4KNRA 4EGGA 2OEFA 4EABA 3R8YA 3VBPA 4K6RA 3R2WA 4G3SA 3R5AA 1HM9A 1SSQA 1LXAA 5DG3A 3HSQA 1THJA 3HJJA 1SSTA 3CJ8A 2IU9A 2WLCA 4G3PA 3NZ2A 3R5BA 3OTMA 3VBMA 4EA9A 4FCEA 2ICXA 2OI5A 3ST8A 3D98A 2XATA 1QRMA 3TWDA 2V0LA 3TDTA 3ECTA 2JF3A 1KHRA 4E79A 1KRRA 2FKOA 3PMOA 3OTZA 3VNPA 4EAAA 3FSCA 1QRGA 4HZCA 2V0HA 5AFUU 1OCXA 2WLFA 3EG4A 2WLGA 2OEGA 5U2KA 4HUSA 4J09A 1YP3A 2WLEA 2GGQA 3FSYA 3MQHA 3Q1XA 5AFUV 3DJ4A 5F42A 3SRTA 3BFPA 1KGQA 4HURA 5E3RA 2WLDA 3BSSA 4G87A 4M9CA 1HM0A 3MC4A 3BRKX 4N6BA 3R3IA 2V0JA 5L6VA 3DHOA 3I3XA 4R37A 4MZUA 3TISA 4E6UA 4EA7A 1QRLA 4M2AA 4AC3A 4EA8A 4E1KA 4M2BA 2QKXA 2AQ9A 4G3QA 5DEPA 4J18A 3IGJA 1KQAA 1XATA 3C8VA 4M28A 1G95A 3VBLA 2IUAA 5DEMA 4IHFA 1KK4A 4KQLA 3VBNA 1YP2A 1J2ZA 4MYOA 1KGTA 3TIOA 3GVDA 2ICYA 3KWEA 2W0WA 3GUEA
chains in the Genus database with same CATH superfamily
2I5KA 4KPZA 3F1XA 3P47A 2V0KA 5L6SA 3FOQA 3BSWA 3VBJA 4KPXA 1G97A 3IXCA 4N27A 3R3RA 4DCLA 3TV0A 1T3DA 3KWDA 3OUPA 2VD4A 4AA7A 5E3PA 3SUCA 1KRVA 4M98A 2RIJA 3SPTA 3BXYA 4AAWA 3JQYA 2GGOA 3OH0A 5ADXV 1MRLA 3EH0A 4M99A 1SSMA 4IHGA 4R36A 4R7PA 3VBIA 1TDTA 1Z90A 1QQ0A 4EQYA 2NPOA 3T57A 2Q4JA 4KNXA 3D8VA 2QIAA 2QIVX 1KK6A 2W0VA 1V67A 3P1BA 3R1WA 4N6AA 1HV9A 3FSBA 3OU9A 2IC7A 2IU8A 1Z2FA 2TDTA 3BSYA 4H7OA 4N69A 3FS8A 3GQ9A 5E3QA 1XHDA 3FTTA 1MR9A 3FWWA 3I3AA 1KRUA 1FXJA 3EEVA 3GQ7A 1KK5A 3OH1A 2OI6A 1MR7A 2JF2A 2VHEA 1YP4A 3GOSA 3OH4A 4MFGA 3DK5A 3V4EA 3KWCA 1QRFA 5ADXU 4HCQA 3OW5A 3MQGA 1S80A 1V3WA 1HM8A 4ISXA 1FWYA 2V0IA 4IHHA 4E6TA 3FSXA 1QREA 2OI7A 3VBKA 3R5CA 2P2OA 3R5DA 3TK8A 3R0SA 4HZDA 4KNRA 3GQ8A 4EGGA 2OEFA 4EABA 3R8YA 3VBPA 4K6RA 1L0SA 3R2WA 4G3SA 3R5AA 1HM9A 1SSQA 1LXAA 5DG3A 3HSQA 1THJA 3HJJA 1SSTA 3CJ8A 2IU9A 2WLCA 4G3PA 3NZ2A 3R5BA 4E75A 3OTMA 3VBMA 4EA9A 4FCEA 2ICXA 2OI5A 3ST8A 3D98A 2XATA 1QRMA 3TWDA 2V0LA 3TDTA 3ECTA 2JF3A 1KHRA 4E79A 1KRRA 2FKOA 3PMOA 3OTZA 3VNPA 4EAAA 3FSCA 1QRGA 4HZCA 2V0HA 5AFUU 1OCXA 2WLFA 3EG4A 2WLGA 2OEGA 5U2KA 4HUSA 4J09A 1YP3A 2WLEA 2GGQA 3FSYA 3MQHA 3Q1XA 5AFUV 3DJ4A 5F42A 3SRTA 3BFPA 1KGQA 4HURA 5E3RA 2WLDA 3BSSA 4G87A 4M9CA 1HM0A 3MC4A 3BRKX 4N6BA 3R3IA 2V0JA 5L6VA 3DHOA 1EWWA 3I3XA 1N4IA 1M8NA 4R37A 4MZUA 3TISA 4E6UA 4EA7A 1QRLA 4M2AA 4AC3A 4EA8A 4E1KA 4M2BA 2QKXA 2AQ9A 4G3QA 5DEPA 4J18A 3OH2A 3IGJA 1KQAA 1XATA 3C8VA 3OGZA 4M28A 1G95A 3VBLA 2IUAA 5DEMA 3GQAA 4IHFA 1KK4A 4KQLA 3VBNA 1YP2A 1J2ZA 3OH3A 4MYOA 1KGTA 3TIOA 3GVDA 2ICYA 3KWEA 2W0WA 3GUEA
