5DG3A

Structure of pseudomonas aeruginosa lpxa in complex with udp-3-o-(r-3-hydroxydecanoyl)-glcnac
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
256
structure length
256
Chain Sequence
b'LIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain pa7)
molecule tags Transferase
total genus 103
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5dg3A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5dg3A01
3BRKX 4H7OA 1HM8A 2V0KA 2V0IA 5DEMA 4R36A 4KNXA 2RIJA 1MRLA 3BFPA 1G95A 3GVDA 5E3RA 5L6VA 3R5CA 3Q1XA 2QIAA 3FOQA 3TV0A 3C8VA 1YP4A 2XATA 1KRVA 3OUPA 2NPOA 3FSBA 4M9CA 3VNPA 1G97A 4G3PA 3SPTA 3I3AA 4KPZA 5F42A 3TDTA 3EH0A 1Z90A 5DEPA 4N27A 1QREA 4AAWA 4MZUA 1S80A 1KK5A 3VBNA 3IXCA 4EQYA 2WLGA 4IHHA 5AFUU 4EABA 1KQAA 4HZDA 4EA9A 3D8VA 2IU8A 2FKOA 3MQGA 3BXYA 4M98A 1XHDA 5U2KA 4IHGA 1QQ0A 1YP2A 2V0JA 3DHOA 1TDTA 2IU9A 3R3RA 1MR7A 5L6SA 3MQHA 3KWCA 2ICYA 1SSMA 5DG3A 1V3WA 2GGOA 4MYOA 2W0WA 3FTTA 1KRRA 3NZ2A 3R5AA 5ADXV 4KPXA 1HM9A 1KGQA 1FXJA 4N69A 4EAAA 4EA7A 3T57A 3FSXA 1HM0A 4IHFA 2IUAA 4HZCA 3FS8A 4R7PA 1KHRA 2IC7A 2W0VA 2WLDA 1SSQA 1FWYA 2TDTA 4E75A 1YP3A 3R0SA 1SSTA 2WLCA 3BSSA 3I3XA 1KK6A 2QIVX 3R2WA 4MFGA 4N6BA 3VBMA 4EA8A 4ISXA 3F1XA 4M28A 3GOSA 4EGGA 3D98A 1KGTA 4AA7A 4E6UA 1KK4A 2AQ9A 3OTMA 1LXAA 4R37A 2JF2A 3FWWA 2VD4A 3JQYA 3MC4A 2I5KA 2WLEA 5ADXU 4KQLA 4E6TA 2Q4JA 4KNRA 3ST8A 1THJA 3CJ8A 3ECTA 3HJJA 3EEVA 4G87A 1QRGA 1T3DA 2GGQA 2VHEA 3R5BA 4G3QA 3VBKA 2P2OA 3KWDA 2QKXA 3P47A 3GUEA 3IGJA 3PMOA 4N6AA 4M99A 5E3QA 3EG4A 3HSQA 2JF3A 4E79A 4HCQA 3FSCA 3FSYA 4K6RA 3BSYA 3BSWA 3TWDA 4J09A 3TK8A 4FCEA 3TISA 1HV9A 3VBIA 4M2AA 2OEFA 4HUSA 1OCXA 2ICXA 1QRLA 4AC3A 2V0HA 1J2ZA 3SRTA 3VBPA 3OW5A 3VBJA 2OI6A 3DK5A 3P1BA 5E3PA 4E1KA 4HURA 1KRUA 3OTZA 5AFUV 3DJ4A 3R8YA 2OI5A 1XATA 3R5DA 3R3IA 4G3SA 3VBLA 1QRFA 2OEGA 2V0LA 3OU9A 2WLFA 3R1WA 4J18A 4M2BA 3TIOA 3V4EA 4DCLA 1MR9A 3KWEA 1QRMA 1V67A 2OI7A
chains in the Genus database with same CATH superfamily
