3DK5A

Crystal structure of apo-glmu from mycobacterium tuberculosis
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
469
structure length
442
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFYGRIVMAIVEVNAGVYAFDIAALRSALSRLSSNNQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 141
structure length 442
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dk5A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dk5A01
4AC3A 1VGUA 2V0JA 1H5TA 3I0IX 2VS4A 3OW5A 2VHEA 1R80A 5EJ1A 2GGQA 3OC9A 5CQPA 1G3LA 3SXGA 4HURA 3KWDA 5EJZA 4B3UA 5ADXV 5FU8A 5C36A 4M99A 1H5SC 4ISXA 2BO7A 3R5BA 3OTZA 1KRVA 2Y4JA 3SXCA 3TK8A 2APCA 1ZDFA 5FYEA 3TIOA 4E6UA 1JYLA 1YP2A 3VBNA 1SSTA 5C4CA 2V0HA 4MFGA 1KRRA 1ZJ1A 4B5BA 5AFUV 2JF3A 3ECTA 1QRFA 2A8WA 1SSQA 1VH1A 1H4EA 5I1FA 5FTVA 2RIXA 3R2WA 5E3RA 4FQWA 4FREA 2ZU9A 1GX0A 3POLA 1V67A 5C47A 4EEMA 1W55A 1QRMA 1JYKA 1H5SD 2WAWA 2CU2A 3DK5A 1H7TA 3TISA 1QWJA 1VPAA 4EA9A 1MR9A 3HSQA 3FS8A 2YCMA 1G0RA 5CQLX 1FO8A 3FOQA 3V0LA 4EA7A 3OH2A 4N69A 3F1YA 3R5CA 5C3AA 1R82A 2RJ4A 4EEOA 4E79A 3I0DA 2VXLA 2QIAA 2AQ9A 1KWSA 4R37A 1H7HA 3D5NA 2P2OA 1VZUA 1R7YA 3USRA 2AM3A 2V0LA 4ARWA 4EE4A 2JCJA 3FWWA 2MZBA 1THJA 1JV3A 1LL3A 3F1CA 3CGXA 3CKVA 3CKOA 4KT7A 1QG8A 4MZUA 1ON8A 2JCKA 1KK5A 4Y7FA 5L6VA 3P47A 4EAAA 1ON6A 1VZXA 3I0FA 2WLFA 3OH1A 4DCLA 4DDZA 1G23A 2E8BA 1PZYB 3BRKX 3R8YA 2XWMA 3P1BA 1JV1A 1QGSA 2AH9A 2YESA 4HZCA 1GWWA 5E3QA 1R7VA 5AJPA 1T3DA 2OEFA 2NXVA 4Y63A 1FGXA 3R0SA 4HO9A 4YS8A 1FRWA 2RIJA 4E75A 2RIYA 3BCVA 4N6BA 2V0IA 5FTSA 4NANA 3U2XA 1VH3A 4Y62A 1TW5A 4IRPA 4B4GA 1E5KA 3R3RA 3USQA 3VBLA 3FTTA 4HO0A 1GX4A 5C49A 1GWVA 4NAIA 5C3DA 4NALA 4HUSA 1H3MA 3R5DA 1H5RA 2OEGA 