5DG3A

Structure of pseudomonas aeruginosa lpxa in complex with udp-3-o-(r-3-hydroxydecanoyl)-glcnac
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
256
structure length
256
Chain Sequence
LIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain pa7)
molecule tags Transferase
total genus 103
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5dg3A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5dg3A01
1QQ0A 2IC7A 4AC3A 3OTZA 4G3QA 3GOSA 1MR7A 3VBMA 2Q4JA 4KNRA 1Z90A 3JQYA 5DEPA 1SSQA 3R5AA 3C8VA 4E1KA 2RIJA 5ADXV 2WLDA 3R0SA 3ST8A 3OU9A 3TISA 2QIVX 2I5KA 1QRGA 1QRLA 2OI7A 4J18A 4DCLA 2W0VA 4AAWA 3MQGA 4E6UA 1T3DA 3GVDA 3VBIA 3VBKA 4E79A 1FWYA 2IUAA 4KPXA 1TDTA 3NZ2A 5E3PA 1FXJA 4M99A 3EG4A 5ADXU 3I3XA 1KRUA 1SSTA 4M9CA 3R1WA 3FSXA 1YP3A 3MQHA 4N27A 4R37A 3GUEA 5E3RA 1G95A 3BXYA 5DG3A 3FS8A 3V4EA 2GGOA 2V0IA 5L6VA 3DHOA 4N6AA 2FKOA 3VNPA 1XATA 2V0LA 4AA7A 2V0HA 2JF3A 4E75A 4M2AA 1KK5A 2TDTA 4IHHA 3VBJA 5AFUU 5L6SA 5U2KA 3R8YA 4MZUA 3EH0A 4E6TA 1KK4A 2IU9A 3VBNA 4FCEA 3F1XA 4HCQA 3OUPA 3P47A 3P1BA 3FSCA 4J09A 1KRVA 4EA9A 3BFPA 4MFGA 3SRTA 5AFUV 2IU8A 3TIOA 1YP2A 1HM9A 2OEFA 3DK5A 1KGTA 5E3QA 3FTTA 4HZDA 4IHFA 1HM0A 3R5DA 4G3SA 3Q1XA 1J2ZA 3EEVA 4HZCA 1V3WA 3PMOA 4N6BA 3SPTA 1QRFA 3IGJA 4R36A 1KQAA 2ICXA 1MR9A 1HV9A 1KK6A 4G3PA 4EA8A 1KHRA 1KRRA 1QREA 3BSSA 3D98A 2VD4A 1XHDA 3T57A 1YP4A 2OEGA 3MC4A 2WLEA 3D8VA 4G87A 4KNXA 2V0KA 4M98A 4N69A 4R7PA 3R5BA 2QKXA 2V0JA 1LXAA 3VBPA 3BSWA 2WLFA 3KWCA 2QIAA 1THJA 3BRKX 4EA7A 2W0WA 1QRMA 3ECTA 3R3IA 1KGQA 4M2BA 1MRLA 2AQ9A 3IXCA 1SSMA 2WLGA 3OTMA 4MYOA 3KWEA 3HSQA 4EABA 4EQYA 4HUSA 2GGQA 1V67A 2OI6A 4KQLA 5DEMA 2ICYA 3KWDA 4KPZA 4H7OA 3TWDA 1S80A 3FSBA 3I3AA 3TV0A 4EAAA 1OCXA 3CJ8A 3DJ4A 1HM8A 1G97A 3FOQA 2NPOA 3FWWA 2VHEA 2JF2A 3HJJA 4ISXA 3TK8A 3OW5A 5F42A 2WLCA 2XATA 4M28A 4K6RA 4HURA 3TDTA 2P2OA 3FSYA 2OI5A 4IHGA 3R2WA 3BSYA 4EGGA 3R5CA 3R3RA 3VBLA
chains in the Genus database with same CATH superfamily
