1L0SA

Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
87
Chain Sequence
SCTNTNSQLSANSKCEKSTLTNCVDKSEVFGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermal hysteresis protein
publication title Crystal structure of beta-helical antifreeze protein points to a general ice binding model.
pubmed doi rcsb
source organism Choristoneura fumiferana
molecule tags Antifreeze protein
total genus 35
structure length 87
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1l0sA00
1M8NA 3GQ9A 3GQAA 1Z2FA 3GQ8A 1EWWA 3GQ7A 1L0SA 3SUCA 1N4IA
chains in the Genus database with same CATH superfamily
4J09A 3SRTA 1HM9A 3TDTA 1V3WA 4AA7A 2NPOA 3GOSA 1QREA 2QIVX 2IU9A 3OGZA 5L6VA 4G3PA 4R36A 2QIAA 2W0VA 3CJ8A 4HUSA 1FXJA 1Z2FA 4MFGA 3T57A 1MRLA 1L0SA 1QRGA 2ICXA 1HV9A 5E3RA 1V67A 2GGQA 3R8YA 3TWDA 1MR9A 1HM8A 3C8VA 4M2BA 3P47A 3BRKX 3FSBA 4HZCA 3FTTA 2FKOA 4M98A 4N69A 3R5DA 2WLEA 3TIOA 5F42A 1KGTA 3BFPA 3BSSA 4AAWA 3FSCA 1SSMA 3JQYA 4M2AA 3VBNA 4N6BA 3VBJA 5ADXV 2OI7A 3DJ4A 3FSYA 4EA8A 4J18A 3EH0A 4E75A 1KK4A 2Q4JA 4G3QA 3R0SA 4E79A 3OH4A 3NZ2A 3VNPA 2OEFA 3KWCA 2V0KA 1THJA 3GQ8A 4MYOA 3IXCA 3OH2A 4EAAA 4KPXA 1N4IA 4M9CA 4EA7A 2WLDA 5E3PA 3EG4A 5AFUU 2OI5A 1QRLA 2WLFA 1KGQA 4E6TA 2I5KA 4HURA 2QKXA 3V4EA 1MR7A 4KNXA 1QQ0A 2V0HA 3R5BA 1OCXA 4IHFA 3VBLA 3GUEA 2V0LA 3VBKA 4HCQA 2OI6A 1S80A 2VHEA 2WLCA 4EA9A 3ECTA 3GQ9A 2XATA 3R3IA 3R5AA 2IU8A 3IGJA 3P1BA 4EQYA 3EEVA 4IHGA 3GQ7A 3OH1A 3R5CA 2VD4A 3BSWA 3VBMA 4AC3A 2P2OA 4DCLA 3GQAA 3HSQA 3I3AA 1HM0A 4HZDA 1EWWA 5DG3A 3BSYA 2AQ9A 4IHHA 4KPZA 2JF2A 1YP2A 3OW5A 4G3SA 2V0JA 1KQAA 3VBPA 2V0IA 3BXYA 1TDTA 3PMOA 3R3RA 3MC4A 3TK8A 1YP4A 3TISA 4EABA 3F1XA 1KHRA 1SSTA 3DHOA 1Z90A 1XHDA 5DEMA 3OH3A 3FOQA 4R7PA 1KRRA 1KRVA 1QRMA 3Q1XA 4N6AA 5U2KA 3KWDA 3I3XA 1QRFA 3D8VA 3TV0A 5E3QA 3OH0A 4R37A 4E1KA 4FCEA 2JF3A 4K6RA 1KK6A 2WLGA 5DEPA 1XATA 3OTZA 3OUPA 3SUCA 4H7OA 1T3DA 2RIJA 3SPTA 2GGOA 4G87A 3ST8A 2IC7A 1SSQA 3DK5A 1LXAA 3OU9A 4EGGA 2IUAA 1KK5A 2OEGA 4E6UA 1M8NA 4N27A 2TDTA 4KQLA 1G97A 3MQHA 3FS8A 3VBIA 3FSXA 2W0WA 1YP3A 3KWEA 3HJJA 3MQGA 3GVDA 3OTMA 4KNRA 4M99A 1KRUA 4MZUA 5AFUV 3FWWA 1G95A 3D98A 4ISXA 1FWYA 3R2WA 5ADXU 4M28A 5L6SA 3R1WA 1J2ZA 2ICYA
chains in the Genus database with same CATH topology
1M8NA 3GQ9A 1EZGA 3GQAA 1Z2FA 3GQ8A 1EWWA 3GQ7A 1L0SA 3SUCA 1N4IA 1L1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8N A;  3GQ9 A;  3GQA A;  1Z2F A;  3GQ8 A;  1EWW A;  3GQ7 A;  1L0S A;  3SUC A;  1N4I A; 
#chains in the Genus database with same CATH topology