4N6AA 3OH0A 4B42A 4CJ8A 2W0VA 2NPOA 1NKHB 3Q80A 5IDTA 1G95A 4M2AA 2D0JA 2PGYA 2X60A 3KIAA 3JUJA 4B2WA 2QGIA 4AYJA 3SX7A 4ASJA 3D8VA 2RJ0A 4KPXA 4R36A 1QRLA 4H7OA 4FRHA 4C2SA 4FRQA 4BMAA 2RJ7A 5C3BA 2O1HA 4HO4A 3U2WA 1KRUA 2UX8A 4Y7GA 1FXJA 4R7PA 4G3PA 2Z87A 3EE5A 2VSIA 3SPTA 1XATA 4GBPA 1QRGA 4ECMA 2VSHA 3V8YA 3OH3A 5J49A 3OUPA 3TZTA 3VBIA 2VFZA 3I3AA 3V91A 1WT3A 5C4EA 1WSZA 1FGGA 3OTMA 4ASYA 1FR9A 4Y7VA 3SXEA 2AM5A 2WLEA 3NZ2A 2O1GA 2OI6A 5C1LA 3CKNA 1LL0A 2XWNA 5CQNX 3OGZA 2Y7AA 3I0LA 5CMFX 1ZI3A 2ICYA 3K8EA 4FRDA 1JVGA 2IU9A 3I3XA 2X5ZA 2FYBA 4B2XA 4KC4A 1V3WA 2ZU8A 1S4PA 1WVCA 2YQSA 1H5SB 1ZJOA 1SS9A 2QIVX 2D7RA 3VNPA 4KNRA 3I0EA 2A8UA 4P00A 2VD4A 1KQAA 4E1KA 1R81A 4HCQA 4EE3A 4IHGA 2P73A 2WLDA 3KWCA 3LW6A 4ZDQA 5C4DA 1ZJ0A 2JCOA 4EEGA 2FKOA 2WVMA 3PNNA 1LL2A 1HJJA 3DUVA 1SSMA 3I0GA 2WVKA 3K8DA 4D0TA 1WT2A 2RJ6A 4AYLA 4J09A 1G8OA 3DHOA 4IHHA 1VICA 1MP3A 3ZLLA 3CJ8A 3BSSA 4AA7A 1IINA 4Y6NA 2XMEA 2WVLA 5AJNA 2D7IA 3OH4A 1H7QA 1INJA 4D11A 3OAMA 4CJCA 1LXAA 3D98A 1FOAA 5F42A 4HO3A 5C4FA 1H7EA 3R3IA 2IU8A 1ZHJA 1FG5N 2VS5A 5CMJA 2WGZA 2PGVA 3IOIA 4M9CA 1J2ZA 1KK4A 1XZ6A 2E3DA 4DECA 1O7QA 1W77A 3E25A 1OMZA 4MYOA 3RMVA 4K6RA 3T57A 4HG6A 3V0OA 5U2KA 1WT0A 3Q4SA 4HO5A 4MYBA 2IUAA 3Q1XA 2BO4A 5ADXU 4IRQA 3EG4A 2IC7A 1VGTA 3MC4A 4HO2A 2W0WA 1NMMB 4XWIA 1R7XA 2V0KA 4B4BA 4FRBA 4HZDA 3MQHA 1ZIZA 3I0KA 1G97A 3T7NA 3R5AA 2VXMA 4DE7A 4M2BA 2RJ1A 3EH0A 1V83A 2P6WA 1LVWA 1LZ7A 4G87A 4FRAA 3T7OA 5AFUU 3MQGA 1ZJ3A 4AAWA 1ZCVA 4JD0A 5CMGX 2ICXA 5C8RA 3IXCA 3V8ZA 1ZJPA 3GOSA 2Y6PA 3ST8A 1S4NA 1KGQA 2XWLA 3KWEA 3V0MA 1TW1A 1ZJ2A 2YQHA 4UEGA 3U2VA 4IHFA 1WT1A 2ZU7A 5FUHA 1VZTA 1JVDA 1MP5A 3V0PA 3TQDA 3V90A 