3BRKX 4H7OA 1HM8A 2V0KA 2V0IA 5DEMA 4R36A 4KNXA 2RIJA 1MRLA 3BFPA 1G95A 3GVDA 5E3RA 5L6VA 3R5CA 3Q1XA 2QIAA 3FOQA 3TV0A 3C8VA 1YP4A 2XATA 1KRVA 3OUPA 2NPOA 3FSBA 4M9CA 3VNPA 1G97A 4G3PA 3SPTA 3I3AA 4KPZA 5F42A 3TDTA 3EH0A 1Z90A 5DEPA 4N27A 1QREA 4AAWA 4MZUA 1S80A 1KK5A 3VBNA 3OH2A 3IXCA 4EQYA 2WLGA 4IHHA 5AFUU 4EABA 1KQAA 4HZDA 4EA9A 3D8VA 2IU8A 2FKOA 3GQ7A 3MQGA 3BXYA 4M98A 1XHDA 1L0SA 5U2KA 4IHGA 1QQ0A 1YP2A 2V0JA 3DHOA 1TDTA 2IU9A 3R3RA 1MR7A 5L6SA 3MQHA 3KWCA 2ICYA 1SSMA 5DG3A 1V3WA 2GGOA 4MYOA 2W0WA 3FTTA 1KRRA 3NZ2A 3R5AA 5ADXV 4KPXA 3OH3A 1HM9A 1KGQA 1FXJA 4N69A 4EAAA 4EA7A 3T57A 3FSXA 1HM0A 4IHFA 2IUAA 4HZCA 3FS8A 4R7PA 1KHRA 2IC7A 2W0VA 2WLDA 1Z2FA 1SSQA 1FWYA 2TDTA 4E75A 1YP3A 3R0SA 1SSTA 2WLCA 3BSSA 3I3XA 1KK6A 2QIVX 3R2WA 4MFGA 4N6BA 3SUCA 3VBMA 4ISXA 3F1XA 4M28A 3GOSA 4EA8A 4EGGA 3D98A 1KGTA 4AA7A 4E6UA 3OH4A 1KK4A 2AQ9A 3OTMA 1LXAA 3GQ9A 4R37A 2JF2A 3FWWA 2VD4A 3JQYA 3MC4A 2I5KA 2WLEA 5ADXU 4KQLA 4E6TA 2Q4JA 4KNRA 3ST8A 1THJA 3CJ8A 3ECTA 3HJJA 3EEVA 4G87A 1QRGA 1T3DA 2GGQA 2VHEA 3R5BA 4G3QA 3VBKA 2P2OA 3KWDA 2QKXA 3P47A 3GUEA 3IGJA 3PMOA 4N6AA 4M99A 5E3QA 3EG4A 3HSQA 3GQ8A 2JF3A 4E79A 4HCQA 3FSCA 3FSYA 4K6RA 3BSYA 3BSWA 1EWWA 1M8NA 3GQAA 3TWDA 4J09A 3TK8A 4FCEA 3TISA 1HV9A 3VBIA 4M2AA 2OEFA 4HUSA 1OCXA 2ICXA 1N4IA 1QRLA 2V0HA 1J2ZA 4AC3A 3SRTA 3VBPA 3OH1A 3OW5A 3VBJA 2OI6A 3DK5A 3P1BA 5E3PA 4E1KA 4HURA 1KRUA 3OTZA 5AFUV 3DJ4A 3R8YA 2OI5A 4DCLA 1XATA 3R5DA 3R3IA 4G3SA 3VBLA 1QRFA 2OEGA 2V0LA 3OGZA 2WLFA 3OU9A 3R1WA 4J18A 4M2BA 3OH0A 3TIOA 1MR9A 3KWEA 3V4EA 1QRMA 1V67A 2OI7A
chains in the Genus database with same CATH topology
3BRKX 4H7OA 1HM8A 2V0KA 2V0IA 5DEMA 4R36A 4KNXA 2RIJA 1MRLA 3BFPA 1G95A 3GVDA 5E3RA 5L6VA 3R5CA 3Q1XA 2QIAA 3FOQA 3TV0A 3C8VA 1YP4A 2XATA 1KRVA 3OUPA 2NPOA 3FSBA 4M9CA 3VNPA 1G97A 4G3PA 3SPTA 3I3AA 4KPZA 5F42A 3TDTA 3EH0A 1Z90A 5DEPA 4N27A 1QREA 4AAWA 4MZUA 1S80A 1KK5A 3VBNA 3IXCA 4EQYA 2WLGA 4IHHA 5AFUU 4EABA 1KQAA 4HZDA 4EA9A 3D8VA 2IU8A 2FKOA 3MQGA 3BXYA 4M98A 1XHDA 5U2KA 4IHGA 1QQ0A 1YP2A 2V0JA 3DHOA 