1L0SA

Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
87
Chain Sequence
SCTNTNSQLSANSKCEKSTLTNCVDKSEVFGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords thermal hysteresis protein
publication title Crystal structure of beta-helical antifreeze protein points to a general ice binding model.
pubmed doi rcsb
source organism Choristoneura fumiferana
total genus 35
structure length 87
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1l0sA00
3GQAA 1Z2FA 1M8NA 3SUCA 1L0SA 1EWWA 1N4IA 3GQ7A 3GQ9A 3GQ8A
chains in the Genus database with same CATH superfamily
1YP4A 5L6SA 3SUCA 3I3XA 4EABA 2XATA 1THJA 3R3IA 3JQYA 3TK8A 4J09A 1EWWA 3R2WA 1N4IA 3BFPA 2V0IA 4HZCA 3MQGA 4G3QA 2IC7A 1SSMA 3EG4A 3OTMA 3Q1XA 1L0SA 4N27A 3MC4A 3R5BA 4FCEA 4M99A 1OCXA 3C8VA 4KPZA 4IHGA 3R1WA 4KPXA 1KK6A 1TDTA 3R3RA 3V4EA 1T3DA 2QIVX 1KGQA 3GQ9A 3D98A 3OH4A 3VBNA 5AFUU 1G97A 2WLCA 5AFUV 3I3AA 3FSBA 1V3WA 2TDTA 3P1BA 3TDTA 4EA7A 5DEMA 3HSQA 3OH1A 1HM0A 1Z2FA 2QKXA 4R7PA 1XHDA 1YP2A 4M2AA 3NZ2A 4KNRA 3PMOA 4MYOA 3DHOA 2NPOA 2OEFA 5DG3A 1J2ZA 3ECTA 4ISXA 2QIAA 3R5CA 2VD4A 3VNPA 3FOQA 4AC3A 4R37A 3IGJA 3KWCA 2IU8A 4M28A 5DEPA 1QRMA 3FSYA 1G95A 1MR9A 2P2OA 2V0LA 3GOSA 2RIJA 3SPTA 3P47A 4K6RA 4AAWA 3FTTA 3BSSA 3KWDA 4KQLA 3R0SA 3OGZA 3BRKX 3FSCA 4E1KA 2ICYA 1KQAA 3VBKA 4E75A 3OUPA 3VBLA 4DCLA 5L6VA 1QREA 2VHEA 4HZDA 1KRRA 3FWWA 3GQ7A 4EA8A 2I5KA 1KRVA 4IHHA 3GQAA 1MRLA 1M8NA 1HM8A 4G87A 3BSYA 4HUSA 5E3QA 5U2KA 4KNXA 2V0JA 4N6BA 1KK5A 4E6UA 2OI7A 3GVDA 3OH2A 2FKOA 1KRUA 1XATA 2GGOA 2Q4JA 3CJ8A 3OU9A 1HM9A 3TIOA 3TWDA 4E6TA 3HJJA 3OTZA 2WLFA 3DK5A 1KK4A 3T57A 4J18A 2ICXA 3ST8A 3GUEA 4G3PA 4N69A 4HCQA 4EA9A 2W0VA 2OI5A 1KGTA 2OI6A 4M2BA 4MFGA 4H7OA 1S80A 2V0HA 1SSQA 3OH3A 5E3PA 1KHRA 2V0KA 4EAAA 3TV0A 1QRGA 4M9CA 3EEVA 2WLDA 5E3RA 4HURA 2WLEA 1HV9A 3R5AA 3FS8A 3TISA 5ADXU 3DJ4A 2WLGA 3KWEA 4AA7A 3R5DA 1QRLA 4EQYA 5ADXV 1QQ0A 3EH0A 4G3SA 3OW5A 4MZUA 1QRFA 3BXYA 3MQHA 1FXJA 4M98A 3IXCA 5F42A 3SRTA 3OH0A 2W0WA 1Z90A 4R36A 1SSTA 4EGGA 3D8VA 2IUAA 3VBPA 1MR7A 1FWYA 3VBJA 4E79A 3FSXA 2IU9A 2AQ9A 2JF3A 2OEGA 4IHFA 1LXAA 3R8YA 3VBMA 3F1XA 3BSWA 1V67A 3VBIA 2GGQA 3GQ8A 4N6AA 1YP3A 2JF2A
chains in the Genus database with same CATH topology
3GQAA 1Z2FA 1M8NA 3SUCA 1L0SA 1EWWA 1N4IA 3GQ7A 3GQ9A 1L1IA 3GQ8A 1EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQA A;  1Z2F A;  1M8N A;  3SUC A;  1L0S A;  1EWW A;  1N4I A;  3GQ7 A;  3GQ9 A;  3GQ8 A; 
#chains in the Genus database with same CATH topology