3TDTA 2AM4A 3NGWA 1XHBA 4G3QA 3IGJA 2YC5A 3FSXA 3FSCA 3GUEA 2AGDA 1KGTA 3N9WA 3PKQA 3Q7UA 2OI7A 4D48A 1H5RB 3U0YA 3SXDA 1MRLA 2WLGA 1MC3A 4EGGA 4CJBA 1K4VA 4E6TA 4KRVA 4M4KA 1YP4A 3VBMA 2QH5A 4KQLA 4KC2A 1LZ0A 5L6SA 2VS3A 5CQOA 1V82A 3V0NA 2I5KA 3HJJA 1O23B 3CU0A 4MNDA 1I52A 4FCEA 4FRMA 3I0HA 3U0XA 5IDSA 4B4MA 4Y7UA 3TWDA 2AESA 5EIYA 1IIMA 1ZCTA 4L41C 2X65A 1MR7A 1ZCUA 2DPWA 1NF5B 2FFVA 1H5TB 2FFUA 3DJ4A 2RITA 2RIZA 1R7TA 1HM9A 3SX3A 4FROA 1EZIA 4EA8A 4FRPA 5C38A 2Y4KA 1TZFA 4P02A 4Y7TA 1H5SA 3FSYA 3OU9A 4CVHA 1QQ0A 3U2UA 1VGWA 3E26A 4EE5A 5CMHA 3U2TA 1KHRA 5DEMA 1PZTA 3T7MA 2FYDB 2RJ5A 2GGOA 2FY7A 2WE9A 3JQYA 1V84A 3ZGFA 1ZI4A 1EYRA 2WLCA 4Y64A 5C1GA 3IOHA 4JISA 5HS2A 1KK6A 1FO9A 5DEPA 3PMOA 3OKRA 2YQJA 1QGQA 2I7BA 3SX5A 4LW6A 1HM0A 1W57A 1FWYA 2FYAA 1G93A 3HL3A 5FV9A 4N27A 3CKQA 1YP3A 5CMIA 4D11C 1Z90A 1INIA 5E3PA 5IFYA 2TDTA 1HV9A 3R1WA 2QKXA 2JF2A 3EEVA 1ZDGA 1MP4A 1LZIA 1ZCYA 1FZWA 2JCLA 1QREA 1S4OA 1H7GA 4KC1A 1YROB 1VM8A 4G3SA 1NHEB 1HJLA 4KXOA 2X5SA 2BO6A 3FSBA 1ZI1A 1ZI5A 5C4BA 1G1LA 1XHDA 3SXAA 5DG3A 3BSWA 1H7FA 2BO8A 1FXOA 1H7LA 2XATA 3RSBA 1TDTA 1FR8A 2PX7A 3JTJA 4FRLA 4Y6UA 3V0QA 4KNXA 4HO6A 3IOJA 1VGZA 3ZF8A 1G2VA 2FYCB 2AE7A 2P72A 4KPZA 3SXBA 2YC3A 3PKPA 1O0RA 4LW3A 4M28A 2YQCA 1NWGB 5C48A 1O7OA 3CKJA 2OI5A 2I5EA 5C1HA 5AJOA 3RMWA 4M98A 3I0CA 1OCXA 1H4DA 4J18A 3QVBA 3ZGGA 1H4CA 1OQMB 1GQCA 1R7UA 2RJ9A 3O3PA 4HO8A 3F1XA 3JUKA 4EVWA 5BXCA 3VBPA 4EQYA 1GA8A 3GVDA 4Y9XA 1GQ9A 4EEAA 1LZJA 2XMHA 5DDVA 2Z86A 2PA4A 5DDTA 3SRTA 4D0ZA 3BFPA 2AECA 4NAKA 3I0JA 3V4EA 1HM8A 1G9RA 2Y4LA 1OMXA 3BSYA 5JQQA 3BXYA 1TVYA 2Q4JA 4EABA 3SX8A 2Y4MA 3TV0A 5FU0A 2RJ8A 1NQIB 2WEEA 5CQMX 3C8VA 3VBKA 4FCUA 4HOCA 2O1FA 4BQHA 1S80A 3VBJA 3ZLKA
chains in the Genus database with same CATH superfamily
4AC3A 1VGUA 2V0JA 1H5TA 3I0IX 2VS4A 3OW5A 2VHEA 1R80A 5EJ1A 2GGQA 3OC9A 5CQPA 1G3LA 3SXGA 4HURA 3KWDA 5EJZA 4B3UA 5ADXV 5FU8A 5C36A 4M99A 1H5SC 4ISXA 2BO7A 3R5BA 3OTZA 1KRVA 2Y4JA 3SXCA 3TK8A 2APCA 1ZDFA 5FYEA 3TIOA 4E6UA 1JYLA 1YP2A 3VBNA 1SSTA 5C4CA 2V0HA 4MFGA 1KRRA 1ZJ1A 4B5BA 5AFUV 2JF3A 3ECTA 1QRFA 2A8WA 1SSQA 1VH1A 1H4EA 5I1FA 5FTVA 2RIXA 3R2WA 5E3RA 4FQWA 4FREA 2ZU9A 1GX0A 3POLA 1V67A 5C47A 4EEMA 1W55A 1QRMA 1JYKA 1H5SD 2WAWA 2CU2A 3DK5A 1H7TA 3TISA 1QWJA 1VPAA 4EA9A 1MR9A 3HSQA 3FS8A 2YCMA 1G0RA 5CQLX 1FO8A 3FOQA 3V0LA 4EA7A 3OH2A 4N69A 3F1YA 3R5CA 5C3AA 1R82A 2RJ4A 4EEOA 4E79A 3I0DA 2VXLA 2QIAA 5D92A 2AQ9A 1KWSA 4R37A 1H7HA 3D5NA 2P2OA 1VZUA 1R7YA 3USRA 2AM3A 2V0LA 4ARWA 4EE4A 2JCJA 3FWWA 2MZBA 1THJA 1JV3A 1LL3A 3F1CA 3CGXA 3CKVA 3CKOA 4KT7A 1QG8A 4MZUA 1ON8A 2JCKA 1KK5A 4Y7FA 5L6VA 3P47A 4EAAA 1ON6A 1VZXA 3I0FA 2WLFA 3OH1A 4DCLA 4DDZA 1G23A 2E8BA 1PZYB 3BRKX 3R8YA 2XWMA 3P1BA 1JV1A 1QGSA 2AH9A 2YESA 4HZCA 1GWWA 5E3QA 1R7VA 5AJPA 1T3DA 2OEFA 2NXVA 4Y63A 1FGXA 3R0SA 4HO9A 4YS8A 1FRWA 2RIJA 4E75A 2RIYA 3BCVA 4N6BA 2V0IA 5FTSA 4NANA 3U2XA 1VH3A 4Y62A 1TW5A 4IRPA 4B4GA 1E5KA 3R3RA 3USQA 3VBLA 3FTTA 4HO0A 1GX4A 5C49A 1GWVA 4NAIA 5C3DA 4NALA 4HUSA 1H3MA 3R5DA 1H5RA 2OEGA 3OH0A 4N6AA 4B42A 4CJ8A 2W0VA 2NPOA 1NKHB 3Q80A 5IDTA 1G95A 4M2AA 2D0JA 2PGYA 4O6MA 2X60A 3KIAA 3JUJA 4B2WA 2QGIA 4AYJA 3SX7A 4ASJA 3D8VA 2RJ0A 4KPXA 4R36A 2C0NA 1QRLA 4H7OA 4FRHA 4C2SA 4FRQA 4BMAA 2RJ7A 5C3BA 2O1HA 4HO4A 3U2WA 1KRUA 2UX8A 4Y7GA 1FXJA 4R7PA 4G3PA 2Z87A 3EE5A 2VSIA 3SPTA 1XATA 4GBPA 1QRGA 2VK9A 4ECMA 2VSHA 3V8YA 3OH3A 