1TDTA 2IU9A 3R3RA 1MR7A 5L6SA 3MQHA 3KWCA 2ICYA 1SSMA 5DG3A 1V3WA 2GGOA 4MYOA 2W0WA 3FTTA 1KRRA 3NZ2A 3R5AA 5ADXV 4KPXA 1HM9A 1KGQA 1FXJA 4N69A 4EAAA 4EA7A 3T57A 3FSXA 1HM0A 4IHFA 2IUAA 4HZCA 3FS8A 4R7PA 1KHRA 2IC7A 2W0VA 2WLDA 1SSQA 1FWYA 2TDTA 4E75A 1YP3A 3R0SA 1SSTA 2WLCA 3BSSA 3I3XA 1KK6A 2QIVX 3R2WA 4MFGA 4N6BA 3VBMA 4EA8A 4ISXA 3F1XA 4M28A 3GOSA 4EGGA 3D98A 1KGTA 4AA7A 4E6UA 1KK4A 2AQ9A 3OTMA 1LXAA 4R37A 2JF2A 3FWWA 2VD4A 3JQYA 3MC4A 2I5KA 2WLEA 5ADXU 4KQLA 4E6TA 2Q4JA 4KNRA 3ST8A 1THJA 3CJ8A 3ECTA 3HJJA 3EEVA 4G87A 1QRGA 1T3DA 2GGQA 2VHEA 3R5BA 4G3QA 3VBKA 2P2OA 3KWDA 2QKXA 3P47A 3GUEA 3IGJA 3PMOA 4N6AA 4M99A 5E3QA 3EG4A 3HSQA 2JF3A 4E79A 4HCQA 3FSCA 3FSYA 4K6RA 3BSYA 3BSWA 3TWDA 4J09A 3TK8A 4FCEA 3TISA 1HV9A 3VBIA 4M2AA 2OEFA 4HUSA 1OCXA 2ICXA 1QRLA 4AC3A 2V0HA 1J2ZA 3SRTA 3VBPA 3OW5A 3VBJA 2OI6A 3DK5A 3P1BA 5E3PA 4E1KA 4HURA 1KRUA 3OTZA 5AFUV 3DJ4A 3R8YA 2OI5A 1XATA 3R5DA 3R3IA 4G3SA 3VBLA 1QRFA 2OEGA 2V0LA 3OU9A 2WLFA 3R1WA 4J18A 4M2BA 3TIOA 3V4EA 4DCLA 1MR9A 3KWEA 1QRMA 1V67A 2OI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRK X;  4H7O A;  1HM8 A;  2V0K A;  2V0I A;  5DEM A;  4R36 A;  4KNX A;  2RIJ A;  1MRL A;  3BFP A;  1G95 A;  3GVD A;  5E3R A;  5L6V A;  3R5C A;  3Q1X A;  2QIA A;  3FOQ A;  3TV0 A;  3C8V A;  1YP4 A;  2XAT A;  1KRV A;  3OUP A;  2NPO A;  3FSB A;  4M9C A;  3VNP A;  1G97 A;  4G3P A;  3SPT A;  3I3A A;  4KPZ A;  5F42 A;  3TDT A;  3EH0 A;  1Z90 A;  5DEP A;  4N27 A;  1QRE A;  4AAW A;  4MZU A;  1S80 A;  1KK5 A;  3VBN A;  3IXC A;  4EQY A;  2WLG A;  4IHH A;  5AFU U;  4EAB A;  1KQA A;  4HZD A;  4EA9 A;  3D8V A;  2IU8 A;  2FKO A;  3MQG A;  3BXY A;  4M98 A;  1XHD A;  5U2K A;  4IHG A;  1QQ0 A;  1YP2 A;  2V0J A;  3DHO A;  1TDT A;  2IU9 A;  3R3R A;  1MR7 A;  5L6S A;  3MQH A;  3KWC A;  2ICY A;  1SSM A;  5DG3 A;  1V3W A;  2GGO A;  4MYO A;  2W0W A;  3FTT A;  1KRR A;  3NZ2 A;  3R5A A;  5ADX V;  4KPX A;  1HM9 A;  1KGQ A;  1FXJ A;  4N69 A;  4EAA A;  4EA7 A;  3T57 A;  3FSX A;  1HM0 A;  4IHF