chains in the Genus database with same CATH topology
2I5KA 4KPZA 3F1XA 3P47A 2V0KA 5L6SA 3FOQA 3BSWA 3VBJA 4KPXA 1G97A 3IXCA 4N27A 3R3RA 4DCLA 3TV0A 1T3DA 3KWDA 3OUPA 2VD4A 4AA7A 5E3PA 1KRVA 4M98A 2RIJA 3SPTA 3BXYA 4AAWA 3JQYA 2GGOA 5ADXV 1MRLA 3EH0A 4M99A 1SSMA 4IHGA 4R36A 4R7PA 3VBIA 1TDTA 1Z90A 1QQ0A 4EQYA 2NPOA 3T57A 2Q4JA 4KNXA 3D8VA 2QIAA 2QIVX 1KK6A 2W0VA 1V67A 3P1BA 3R1WA 4N6AA 1HV9A 3FSBA 3OU9A 2IC7A 2IU8A 2TDTA 3BSYA 4H7OA 4N69A 3FS8A 5E3QA 1XHDA 3FTTA 1MR9A 3FWWA 3I3AA 1KRUA 1FXJA 3EEVA 1KK5A 2OI6A 1MR7A 2JF2A 2VHEA 1YP4A 3GOSA 4MFGA 3V4EA 3DK5A 4E75A 3KWCA 1QRFA 5ADXU 4HCQA 3OW5A 3MQGA 1S80A 1V3WA 1HM8A 4ISXA 1FWYA 2V0IA 4IHHA 4E6TA 3FSXA 1QREA 2OI7A 3VBKA 3R5CA 2P2OA 3R5DA 3TK8A 3R0SA 4HZDA 4KNRA 4EGGA 2OEFA 4EABA 3R8YA 3VBPA 4K6RA 3R2WA 4G3SA 3R5AA 1HM9A 1SSQA 1LXAA 5DG3A 3HSQA 1THJA 3HJJA 1SSTA 3CJ8A 2IU9A 2WLCA 4G3PA 3NZ2A 3R5BA 3OTMA 3VBMA 4EA9A 4FCEA 2ICXA 2OI5A 3ST8A 3D98A 2XATA 1QRMA 3TWDA 2V0LA 3TDTA 3ECTA 2JF3A 1KHRA 4E79A 1KRRA 2FKOA 3PMOA 3OTZA 3VNPA 4EAAA 3FSCA 1QRGA 4HZCA 2V0HA 5AFUU 1OCXA 2WLFA 3EG4A 2WLGA 2OEGA 5U2KA 4HUSA 4J09A 1YP3A 2WLEA 2GGQA 3FSYA 3MQHA 3Q1XA 5AFUV 3DJ4A 5F42A 3SRTA 3BFPA 1KGQA 4HURA 5E3RA 2WLDA 3BSSA 4G87A 4M9CA 1HM0A 3MC4A 3BRKX 4N6BA 3R3IA 2V0JA 5L6VA 3DHOA 3I3XA 4R37A 4MZUA 3TISA 4E6UA 4EA7A 1QRLA 4M2AA 4AC3A 4EA8A 4E1KA 4M2BA 2QKXA 2AQ9A 4G3QA 5DEPA 4J18A 3IGJA 1KQAA 1XATA 3C8VA 4M28A 1G95A 3VBLA 2IUAA 5DEMA 4IHFA 1KK4A 4KQLA 3VBNA 1YP2A 1J2ZA 4MYOA 1KGTA 3TIOA 3GVDA 2ICYA 3KWEA 2W0WA 3GUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5K A;  4KPZ A;  3F1X A;  3P47 A;  2V0K A;  5L6S A;  3FOQ A;  3BSW A;  3VBJ A;  4KPX A;  1G97 A;  3IXC A;  4N27 A;  3R3R A;  4DCL A;  3TV0 A;  1T3D A;  3KWD A;  3OUP A;  2VD4 A;  4AA7 A;  5E3P A;  1KRV A;  4M98 A;  2RIJ A;  3SPT A;  3BXY A;  4AAW A;  3JQY A;  2GGO A;  5ADX V;  1MRL A;  3EH0 A;  4M99 A;  1SSM A;  4IHG A;  4R36 A;  4R7P A;  3VBI A;  1TDT A;  1Z90 