1QQ0A 1EWWA 2IC7A 4AC3A 3OTZA 4G3QA 3SUCA 3OH3A 3GOSA 1MR7A 3GQ9A 3VBMA 2Q4JA 4KNRA 1Z90A 3JQYA 5DEPA 1SSQA 3R5AA 3OH1A 3C8VA 4E1KA 2RIJA 5ADXV 2WLDA 3R0SA 3ST8A 3OU9A 3TISA 2QIVX 2I5KA 1QRGA 1QRLA 2OI7A 4J18A 4DCLA 2W0VA 4AAWA 3MQGA 4E6UA 1T3DA 3GVDA 3VBIA 3VBKA 4E79A 1FWYA 2IUAA 4KPXA 1TDTA 3NZ2A 5E3PA 1FXJA 4M99A 3EG4A 5ADXU 3I3XA 1KRUA 1SSTA 4M9CA 3R1WA 3FSXA 1YP3A 3MQHA 4N27A 4R37A 3GUEA 5E3RA 1G95A 3BXYA 5DG3A 3FS8A 3V4EA 2GGOA 2V0IA 5L6VA 3DHOA 4N6AA 2FKOA 3VNPA 1XATA 2V0LA 4AA7A 2V0HA 2JF3A 4E75A 4M2AA 1KK5A 2TDTA 4IHHA 3VBJA 5AFUU 5L6SA 5U2KA 3R8YA 4MZUA 3EH0A 4E6TA 1KK4A 2IU9A 3VBNA 4FCEA 3F1XA 1M8NA 4HCQA 3OUPA 3P47A 3P1BA 3FSCA 4J09A 1KRVA 4EA9A 3OGZA 3BFPA 4MFGA 3GQAA 3SRTA 5AFUV 2IU8A 3TIOA 1YP2A 1HM9A 2OEFA 3DK5A 1KGTA 5E3QA 3FTTA 4HZDA 4IHFA 1HM0A 3R5DA 4G3SA 3OH0A 1J2ZA 3EEVA 3Q1XA 4HZCA 1V3WA 3PMOA 4N6BA 3SPTA 1QRFA 3IGJA 4R36A 1KQAA 1Z2FA 1MR9A 2ICXA 1HV9A 1KK6A 3OH4A 4G3PA 4EA8A 1KHRA 1KRRA 1QREA 3BSSA 3D98A 2VD4A 1XHDA 3T57A 1YP4A 2OEGA 3GQ8A 3MC4A 2WLEA 3D8VA 4G87A 4KNXA 2V0KA 4M98A 4N69A 4R7PA 3R5BA 2QKXA 2V0JA 1LXAA 3VBPA 3BSWA 2WLFA 3KWCA 3OH2A 2QIAA 1THJA 3BRKX 4EA7A 2W0WA 1QRMA 3ECTA 3R3IA 1KGQA 4M2BA 1MRLA 2AQ9A 3IXCA 1SSMA 2WLGA 3OTMA 4MYOA 3KWEA 3HSQA 3GQ7A 4EABA 4EQYA 1L0SA 2GGQA 1N4IA 1V67A 2OI6A 4HUSA 4KQLA 5DEMA 2ICYA 3KWDA 4KPZA 4H7OA 3TWDA 1S80A 3FSBA 3I3AA 3TV0A 4EAAA 1OCXA 3CJ8A 3DJ4A 1HM8A 1G97A 3FOQA 2NPOA 3FWWA 2VHEA 2JF2A 3HJJA 4ISXA 3TK8A 3OW5A 5F42A 2WLCA 2XATA 4M28A 4K6RA 4HURA 3TDTA 2P2OA 3FSYA 2OI5A 4IHGA 3R2WA 3BSYA 4EGGA 3R5CA 3R3RA 3VBLA
chains in the Genus database with same CATH topology
1QQ0A 2IC7A 4AC3A 3OTZA 4G3QA 3GOSA 1MR7A 3VBMA 2Q4JA 4KNRA 1Z90A 3JQYA 5DEPA 1SSQA 3R5AA 3C8VA 4E1KA 2RIJA 5ADXV 2WLDA 3R0SA 3ST8A 3OU9A 3TISA 2QIVX 2I5KA 1QRGA 1QRLA 2OI7A 4J18A 4DCLA 2W0VA 4AAWA 3MQGA 4E6UA 1T3DA 3GVDA 3VBIA 3VBKA 4E79A 1FWYA 2IUAA 4KPXA 1TDTA 3NZ2A 5E3PA 1FXJA 4M99A 3EG4A 5ADXU 3I3XA 1KRUA 1SSTA 4M9CA 3R1WA 3FSXA 1YP3A 3MQHA 4N27A 4R37A 3GUEA 5E3RA 1G95A 3BXYA 5DG3A 3FS8A 3V4EA 2GGOA 