A;  2IUA A;  4HZC A;  3FS8 A;  4R7P A;  1KHR A;  2IC7 A;  2W0V A;  2WLD A;  1SSQ A;  1FWY A;  2TDT A;  4E75 A;  1YP3 A;  3R0S A;  1SST A;  2WLC A;  3BSS A;  3I3X A;  1KK6 A;  2QIV X;  3R2W A;  4MFG A;  4N6B A;  3VBM A;  4EA8 A;  4ISX A;  3F1X A;  4M28 A;  3GOS A;  4EGG A;  3D98 A;  1KGT A;  4AA7 A;  4E6U A;  1KK4 A;  2AQ9 A;  3OTM A;  1LXA A;  4R37 A;  2JF2 A;  3FWW A;  2VD4 A;  3JQY A;  3MC4 A;  2I5K A;  2WLE A;  5ADX U;  4KQL A;  4E6T A;  2Q4J A;  4KNR A;  3ST8 A;  1THJ A;  3CJ8 A;  3ECT A;  3HJJ A;  3EEV A;  4G87 A;  1QRG A;  1T3D A;  2GGQ A;  2VHE A;  3R5B A;  4G3Q A;  3VBK A;  2P2O A;  3KWD A;  2QKX A;  3P47 A;  3GUE A;  3IGJ A;  3PMO A;  4N6A A;  4M99 A;  5E3Q A;  3EG4 A;  3HSQ A;  2JF3 A;  4E79 A;  4HCQ A;  3FSC A;  3FSY A;  4K6R A;  3BSY A;  3BSW A;  3TWD A;  4J09 A;  3TK8 A;  4FCE A;  3TIS A;  1HV9 A;  3VBI A;  4M2A A;  2OEF A;  4HUS A;  1OCX A;  2ICX A;  1QRL A;  4AC3 A;  2V0H A;  1J2Z A;  3SRT A;  3VBP A;  3OW5 A;  3VBJ A;  2OI6 A;  3DK5 A;  3P1B A;  5E3P A;  4E1K A;  4HUR A;  1KRU A;  3OTZ A;  5AFU V;  3DJ4 A;  3R8Y A;  2OI5 A;  1XAT A;  3R5D A;  3R3I A;  4G3S A;  3VBL A;  1QRF A;  2OEG A;  2V0L A;  3OU9 A;  2WLF A;  3R1W A;  4J18 A;  4M2B A;  3TIO A;  3V4E A;  4DCL A;  1MR9 A;  3KWE A;  1QRM A;  1V67 A;  2OI7 A; 
#chains in the Genus database with same CATH topology
 3BRK X;  4H7O A;  1HM8 A;  2V0K A;  2V0I A;  5DEM A;  4R36 A;  4KNX A;  2RIJ A;  1MRL A;  3BFP A;  1G95 A;  3GVD A;  5E3R A;  5L6V A;  3R5C A;  3Q1X A;  2QIA A;  3FOQ A;  3TV0 A;  3C8V A;  1YP4 A;  2XAT A;  1KRV A;  3OUP A;  2NPO A;  3FSB A;  4M9C A;  3VNP A;  1G97 A;  4G3P A;  3SPT A;  3I3A A;  4KPZ A;  5F42 A;  3TDT A;  3EH0 A;  1Z90 A;  5DEP A;  4N27 A;  1QRE A;  4AAW A;  4MZU A;  1S80 A;  1KK5 A;  3VBN A;  3OH2 A;  3IXC A;  4EQY A;  2WLG A;  4IHH A;  5AFU U;  4EAB A;  1KQA A;  4HZD A;  4EA9 A;  3D8V A;  2IU8 A;  2FKO A;  3GQ7 A;  3MQG A;  3BXY A;  4M98 A;  1XHD A;  1L0S A;  5U2K A;  4IHG A;  1QQ0 A;  1YP2 A;  2V0J A;  