5J49A 2J0BA 3OUPA 3TZTA 3VBIA 2VFZA 3I3AA 3V91A 1WT3A 5C4EA 1WSZA 1FGGA 3OTMA 4ASYA 1FR9A 4Y7VA 3SXEA 2AM5A 2WLEA 3NZ2A 2O1GA 2OI6A 5C1LA 3CKNA 1LL0A 2XWNA 5CQNX 3OGZA 4O6NA 2Y7AA 3I0LA 5CMFX 1ZI3A 2ICYA 3K8EA 4FRDA 1JVGA 2IU9A 3I3XA 2X5ZA 2FYBA 4B2XA 4KC4A 1V3WA 2ZU8A 1S4PA 1WVCA 1EWWA 2YQSA 1H5SB 1ZJOA 1SS9A 2QIVX 2D7RA 3VNPA 4KNRA 3I0EA 2A8UA 4P00A 2VD4A 1KQAA 4E1KA 1R81A 4HCQA 4EE3A 4IHGA 2P73A 2WLDA 3KWCA 3LW6A 4ZDQA 5C4DA 1ZJ0A 2JCOA 4EEGA 2FKOA 2WVMA 3PNNA 1LL2A 1HJJA 3DUVA 1SSMA 3I0GA 2WVKA 3K8DA 4D0TA 1WT2A 2RJ6A 4AYLA 4J09A 1G8OA 3DHOA 4IHHA 1VICA 1MP3A 3ZLLA 3CJ8A 3BSSA 4AA7A 1IINA 4Y6NA 2XMEA 2WVLA 5AJNA 2D7IA 3OH4A 1H7QA 1INJA 4D11A 3OAMA 1N4IA 4CJCA 1LXAA 3D98A 1FOAA 5F42A 4HO3A 5C4FA 1H7EA 3R3IA 2IU8A 1ZHJA 1FG5N 2VS5A 5CMJA 2WGZA 2PGVA 3IOIA 4M9CA 1J2ZA 1KK4A 1XZ6A 2E3DA 4DECA 1O7QA 1W77A 3E25A 1OMZA 4MYOA 3RMVA 4K6RA 3T57A 4HG6A 3V0OA 5U2KA 1WT0A 3Q4SA 4HO5A 4MYBA 1M8NA 2IUAA 3Q1XA 2BO4A 5ADXU 4IRQA 3EG4A 2IC7A 1VGTA 3MC4A 4FIYA 4HO2A 2W0WA 1NMMB 4XWIA 1Z2FA 1R7XA 2V0KA 4B4BA 4FRBA 4HZDA 3MQHA 1ZIZA 3I0KA 1G97A 3T7NA 3R5AA 2VXMA 4DE7A 2J0AA 4M2BA 2RJ1A 3EH0A 1V83A 2P6WA 1LVWA 1LZ7A 4G87A 4FRAA 3T7OA 5AFUU 3MQGA 1ZJ3A 5D91A 4AAWA 1ZCVA 4JD0A 5CMGX 2ICXA 5C8RA 3IXCA 3V8ZA 1ZJPA 3GOSA 2Y6PA 3ST8A 1S4NA 1KGQA 2XWLA 3KWEA 3V0MA 1TW1A 1ZJ2A 2YQHA 4UEGA 3U2VA 4IHFA 1WT1A 2ZU7A 5FUHA 1VZTA 1JVDA 1MP5A 3V0PA 3TQDA 3V90A 3TDTA 2AM4A 3NGWA 1XHBA 4G3QA 3IGJA 2YC5A 3FSXA 3FSCA 3GUEA 2AGDA 1KGTA 3N9WA 3PKQA 3Q7UA 2OI7A 4D48A 1H5RB 3U0YA 3SXDA 1MRLA 3GQAA 2WLGA 1MC3A 4EGGA 4CJBA 1K4VA 4E6TA 4KRVA 4M4KA 1YP4A 3VBMA 2QH5A 4KQLA 4KC2A 1LZ0A 5L6SA 2VS3A 5CQOA 1V82A 3V0NA 2I5KA 3HJJA 1O23B 