2V0IA 5L6VA 3DHOA 4N6AA 2FKOA 3VNPA 1XATA 2V0LA 4AA7A 2V0HA 2JF3A 4E75A 4M2AA 1KK5A 2TDTA 4IHHA 3VBJA 5AFUU 5L6SA 5U2KA 3R8YA 4MZUA 3EH0A 4E6TA 1KK4A 2IU9A 3VBNA 4FCEA 3F1XA 4HCQA 3OUPA 3P47A 3P1BA 3FSCA 4J09A 1KRVA 4EA9A 3BFPA 4MFGA 3SRTA 5AFUV 2IU8A 3TIOA 1YP2A 1HM9A 2OEFA 3DK5A 1KGTA 5E3QA 3FTTA 4HZDA 4IHFA 1HM0A 3R5DA 4G3SA 3Q1XA 1J2ZA 3EEVA 4HZCA 1V3WA 3PMOA 4N6BA 3SPTA 1QRFA 3IGJA 4R36A 1KQAA 2ICXA 1MR9A 1HV9A 1KK6A 4G3PA 4EA8A 1KHRA 1KRRA 1QREA 3BSSA 3D98A 2VD4A 1XHDA 3T57A 1YP4A 2OEGA 3MC4A 2WLEA 3D8VA 4G87A 4KNXA 2V0KA 4M98A 4N69A 4R7PA 3R5BA 2QKXA 2V0JA 1LXAA 3VBPA 3BSWA 2WLFA 3KWCA 2QIAA 1THJA 3BRKX 4EA7A 2W0WA 1QRMA 3ECTA 3R3IA 1KGQA 4M2BA 1MRLA 2AQ9A 3IXCA 1SSMA 2WLGA 3OTMA 4MYOA 3KWEA 3HSQA 4EABA 4EQYA 4HUSA 2GGQA 1V67A 2OI6A 4KQLA 5DEMA 2ICYA 3KWDA 4KPZA 4H7OA 3TWDA 1S80A 3FSBA 3I3AA 3TV0A 4EAAA 1OCXA 3CJ8A 3DJ4A 1HM8A 1G97A 3FOQA 2NPOA 3FWWA 2VHEA 2JF2A 3HJJA 4ISXA 3TK8A 3OW5A 5F42A 2WLCA 2XATA 4M28A 4K6RA 4HURA 3TDTA 2P2OA 3FSYA 2OI5A 4IHGA 3R2WA 3BSYA 4EGGA 3R5CA 3R3RA 3VBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ0 A;  2IC7 A;  4AC3 A;  3OTZ A;  4G3Q A;  3GOS A;  1MR7 A;  3VBM A;  2Q4J A;  4KNR A;  1Z90 A;  3JQY A;  5DEP A;  1SSQ A;  3R5A A;  3C8V A;  4E1K A;  2RIJ A;  5ADX V;  2WLD A;  3R0S A;  3ST8 A;  3OU9 A;  3TIS A;  2QIV X;  2I5K A;  1QRG A;  1QRL A;  2OI7 A;  4J18 A;  4DCL A;  2W0V A;  4AAW A;  3MQG A;  4E6U A;  1T3D A;  3GVD A;  3VBI A;  3VBK A;  4E79 A;  1FWY A;  2IUA A;  4KPX A;  1TDT A;  3NZ2 A;  5E3P A;  1FXJ A;  4M99 A;  3EG4 A;  5ADX U;  3I3X A;  1KRU A;  1SST A;  4M9C A;  3R1W A;  3FSX A;  1YP3 A;  3MQH A;  4N27 A;  4R37 A;  3GUE A;  5E3R A;  1G95 A;  3BXY A;  5DG3 A;  3FS8 A;  3V4E A;  2GGO A;  2V0I A;  5L6V A;  3DHO A;  4N6A A;  2FKO A;  3VNP A;  1XAT A;  2V0L A;  4AA7 A;  2V0H A;  2JF3 A;  4E75 A;  4M2A A;  1KK5 A;  2TDT A;  4IHH A;  3VBJ A;  5AFU U;  5L6S A;  5U2K A;  3R8Y A;  4MZU A;  3EH0 A;  4E6T A;  1KK4 A;  2IU9 A;  3VBN A;  4FCE A;  3F1X A;  4HCQ A;  3OUP A;  3P47 A;  3P1B A;  3FSC A;  4J09 A;  1KRV A;  4EA9 A;  3BFP A;  4MFG A;  3SRT A;  5AFU V;  2IU8 A;  3TIO A;  1YP2 A;  1HM9 A;  2OEF A;  3DK5 A;  1KGT A;  5E3Q A;  3FTT A;  4HZD A;  4IHF A;  1HM0 A;  3R5D A;  4G3S A;  3Q1X A;  1J2Z A;  3EEV A;  4HZC A;  1V3W A;  3PMO A;  4N6B A;  3SPT A;  1QRF A;  3IGJ A;  4R36 A;  1KQA A;  2ICX A;  1MR9 A;  1HV9 A;  1KK6 A;  4G3P A;  4EA8 A;  1KHR A;  1KRR A;  1QRE A;  3BSS A;  3D98 A;  2VD4 A;  1XHD A;  3T57 A;  1YP4 A;  2OEG A;  3MC4 A;  2WLE A;  3D8V A;  4G87 A;  4KNX A;  2V0K A;  4M98 A;  4N69 A;  4R7P A;  3R5B A;  2QKX A;  2V0J A;  1LXA A;  3VBP A;  3BSW A;  2WLF A;  3KWC A;  2QIA A;  1THJ A;  3BRK X;  4EA7 A;  2W0W A;  1QRM A;  3ECT A;  3R3I A;  1KGQ A;  4M2B A;  1MRL A;  2AQ9 A;  3IXC A;  1SSM A;  2WLG A;  3OTM A;  4MYO A;  3KWE A;  3HSQ A;  4EAB A;  4EQY A;  4HUS A;  2GGQ A;  1V67 A;  2OI6 A;  4KQL A;  5DEM A;  2ICY A;  3KWD A;  4KPZ A;  4H7O A;  3TWD A;  1S80 A;  3FSB A;  3I3A A;  3TV0 A;  4EAA A;  1OCX A;  3CJ8 A;  3DJ4 A;  1HM8 A;  1G97 A;  3FOQ A;  2NPO A;  3FWW A;  2VHE A;  2JF2 A;  3HJJ A;  4ISX A;  3TK8 A;  3OW5 A;  5F42 A;  2WLC A;  2XAT A;  4M28 A;  4K6R A;  4HUR A;  3TDT A;  2P2O A;  3FSY A;  2OI5 A;  4IHG A;  3R2W A;  3BSY A;  4EGG A;  3R5C A;  3R3R A;  3VBL A; 
#chains in the Genus database with same CATH topology
 1QQ0 A;  1EWW A;  2IC7 A;  4AC3 A;  3OTZ A;  4G3Q A;  3SUC A;  3OH3 A;  3GOS A;  1MR7 A;  3GQ9 A;  3VBM A;  2Q4J A;  4KNR A;  1Z90 A;  3JQY A;  5DEP A;  1SSQ A;  3R5A A;  3OH1 A;  3C8V A;  4E1K A;  2RIJ A;  5ADX V;  2WLD A;  3R0S A;  3ST8 A;  3OU9 A;  3TIS A;  2QIV X;  2I5K A;  1QRG A;  1QRL A;  2OI7 A;  4J18 A;  4DCL A;  2W0V A;  4AAW A;  3MQG A;  4E6U A;  1T3D A;  3GVD A;  3VBI A;  3VBK A;  4E79 A;  1FWY A;  2IUA A;  4KPX A;  1TDT A;  3NZ2 A;  5E3P A;  1FXJ A;  4M99 A;  3EG4 A;  5ADX U;  3I3X A;  1KRU A;  1SST A;  4M9C A;  3R1W A;  3FSX A;  1YP3 A;  3MQH A;  4N27 A;  4R37 A;  3GUE A;  5E3R A;  1G95 A;  3BXY A;  5DG3 A;  