3DHO A;  1TDT A;  2IU9 A;  3R3R A;  1MR7 A;  5L6S A;  3MQH A;  3KWC A;  2ICY A;  1SSM A;  5DG3 A;  1V3W A;  2GGO A;  4MYO A;  2W0W A;  3FTT A;  1KRR A;  3NZ2 A;  3R5A A;  5ADX V;  4KPX A;  3OH3 A;  1HM9 A;  1KGQ A;  1FXJ A;  4N69 A;  4EAA A;  4EA7 A;  3T57 A;  3FSX A;  1HM0 A;  4IHF A;  2IUA A;  4HZC A;  3FS8 A;  4R7P A;  1KHR A;  2IC7 A;  2W0V A;  2WLD A;  1Z2F A;  1SSQ A;  1FWY A;  2TDT A;  4E75 A;  1YP3 A;  3R0S A;  1SST A;  2WLC A;  3BSS A;  3I3X A;  1KK6 A;  2QIV X;  3R2W A;  4MFG A;  4N6B A;  3SUC A;  3VBM A;  4ISX A;  3F1X A;  4M28 A;  3GOS A;  4EA8 A;  4EGG A;  3D98 A;  1KGT A;  4AA7 A;  4E6U A;  3OH4 A;  1KK4 A;  2AQ9 A;  3OTM A;  1LXA A;  3GQ9 A;  4R37 A;  2JF2 A;  3FWW A;  2VD4 A;  3JQY A;  3MC4 A;  2I5K A;  2WLE A;  5ADX U;  4KQL A;  4E6T A;  2Q4J A;  4KNR A;  3ST8 A;  1THJ A;  3CJ8 A;  3ECT A;  3HJJ A;  3EEV A;  4G87 A;  1QRG A;  1T3D A;  2GGQ A;  2VHE A;  3R5B A;  4G3Q A;  3VBK A;  2P2O A;  3KWD A;  2QKX A;  3P47 A;  3GUE A;  3IGJ A;  3PMO A;  4N6A A;  4M99 A;  5E3Q A;  3EG4 A;  3HSQ A;  3GQ8 A;  2JF3 A;  4E79 A;  4HCQ A;  3FSC A;  3FSY A;  4K6R A;  3BSY A;  3BSW A;  1EWW A;  1M8N A;  3GQA A;  3TWD A;  4J09 A;  3TK8 A;  4FCE A;  3TIS A;  1HV9 A;  3VBI A;  4M2A A;  2OEF A;  4HUS A;  1OCX A;  2ICX A;  1N4I A;  1QRL A;  2V0H A;  1J2Z A;  4AC3 A;  3SRT A;  3VBP A;  3OH1 A;  3OW5 A;  3VBJ A;  2OI6 A;  3DK5 A;  3P1B A;  5E3P A;  4E1K A;  4HUR A;  1KRU A;  3OTZ A;  5AFU V;  3DJ4 A;  3R8Y A;  2OI5 A;  4DCL A;  1XAT A;  3R5D A;  3R3I A;  4G3S A;  3VBL A;  1QRF A;  2OEG A;  2V0L A;  3OGZ A;  2WLF A;  3OU9 A;  3R1W A;  4J18 A;  4M2B A;  3OH0 A;  3TIO A;  1MR9 A;  3KWE A;  3V4E A;  1QRM A;  1V67 A;  2OI7 A; 
#chains in the Genus database with same CATH homology