3CU0A 4MNDA 1I52A 4FCEA 4FRMA 3I0HA 3U0XA 4Q7CA 5IDSA 4B4MA 4Y7UA 3TWDA 2AESA 5EIYA 1IIMA 1ZCTA 4L41C 2X65A 1MR7A 1ZCUA 2DPWA 1NF5B 2FFVA 1H5TB 2FFUA 3DJ4A 2RITA 2RIZA 1R7TA 1HM9A 3SX3A 4FROA 1EZIA 4EA8A 4FRPA 5C38A 2Y4KA 1TZFA 4P02A 4Y7TA 1H5SA 3FSYA 3OU9A 4CVHA 1QQ0A 3U2UA 1VGWA 3E26A 4EE5A 5CMHA 3U2TA 1KHRA 5DEMA 1PZTA 3T7MA 2FYDB 2RJ5A 2GGOA 2FY7A 2WE9A 3JQYA 1V84A 3ZGFA 1ZI4A 1EYRA 2WLCA 4Y64A 5C1GA 3IOHA 4JISA 5HS2A 1KK6A 1FO9A 5DEPA 3PMOA 3OKRA 2YQJA 1QGQA 2I7BA 3SX5A 4LW6A 1HM0A 1W57A 1FWYA 2FYAA 3GQ8A 1G93A 3HL3A 5FV9A 4N27A 4FIXA 3CKQA 1YP3A 5CMIA 4D11C 1Z90A 1INIA 5E3PA 5IFYA 2TDTA 1HV9A 3R1WA 2QKXA 2JF2A 3EEVA 1ZDGA 1MP4A 1LZIA 1ZCYA 1FZWA 2JCLA 1QREA 1S4OA 1H7GA 4KC1A 1YROB 1VM8A 4G3SA 1NHEB 1HJLA 4KXOA 2X5SA 2BO6A 3FSBA 1ZI1A 1ZI5A 5C4BA 1G1LA 1XHDA 3SXAA 5DG3A 3BSWA 1H7FA 2BO8A 1FXOA 1H7LA 2XATA 3RSBA 1TDTA 4MIXA 1FR8A 2PX7A 3JTJA 3GQ7A 3SUCA 4FRLA 4Y6UA 3V0QA 4KNXA 4HO6A 3IOJA 1VGZA 3ZF8A 1G2VA 2FYCB 2AE7A 2P72A 4KPZA 3SXBA 2YC3A 3PKPA 1O0RA 4LW3A 4M28A 2YQCA 1NWGB 5C48A 1O7OA 3GQ9A 1L0SA 2OI5A 2I5EA 3CKJA 5C1HA 5AJOA 3RMWA 4M98A 3I0CA 1OCXA 1H4DA 4J18A 3QVBA 3ZGGA 1H4CA 1OQMB 1GQCA 1R7UA 2RJ9A 3O3PA 4HO8A 3F1XA 3JUKA 4EVWA 5BXCA 3VBPA 4EQYA 1GA8A 3GVDA 4Y9XA 1GQ9A 4EEAA 1LZJA 2XMHA 5DDVA 2Z86A 2PA4A 5DDTA 3SRTA 4D0ZA 3BFPA 2AECA 4NAKA 3I0JA 3V4EA 1HM8A 1G9RA 2Y4LA 1OMXA 3BSYA 5JQQA 3BXYA 1TVYA 2Q4JA 4EABA 3SX8A 2Y4MA 3TV0A 5FU0A 2RJ8A 1NQIB 2WEEA 5CQMX 3C8VA 3VBKA 4FCUA 4HOCA 2O1FA 4BQHA 1S80A 3VBJA 3ZLKA
chains in the Genus database with same CATH topology