A;  1QQ0 A;  4EQY A;  2NPO A;  3T57 A;  2Q4J A;  4KNX A;  3D8V A;  2QIA A;  2QIV X;  1KK6 A;  2W0V A;  1V67 A;  3P1B A;  3R1W A;  4N6A A;  1HV9 A;  3FSB A;  3OU9 A;  2IC7 A;  2IU8 A;  2TDT A;  3BSY A;  4H7O A;  4N69 A;  3FS8 A;  5E3Q A;  1XHD A;  3FTT A;  1MR9 A;  3FWW A;  3I3A A;  1KRU A;  1FXJ A;  3EEV A;  1KK5 A;  2OI6 A;  1MR7 A;  2JF2 A;  2VHE A;  1YP4 A;  3GOS A;  4MFG A;  3V4E A;  3DK5 A;  4E75 A;  3KWC A;  1QRF A;  5ADX U;  4HCQ A;  3OW5 A;  3MQG A;  1S80 A;  1V3W A;  1HM8 A;  4ISX A;  1FWY A;  2V0I A;  4IHH A;  4E6T A;  3FSX A;  1QRE A;  2OI7 A;  3VBK A;  3R5C A;  2P2O A;  3R5D A;  3TK8 A;  3R0S A;  4HZD A;  4KNR A;  4EGG A;  2OEF A;  4EAB A;  3R8Y A;  3VBP A;  4K6R A;  3R2W A;  4G3S A;  3R5A A;  1HM9 A;  1SSQ A;  1LXA A;  5DG3 A;  3HSQ A;  1THJ A;  3HJJ A;  1SST A;  3CJ8 A;  2IU9 A;  2WLC A;  4G3P A;  3NZ2 A;  3R5B A;  3OTM A;  3VBM A;  4EA9 A;  4FCE A;  2ICX A;  2OI5 A;  3ST8 A;  3D98 A;  2XAT A;  1QRM A;  3TWD A;  2V0L A;  3TDT A;  3ECT A;  2JF3 A;  1KHR A;  4E79 A;  1KRR A;  2FKO A;  3PMO A;  3OTZ A;  3VNP A;  4EAA A;  3FSC A;  1QRG A;  4HZC A;  2V0H A;  5AFU U;  1OCX A;  2WLF A;  3EG4 A;  2WLG A;  2OEG A;  5U2K A;  4HUS A;  4J09 A;  1YP3 A;  2WLE A;  2GGQ A;  3FSY A;  3MQH A;  3Q1X A;  5AFU V;  3DJ4 A;  5F42 A;  3SRT A;  3BFP A;  1KGQ A;  4HUR A;  5E3R A;  2WLD A;  3BSS A;  4G87 A;  4M9C A;  1HM0 A;  3MC4 A;  3BRK X;  4N6B A;  3R3I A;  2V0J A;  5L6V A;  3DHO A;  3I3X A;  4R37 A;  4MZU A;  3TIS A;  4E6U A;  4EA7 A;  1QRL A;  4M2A A;  4AC3 A;  4EA8 A;  4E1K A;  4M2B A;  2QKX A;  2AQ9 A;  4G3Q A;  5DEP A;  4J18 A;  3IGJ A;  1KQA A;  1XAT A;  3C8V A;  4M28 A;  1G95 A;  3VBL A;  2IUA A;  5DEM A;  4IHF A;  1KK4 A;  4KQL A;  3VBN A;  1YP2 A;  1J2Z A;  4MYO A;  1KGT A;  3TIO A;  3GVD A;  2ICY A;  3KWE A;  2W0W A;  3GUE A; 
#chains in the Genus database with same CATH topology