 3BRK X;  4H7O A;  1HM8 A;  2V0K A;  2V0I A;  5DEM A;  4R36 A;  4KNX A;  2RIJ A;  1MRL A;  3BFP A;  1G95 A;  3GVD A;  5E3R A;  5L6V A;  3R5C A;  3Q1X A;  2QIA A;  3FOQ A;  3TV0 A;  3C8V A;  1YP4 A;  2XAT A;  1KRV A;  3OUP A;  2NPO A;  3FSB A;  4M9C A;  3VNP A;  1G97 A;  4G3P A;  3SPT A;  3I3A A;  4KPZ A;  5F42 A;  3TDT A;  3EH0 A;  1Z90 A;  5DEP A;  4N27 A;  1QRE A;  4AAW A;  4MZU A;  1S80 A;  1KK5 A;  3VBN A;  3IXC A;  4EQY A;  2WLG A;  4IHH A;  5AFU U;  4EAB A;  1KQA A;  4HZD A;  4EA9 A;  3D8V A;  2IU8 A;  2FKO A;  3MQG A;  3BXY A;  4M98 A;  1XHD A;  5U2K A;  4IHG A;  1QQ0 A;  1YP2 A;  2V0J A;  3DHO A;  1TDT A;  2IU9 A;  3R3R A;  1MR7 A;  5L6S A;  3MQH A;  3KWC A;  2ICY A;  1SSM A;  5DG3 A;  1V3W A;  2GGO A;  4MYO A;  2W0W A;  3FTT A;  1KRR A;  3NZ2 A;  3R5A A;  5ADX V;  4KPX A;  1HM9 A;  1KGQ A;  1FXJ A;  4N69 A;  4EAA A;  4EA7 A;  3T57 A;  3FSX A;  1HM0 A;  4IHF A;  2IUA A;  4HZC A;  3FS8 A;  4R7P A;  1KHR A;  2IC7 A;  2W0V A;  2WLD A;  1SSQ A;  1FWY A;  2TDT A;  4E75 A;  1YP3 A;  3R0S A;  1SST A;  2WLC A;  3BSS A;  3I3X A;  1KK6 A;  2QIV X;  3R2W A;  4MFG A;  4N6B A;  3VBM A;  4EA8 A;  4ISX A;  3F1X A;  4M28 A;  3GOS A;  4EGG A;  3D98 A;  1KGT A;  4AA7 A;  4E6U A;  1KK4 A;  2AQ9 A;  3OTM A;  1LXA A;  4R37 A;  2JF2 A;  3FWW A;  2VD4 A;  3JQY A;  3MC4 A;  2I5K A;  2WLE A;  5ADX U;  4KQL A;  4E6T A;  2Q4J A;  4KNR A;  3ST8 A;  1THJ A;  3CJ8 A;  3ECT A;  3HJJ A;  3EEV A;  4G87 A;  1QRG A;  1T3D A;  2GGQ A;  2VHE A;  3R5B A;  4G3Q A;  3VBK A;  2P2O A;  3KWD A;  2QKX A;  3P47 A;  3GUE A;  3IGJ A;  3PMO A;  4N6A A;  4M99 A;  5E3Q A;  3EG4 A;  3HSQ A;  2JF3 A;  4E79 A;  4HCQ A;  3FSC A;  3FSY A;  4K6R A;  3BSY A;  3BSW A;  3TWD A;  4J09 A;  3TK8 A;  4FCE A;  3TIS A;  1HV9 A;  3VBI A;  4M2A A;  2OEF A;  4HUS A;  1OCX A;  2ICX A;  1QRL A;  4AC3 A;  2V0H A;  1J2Z A;  3SRT A;  3VBP A;  3OW5 A;  3VBJ A;  2OI6 A;  3DK5 A;  3P1B A;  5E3P A;  4E1K A;  4HUR A;  1KRU A;  3OTZ A;  5AFU V;  3DJ4 A;  3R8Y A;  2OI5 A;  1XAT A;  3R5D A;  3R3I A;  4G3S A;  3VBL A;  1QRF A;  2OEG A;  2V0L A;  3OU9 A;  2WLF A;  3R1W A;  4J18 A;  4M2B A;  3TIO A;  3V4E A;  4DCL A;  1MR9 A;  3KWE A;  1QRM A;  1V67 A;  2OI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...