4AC3A 1VGUA 2V0JA 1H5TA 3I0IX 2VS4A 3OW5A 2VHEA 1R80A 5EJ1A 2GGQA 3OC9A 5CQPA 1G3LA 3SXGA 4HURA 3KWDA 5EJZA 4B3UA 5ADXV 5FU8A 5C36A 4M99A 1H5SC 4ISXA 2BO7A 3R5BA 3OTZA 1KRVA 2Y4JA 3SXCA 3TK8A 2APCA 1ZDFA 5FYEA 3TIOA 4E6UA 1JYLA 1YP2A 3VBNA 1SSTA 5C4CA 2V0HA 4MFGA 1KRRA 1ZJ1A 4B5BA 5AFUV 2JF3A 3ECTA 1QRFA 2A8WA 1SSQA 1VH1A 1H4EA 5I1FA 5FTVA 2RIXA 3R2WA 5E3RA 4FQWA 4FREA 2ZU9A 1GX0A 3POLA 1V67A 5C47A 4EEMA 1W55A 1QRMA 1JYKA 1H5SD 2WAWA 2CU2A 3DK5A 1H7TA 3TISA 1QWJA 1VPAA 4EA9A 1MR9A 3HSQA 3FS8A 2YCMA 1G0RA 5CQLX 1FO8A 3FOQA 3V0LA 4EA7A 3OH2A 4N69A 3F1YA 3R5CA 5C3AA 1R82A 2RJ4A 4EEOA 4E79A 3I0DA 2VXLA 2QIAA 5D92A 2AQ9A 1KWSA 4R37A 1H7HA 3D5NA 2P2OA 1VZUA 1R7YA 3USRA 2AM3A 2V0LA 4ARWA 4EE4A 2JCJA 3FWWA 2MZBA 1THJA 1JV3A 1LL3A 3F1CA 3CGXA 3CKVA 3CKOA 4KT7A 1QG8A 4MZUA 1ON8A 2JCKA 1KK5A 4Y7FA 5L6VA 3P47A 4EAAA 1ON6A 1VZXA 3I0FA 2WLFA 3OH1A 4DCLA 4DDZA 1G23A 2E8BA 1PZYB 3BRKX 3R8YA 2XWMA 3P1BA 1JV1A 1QGSA 2AH9A 2YESA 4HZCA 1GWWA 5E3QA 1R7VA 5AJPA 1T3DA 2OEFA 2NXVA 4Y63A 1FGXA 3R0SA 4HO9A 4YS8A 1FRWA 2RIJA 4E75A 2RIYA 3BCVA 4N6BA 2V0IA 5FTSA 4NANA 3U2XA 1VH3A 4Y62A 1TW5A 4IRPA 4B4GA 1E5KA 3R3RA 3USQA 3VBLA 3FTTA 4HO0A 1GX4A 5C49A 1GWVA 4NAIA 5C3DA 4NALA 4HUSA 1H3MA 3R5DA 1H5RA 2OEGA 4N6AA 3OH0A 4B42A 4CJ8A 2W0VA 2NPOA 1NKHB 3Q80A 5IDTA 1G95A 4M2AA 2D0JA 2PGYA 4O6MA 2X60A 3KIAA 3JUJA 4B2WA 2QGIA 4AYJA 3SX7A 4ASJA 3D8VA 2RJ0A 4KPXA 4R36A 2C0NA 1QRLA 4H7OA 4FRHA 4C2SA 4FRQA 4BMAA 2RJ7A 5C3BA 2O1HA 4HO4A 3U2WA 1KRUA 2UX8A 4Y7GA 1FXJA 4R7PA 4G3PA 2Z87A 3EE5A 2VSIA 3SPTA 1XATA 4GBPA 1QRGA 2VK9A 4ECMA 2VSHA 3V8YA 3OH3A 5J49A 2J0BA 3OUPA 3TZTA 3VBIA 2VFZA 3I3AA 3V91A 1WT3A 5C4EA 1WSZA 1FGGA 3OTMA 4ASYA 1FR9A 4Y7VA 3SXEA 2AM5A 2WLEA 3NZ2A 2O1GA 2OI6A 5C1LA 3CKNA 1LL0A 2XWNA 5CQNX 3OGZA 4O6NA 2Y7AA 3I0LA 5CMFX 1ZI3A 2ICYA 3K8EA 