 2I5K A;  4KPZ A;  3F1X A;  3P47 A;  2V0K A;  5L6S A;  3FOQ A;  3BSW A;  3VBJ A;  4KPX A;  1G97 A;  3IXC A;  4N27 A;  3R3R A;  4DCL A;  3TV0 A;  1T3D A;  3KWD A;  3OUP A;  2VD4 A;  4AA7 A;  5E3P A;  3SUC A;  1KRV A;  4M98 A;  2RIJ A;  3SPT A;  3BXY A;  4AAW A;  3JQY A;  2GGO A;  3OH0 A;  5ADX V;  1MRL A;  3EH0 A;  4M99 A;  1SSM A;  4IHG A;  4R36 A;  4R7P A;  3VBI A;  1TDT A;  1Z90 A;  1QQ0 A;  4EQY A;  2NPO A;  3T57 A;  2Q4J A;  4KNX A;  3D8V A;  2QIA A;  2QIV X;  1KK6 A;  2W0V A;  1V67 A;  3P1B A;  3R1W A;  4N6A A;  1HV9 A;  3FSB A;  3OU9 A;  2IC7 A;  2IU8 A;  1Z2F A;  2TDT A;  3BSY A;  4H7O A;  4N69 A;  3FS8 A;  3GQ9 A;  5E3Q A;  1XHD A;  3FTT A;  1MR9 A;  3FWW A;  3I3A A;  1KRU A;  1FXJ A;  3EEV A;  3GQ7 A;  1KK5 A;  3OH1 A;  2OI6 A;  1MR7 A;  2JF2 A;  2VHE A;  1YP4 A;  3GOS A;  3OH4 A;  4MFG A;  3DK5 A;  3V4E A;  3KWC A;  1QRF A;  5ADX U;  4HCQ A;  3OW5 A;  3MQG A;  1S80 A;  1V3W A;  1HM8 A;  4ISX A;  1FWY A;  2V0I A;  4IHH A;  4E6T A;  3FSX A;  1QRE A;  2OI7 A;  3VBK A;  3R5C A;  2P2O A;  3R5D A;  3TK8 A;  3R0S A;  4HZD A;  4KNR A;  3GQ8 A;  4EGG A;  2OEF A;  4EAB A;  3R8Y A;  3VBP A;  4K6R A;  1L0S A;  3R2W A;  4G3S A;  3R5A A;  1HM9 A;  1SSQ A;  1LXA A;  5DG3 A;  3HSQ A;  1THJ A;  3HJJ A;  1SST A;  3CJ8 A;  2IU9 A;  2WLC A;  4G3P A;  3NZ2 A;  3R5B A;  4E75 A;  3OTM A;  3VBM A;  4EA9 A;  4FCE A;  2ICX A;  2OI5 A;  3ST8 A;  3D98 A;  2XAT A;  1QRM A;  3TWD A;  2V0L A;  3TDT A;  3ECT A;  2JF3 A;  1KHR A;  4E79 A;  1KRR A;  2FKO A;  3PMO A;  3OTZ A;  3VNP A;  4EAA A;  3FSC A;  1QRG A;  4HZC A;  2V0H A;  5AFU U;  1OCX A;  2WLF A;  3EG4 A;  2WLG A;  2OEG A;  5U2K A;  4HUS A;  4J09 A;  1YP3 A;  2WLE A;  2GGQ A;  3FSY A;  3MQH A;  3Q1X A;  5AFU V;  3DJ4 A;  5F42 A;  3SRT A;  3BFP A;  1KGQ A;  4HUR A;  5E3R A;  2WLD A;  3BSS A;  4G87 A;  4M9C A;  1HM0 A;  3MC4 A;  3BRK X;  4N6B A;  3R3I A;  2V0J A;  5L6V A;  3DHO A;  1EWW A;  3I3X A;  1N4I A;  1M8N A;  4R37 A;  4MZU A;  3TIS A;  4E6U A;  4EA7 A;  1QRL A;  4M2A A;  4AC3 A;  4EA8 A;  4E1K A;  4M2B A;  2QKX A;  2AQ9 A;  4G3Q A;  5DEP A;  4J18 A;  3OH2 A;  3IGJ A;  1KQA A;  1XAT A;  3C8V A;  3OGZ A;  4M28 A;  1G95 A;  3VBL A;  2IUA A;  5DEM A;  3GQA A;  4IHF A;  1KK4 A;  4KQL A;  3VBN A;  1YP2 A;  1J2Z A;  3OH3 A;  4MYO A;  1KGT A;  3TIO A;  3GVD A;  2ICY A;  3KWE A;  2W0W A;  3GUE A; 
#chains in the Genus database with same CATH homology