3FS8 A;  3V4E A;  2GGO A;  2V0I A;  5L6V A;  3DHO A;  4N6A A;  2FKO A;  3VNP A;  1XAT A;  2V0L A;  4AA7 A;  2V0H A;  2JF3 A;  4E75 A;  4M2A A;  1KK5 A;  2TDT A;  4IHH A;  3VBJ A;  5AFU U;  5L6S A;  5U2K A;  3R8Y A;  4MZU A;  3EH0 A;  4E6T A;  1KK4 A;  2IU9 A;  3VBN A;  4FCE A;  3F1X A;  1M8N A;  4HCQ A;  3OUP A;  3P47 A;  3P1B A;  3FSC A;  4J09 A;  1KRV A;  4EA9 A;  3OGZ A;  3BFP A;  4MFG A;  3GQA A;  3SRT A;  5AFU V;  2IU8 A;  3TIO A;  1YP2 A;  1HM9 A;  2OEF A;  3DK5 A;  1KGT A;  5E3Q A;  3FTT A;  4HZD A;  4IHF A;  1HM0 A;  3R5D A;  4G3S A;  3OH0 A;  1J2Z A;  3EEV A;  3Q1X A;  4HZC A;  1V3W A;  3PMO A;  4N6B A;  3SPT A;  1QRF A;  3IGJ A;  4R36 A;  1KQA A;  1Z2F A;  1MR9 A;  2ICX A;  1HV9 A;  1KK6 A;  3OH4 A;  4G3P A;  4EA8 A;  1KHR A;  1KRR A;  1QRE A;  3BSS A;  3D98 A;  2VD4 A;  1XHD A;  3T57 A;  1YP4 A;  2OEG A;  3GQ8 A;  3MC4 A;  2WLE A;  3D8V A;  4G87 A;  4KNX A;  2V0K A;  4M98 A;  4N69 A;  4R7P A;  3R5B A;  2QKX A;  2V0J A;  1LXA A;  3VBP A;  3BSW A;  2WLF A;  3KWC A;  3OH2 A;  2QIA A;  1THJ A;  3BRK X;  4EA7 A;  2W0W A;  1QRM A;  3ECT A;  3R3I A;  1KGQ A;  4M2B A;  1MRL A;  2AQ9 A;  3IXC A;  1SSM A;  2WLG A;  3OTM A;  4MYO A;  3KWE A;  3HSQ A;  3GQ7 A;  4EAB A;  4EQY A;  1L0S A;  2GGQ A;  1N4I A;  1V67 A;  2OI6 A;  4HUS A;  4KQL A;  5DEM A;  2ICY A;  3KWD A;  4KPZ A;  4H7O A;  3TWD A;  1S80 A;  3FSB A;  3I3A A;  3TV0 A;  4EAA A;  1OCX A;  3CJ8 A;  3DJ4 A;  1HM8 A;  1G97 A;  3FOQ A;  2NPO A;  3FWW A;  2VHE A;  2JF2 A;  3HJJ A;  4ISX A;  3TK8 A;  3OW5 A;  5F42 A;  2WLC A;  2XAT A;  4M28 A;  4K6R A;  4HUR A;  3TDT A;  2P2O A;  3FSY A;  2OI5 A;  4IHG A;  3R2W A;  3BSY A;  4EGG A;  3R5C A;  3R3R A;  3VBL A; 
#chains in the Genus database with same CATH homology