 4J09 A;  3SRT A;  1HM9 A;  3TDT A;  1V3W A;  4AA7 A;  2NPO A;  3GOS A;  1QRE A;  2QIV X;  2IU9 A;  3OGZ A;  5L6V A;  4G3P A;  4R36 A;  2QIA A;  2W0V A;  3CJ8 A;  4HUS A;  1FXJ A;  1Z2F A;  4MFG A;  3T57 A;  1MRL A;  1L0S A;  1QRG A;  2ICX A;  1HV9 A;  5E3R A;  1V67 A;  2GGQ A;  3R8Y A;  3TWD A;  1MR9 A;  1HM8 A;  3C8V A;  4M2B A;  3P47 A;  3BRK X;  3FSB A;  4HZC A;  3FTT A;  2FKO A;  4M98 A;  4N69 A;  3R5D A;  2WLE A;  3TIO A;  5F42 A;  1KGT A;  3BFP A;  3BSS A;  4AAW A;  3FSC A;  1SSM A;  3JQY A;  4M2A A;  3VBN A;  4N6B A;  3VBJ A;  5ADX V;  2OI7 A;  3DJ4 A;  3FSY A;  4EA8 A;  4J18 A;  3EH0 A;  4E75 A;  1KK4 A;  2Q4J A;  4G3Q A;  3R0S A;  4E79 A;  3OH4 A;  3NZ2 A;  3VNP A;  2OEF A;  3KWC A;  2V0K A;  1THJ A;  3GQ8 A;  4MYO A;  3IXC A;  3OH2 A;  4EAA A;  4KPX A;  1N4I A;  4M9C A;  4EA7 A;  2WLD A;  5E3P A;  3EG4 A;  5AFU U;  2OI5 A;  1QRL A;  2WLF A;  1KGQ A;  4E6T A;  2I5K A;  4HUR A;  2QKX A;  3V4E A;  1MR7 A;  4KNX A;  1QQ0 A;  2V0H A;  3R5B A;  1OCX A;  4IHF A;  3VBL A;  3GUE A;  2V0L A;  3VBK A;  4HCQ A;  2OI6 A;  1S80 A;  2VHE A;  2WLC A;  4EA9 A;  3ECT A;  3GQ9 A;  2XAT A;  3R3I A;  3R5A A;  2IU8 A;  3IGJ A;  3P1B A;  4EQY A;  3EEV A;  4IHG A;  3GQ7 A;  3OH1 A;  3R5C A;  2VD4 A;  3BSW A;  3VBM A;  4AC3 A;  2P2O A;  4DCL A;  3GQA A;  3HSQ A;  3I3A A;  1HM0 A;  4HZD A;  1EWW A;  5DG3 A;  3BSY A;  2AQ9 A;  4IHH A;  4KPZ A;  2JF2 A;  1YP2 A;  3OW5 A;  4G3S A;  2V0J A;  1KQA A;  3VBP A;  2V0I A;  3BXY A;  1TDT A;  3PMO A;  3R3R A;  3MC4 A;  3TK8 A;  1YP4 A;  3TIS A;  4EAB A;  3F1X A;  1KHR A;  1SST A;  3DHO A;  1Z90 A;  1XHD A;  5DEM A;  3OH3 A;  3FOQ A;  4R7P A;  1KRR A;  1KRV A;  1QRM A;  3Q1X A;  4N6A A;  5U2K A;  3KWD A;  3I3X A;  1QRF A;  3D8V A;  3TV0 A;  5E3Q A;  3OH0 A;  4R37 A;  4E1K A;  4FCE A;  2JF3 A;  4K6R A;  1KK6 A;  2WLG A;  5DEP A;  1XAT A;  3OTZ A;  3OUP A;  3SUC A;  4H7O A;  1T3D A;  2RIJ A;  3SPT A;  2GGO A;  4G87 A;  3ST8 A;  2IC7 A;  1SSQ A;  3DK5 A;  1LXA A;  3OU9 A;  4EGG A;  2IUA A;  1KK5 A;  2OEG A;  4E6U A;  1M8N A;  4N27 A;  2TDT A;  4KQL A;  1G97 A;  3MQH A;  3FS8 A;  3VBI A;  3FSX A;  2W0W A;  1YP3 A;  3KWE A;  3HJJ A;  3MQG A;  3GVD A;  3OTM A;  4KNR A;  4M99 A;  1KRU A;  4MZU A;  5AFU V;  3FWW A;  1G95 A;  3D98 A;  4ISX A;  1FWY A;  3R2W A;  5ADX U;  4M28 A;  5L6S A;  3R1W A;  1J2Z A;  2ICY A; 
#chains in the Genus database with same CATH homology
 1M8N A;  3GQ9 A;  1EZG A;  3GQA A;  1Z2F A;  3GQ8 A;  1EWW A;  3GQ7 A;  1L0S A;  3SUC A;  1N4I A;  1L1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...