 2I5K A;  4KPZ A;  3F1X A;  3P47 A;  2V0K A;  5L6S A;  3FOQ A;  3BSW A;  3VBJ A;  4KPX A;  1G97 A;  3IXC A;  4N27 A;  3R3R A;  4DCL A;  3TV0 A;  1T3D A;  3KWD A;  3OUP A;  2VD4 A;  4AA7 A;  5E3P A;  1KRV A;  4M98 A;  2RIJ A;  3SPT A;  3BXY A;  4AAW A;  3JQY A;  2GGO A;  5ADX V;  1MRL A;  3EH0 A;  4M99 A;  1SSM A;  4IHG A;  4R36 A;  4R7P A;  3VBI A;  1TDT A;  1Z90 A;  1QQ0 A;  4EQY A;  2NPO A;  3T57 A;  2Q4J A;  4KNX A;  3D8V A;  2QIA A;  2QIV X;  1KK6 A;  2W0V A;  1V67 A;  3P1B A;  3R1W A;  4N6A A;  1HV9 A;  3FSB A;  3OU9 A;  2IC7 A;  2IU8 A;  2TDT A;  3BSY A;  4H7O A;  4N69 A;  3FS8 A;  5E3Q A;  1XHD A;  3FTT A;  1MR9 A;  3FWW A;  3I3A A;  1KRU A;  1FXJ A;  3EEV A;  1KK5 A;  2OI6 A;  1MR7 A;  2JF2 A;  2VHE A;  1YP4 A;  3GOS A;  4MFG A;  3V4E A;  3DK5 A;  4E75 A;  3KWC A;  1QRF A;  5ADX U;  4HCQ A;  3OW5 A;  3MQG A;  1S80 A;  1V3W A;  1HM8 A;  4ISX A;  1FWY A;  2V0I A;  4IHH A;  4E6T A;  3FSX A;  1QRE A;  2OI7 A;  3VBK A;  3R5C A;  2P2O A;  3R5D A;  3TK8 A;  3R0S A;  4HZD A;  4KNR A;  4EGG A;  2OEF A;  4EAB A;  3R8Y A;  3VBP A;  4K6R A;  3R2W A;  4G3S A;  3R5A A;  1HM9 A;  1SSQ A;  1LXA A;  5DG3 A;  3HSQ A;  1THJ A;  3HJJ A;  1SST A;  3CJ8 A;  2IU9 A;  2WLC A;  4G3P A;  3NZ2 A;  3R5B A;  3OTM A;  3VBM A;  4EA9 A;  4FCE A;  2ICX A;  2OI5 A;  3ST8 A;  3D98 A;  2XAT A;  1QRM A;  3TWD A;  2V0L A;  3TDT A;  3ECT A;  2JF3 A;  1KHR A;  4E79 A;  1KRR A;  2FKO A;  3PMO A;  3OTZ A;  3VNP A;  4EAA A;  3FSC A;  1QRG A;  4HZC A;  2V0H A;  5AFU U;  1OCX A;  2WLF A;  3EG4 A;  2WLG A;  2OEG A;  5U2K A;  4HUS A;  4J09 A;  1YP3 A;  2WLE A;  2GGQ A;  3FSY A;  3MQH A;  3Q1X A;  5AFU V;  3DJ4 A;  5F42 A;  3SRT A;  3BFP A;  1KGQ A;  4HUR A;  5E3R A;  2WLD A;  3BSS A;  4G87 A;  4M9C A;  1HM0 A;  3MC4 A;  3BRK X;  4N6B A;  3R3I A;  2V0J A;  5L6V A;  3DHO A;  3I3X A;  4R37 A;  4MZU A;  3TIS A;  4E6U A;  4EA7 A;  1QRL A;  4M2A A;  4AC3 A;  4EA8 A;  4E1K A;  4M2B A;  2QKX A;  2AQ9 A;  4G3Q A;  5DEP A;  4J18 A;  3IGJ A;  1KQA A;  1XAT A;  3C8V A;  4M28 A;  1G95 A;  3VBL A;  2IUA A;  5DEM A;  4IHF A;  1KK4 A;  4KQL A;  3VBN A;  1YP2 A;  1J2Z A;  4MYO A;  1KGT A;  3TIO A;  3GVD A;  2ICY A;  3KWE A;  2W0W A;  3GUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...