 1QQ0 A;  2IC7 A;  4AC3 A;  3OTZ A;  4G3Q A;  3GOS A;  1MR7 A;  3VBM A;  2Q4J A;  4KNR A;  1Z90 A;  3JQY A;  5DEP A;  1SSQ A;  3R5A A;  3C8V A;  4E1K A;  2RIJ A;  5ADX V;  2WLD A;  3R0S A;  3ST8 A;  3OU9 A;  3TIS A;  2QIV X;  2I5K A;  1QRG A;  1QRL A;  2OI7 A;  4J18 A;  4DCL A;  2W0V A;  4AAW A;  3MQG A;  4E6U A;  1T3D A;  3GVD A;  3VBI A;  3VBK A;  4E79 A;  1FWY A;  2IUA A;  4KPX A;  1TDT A;  3NZ2 A;  5E3P A;  1FXJ A;  4M99 A;  3EG4 A;  5ADX U;  3I3X A;  1KRU A;  1SST A;  4M9C A;  3R1W A;  3FSX A;  1YP3 A;  3MQH A;  4N27 A;  4R37 A;  3GUE A;  5E3R A;  1G95 A;  3BXY A;  5DG3 A;  3FS8 A;  3V4E A;  2GGO A;  2V0I A;  5L6V A;  3DHO A;  4N6A A;  2FKO A;  3VNP A;  1XAT A;  2V0L A;  4AA7 A;  2V0H A;  2JF3 A;  4E75 A;  4M2A A;  1KK5 A;  2TDT A;  4IHH A;  3VBJ A;  5AFU U;  5L6S A;  5U2K A;  3R8Y A;  4MZU A;  3EH0 A;  4E6T A;  1KK4 A;  2IU9 A;  3VBN A;  4FCE A;  3F1X A;  4HCQ A;  3OUP A;  3P47 A;  3P1B A;  3FSC A;  4J09 A;  1KRV A;  4EA9 A;  3BFP A;  4MFG A;  3SRT A;  5AFU V;  2IU8 A;  3TIO A;  1YP2 A;  1HM9 A;  2OEF A;  3DK5 A;  1KGT A;  5E3Q A;  3FTT A;  4HZD A;  4IHF A;  1HM0 A;  3R5D A;  4G3S A;  3Q1X A;  1J2Z A;  3EEV A;  4HZC A;  1V3W A;  3PMO A;  4N6B A;  3SPT A;  1QRF A;  3IGJ A;  4R36 A;  1KQA A;  2ICX A;  1MR9 A;  1HV9 A;  1KK6 A;  4G3P A;  4EA8 A;  1KHR A;  1KRR A;  1QRE A;  3BSS A;  3D98 A;  2VD4 A;  1XHD A;  3T57 A;  1YP4 A;  2OEG A;  3MC4 A;  2WLE A;  3D8V A;  4G87 A;  4KNX A;  2V0K A;  4M98 A;  4N69 A;  4R7P A;  3R5B A;  2QKX A;  2V0J A;  1LXA A;  3VBP A;  3BSW A;  2WLF A;  3KWC A;  2QIA A;  1THJ A;  3BRK X;  4EA7 A;  2W0W A;  1QRM A;  3ECT A;  3R3I A;  1KGQ A;  4M2B A;  1MRL A;  2AQ9 A;  3IXC A;  1SSM A;  2WLG A;  3OTM A;  4MYO A;  3KWE A;  3HSQ A;  4EAB A;  4EQY A;  4HUS A;  2GGQ A;  1V67 A;  2OI6 A;  4KQL A;  5DEM A;  2ICY A;  3KWD A;  4KPZ A;  4H7O A;  3TWD A;  1S80 A;  3FSB A;  3I3A A;  3TV0 A;  4EAA A;  1OCX A;  3CJ8 A;  3DJ4 A;  1HM8 A;  1G97 A;  3FOQ A;  2NPO A;  3FWW A;  2VHE A;  2JF2 A;  3HJJ A;  4ISX A;  3TK8 A;  3OW5 A;  5F42 A;  2WLC A;  2XAT A;  4M28 A;  4K6R A;  4HUR A;  3TDT A;  2P2O A;  3FSY A;  2OI5 A;  4IHG A;  3R2W A;  3BSY A;  4EGG A;  3R5C A;  3R3R A;  3VBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...