 1YP4 A;  5L6S A;  3SUC A;  3I3X A;  4EAB A;  2XAT A;  1THJ A;  3R3I A;  3JQY A;  3TK8 A;  4J09 A;  1EWW A;  3R2W A;  1N4I A;  3BFP A;  2V0I A;  4HZC A;  3MQG A;  4G3Q A;  2IC7 A;  1SSM A;  3EG4 A;  3OTM A;  3Q1X A;  1L0S A;  4N27 A;  3MC4 A;  3R5B A;  4FCE A;  4M99 A;  1OCX A;  3C8V A;  4KPZ A;  4IHG A;  3R1W A;  4KPX A;  1KK6 A;  1TDT A;  3R3R A;  3V4E A;  1T3D A;  2QIV X;  1KGQ A;  3GQ9 A;  3D98 A;  3OH4 A;  3VBN A;  5AFU U;  1G97 A;  2WLC A;  5AFU V;  3I3A A;  3FSB A;  1V3W A;  2TDT A;  3P1B A;  3TDT A;  4EA7 A;  5DEM A;  3HSQ A;  3OH1 A;  1HM0 A;  1Z2F A;  2QKX A;  4R7P A;  1XHD A;  1YP2 A;  4M2A A;  3NZ2 A;  4KNR A;  3PMO A;  4MYO A;  3DHO A;  2NPO A;  2OEF A;  5DG3 A;  1J2Z A;  3ECT A;  4ISX A;  2QIA A;  3R5C A;  2VD4 A;  3VNP A;  3FOQ A;  4AC3 A;  4R37 A;  3IGJ A;  3KWC A;  2IU8 A;  4M28 A;  5DEP A;  1QRM A;  3FSY A;  1G95 A;  1MR9 A;  2P2O A;  2V0L A;  3GOS A;  2RIJ A;  3SPT A;  3P47 A;  4K6R A;  4AAW A;  3FTT A;  3BSS A;  3KWD A;  4KQL A;  3R0S A;  3OGZ A;  3BRK X;  3FSC A;  4E1K A;  2ICY A;  1KQA A;  3VBK A;  4E75 A;  3OUP A;  3VBL A;  4DCL A;  5L6V A;  1QRE A;  2VHE A;  4HZD A;  1KRR A;  3FWW A;  3GQ7 A;  4EA8 A;  2I5K A;  1KRV A;  4IHH A;  3GQA A;  1MRL A;  1M8N A;  1HM8 A;  4G87 A;  3BSY A;  4HUS A;  5E3Q A;  5U2K A;  4KNX A;  2V0J A;  4N6B A;  1KK5 A;  4E6U A;  2OI7 A;  3GVD A;  3OH2 A;  2FKO A;  1KRU A;  1XAT A;  2GGO A;  2Q4J A;  3CJ8 A;  3OU9 A;  1HM9 A;  3TIO A;  3TWD A;  4E6T A;  3HJJ A;  3OTZ A;  2WLF A;  3DK5 A;  1KK4 A;  3T57 A;  4J18 A;  2ICX A;  3ST8 A;  3GUE A;  4G3P A;  4N69 A;  4HCQ A;  4EA9 A;  2W0V A;  2OI5 A;  1KGT A;  2OI6 A;  4M2B A;  4MFG A;  4H7O A;  1S80 A;  2V0H A;  1SSQ A;  3OH3 A;  5E3P A;  1KHR A;  2V0K A;  4EAA A;  3TV0 A;  1QRG A;  4M9C A;  3EEV A;  2WLD A;  5E3R A;  4HUR A;  2WLE A;  1HV9 A;  3R5A A;  3FS8 A;  3TIS A;  5ADX U;  3DJ4 A;  2WLG A;  3KWE A;  4AA7 A;  3R5D A;  1QRL A;  4EQY A;  5ADX V;  1QQ0 A;  3EH0 A;  4G3S A;  3OW5 A;  4MZU A;  1QRF A;  3BXY A;  3MQH A;  1FXJ A;  4M98 A;  3IXC A;  5F42 A;  3SRT A;  3OH0 A;  2W0W A;  1Z90 A;  4R36 A;  1SST A;  4EGG A;  3D8V A;  2IUA A;  3VBP A;  1MR7 A;  1FWY A;  3VBJ A;  4E79 A;  3FSX A;  2IU9 A;  2AQ9 A;  2JF3 A;  2OEG A;  4IHF A;  1LXA A;  3R8Y A;  3VBM A;  3F1X A;  3BSW A;  1V67 A;  3VBI A;  2GGQ A;  3GQ8 A;  4N6A A;  1YP3 A;  2JF2 A; 
#chains in the Genus database with same CATH homology
 3GQA A;  1Z2F A;  1M8N A;  3SUC A;  1L0S A;  1EWW A;  1N4I A;  3GQ7 A;  3GQ9 A;  1L1I A;  3GQ8 A;  1EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...