4FRDA 1JVGA 2IU9A 3I3XA 2X5ZA 2FYBA 4B2XA 4KC4A 1V3WA 2ZU8A 1S4PA 1WVCA 2YQSA 1H5SB 1ZJOA 1SS9A 2QIVX 2D7RA 3VNPA 4KNRA 3I0EA 2A8UA 4P00A 2VD4A 1KQAA 4E1KA 1R81A 4HCQA 4EE3A 4IHGA 2P73A 2WLDA 3KWCA 3LW6A 4ZDQA 5C4DA 1ZJ0A 2JCOA 4EEGA 2FKOA 2WVMA 3PNNA 1LL2A 1HJJA 3DUVA 1SSMA 3I0GA 2WVKA 3K8DA 4D0TA 1WT2A 2RJ6A 4AYLA 4J09A 1G8OA 3DHOA 4IHHA 1VICA 1MP3A 3ZLLA 3CJ8A 3BSSA 4AA7A 1IINA 4Y6NA 2XMEA 2WVLA 5AJNA 2D7IA 3OH4A 1H7QA 1INJA 4D11A 3OAMA 4CJCA 1LXAA 3D98A 1FOAA 5F42A 4HO3A 5C4FA 1H7EA 3R3IA 2IU8A 1ZHJA 1FG5N 2VS5A 5CMJA 2WGZA 2PGVA 3IOIA 4M9CA 1J2ZA 1KK4A 1XZ6A 2E3DA 4DECA 1O7QA 1W77A 3E25A 1OMZA 4MYOA 3RMVA 4K6RA 3T57A 4HG6A 3V0OA 5U2KA 1WT0A 3Q4SA 4HO5A 4MYBA 2IUAA 3Q1XA 2BO4A 5ADXU 4IRQA 3EG4A 2IC7A 1VGTA 3MC4A 4FIYA 4HO2A 2W0WA 1NMMB 4XWIA 1R7XA 2V0KA 4B4BA 4FRBA 4HZDA 3MQHA 1ZIZA 3I0KA 1G97A 3T7NA 3R5AA 2VXMA 4DE7A 2J0AA 4M2BA 2RJ1A 3EH0A 1V83A 2P6WA 1LVWA 1LZ7A 4G87A 4FRAA 3T7OA 5AFUU 3MQGA 1ZJ3A 5D91A 4AAWA 1ZCVA 4JD0A 5CMGX 2ICXA 5C8RA 3IXCA 3V8ZA 1ZJPA 3GOSA 2Y6PA 3ST8A 1S4NA 1KGQA 2XWLA 3KWEA 3V0MA 1TW1A 1ZJ2A 2YQHA 4UEGA 3U2VA 4IHFA 1WT1A 2ZU7A 5FUHA 1VZTA 1JVDA 1MP5A 3V0PA 3TQDA 3V90A 3TDTA 2AM4A 3NGWA 1XHBA 4G3QA 3IGJA 2YC5A 3FSXA 3FSCA 3GUEA 2AGDA 1KGTA 3N9WA 3PKQA 3Q7UA 2OI7A 4D48A 1H5RB 3U0YA 3SXDA 1MRLA 2WLGA 1MC3A 4EGGA 4CJBA 1K4VA 4E6TA 4KRVA 4M4KA 1YP4A 3VBMA 2QH5A 4KQLA 4KC2A 1LZ0A 5L6SA 2VS3A 5CQOA 1V82A 3V0NA 2I5KA 3HJJA 1O23B 3CU0A 4MNDA 1I52A 4FCEA 4FRMA 3I0HA 3U0XA 4Q7CA 5IDSA 4B4MA 4Y7UA 3TWDA 2AESA 5EIYA 1IIMA 1ZCTA 4L41C 2X65A 1MR7A 1ZCUA 2DPWA 1NF5B 2FFVA 1H5TB 2FFUA 3DJ4A 2RITA 2RIZA 1R7TA 1HM9A 3SX3A 4FROA 1EZIA 4EA8A 4FRPA 5C38A 2Y4KA 1TZFA 4P02A 4Y7TA 1H5SA 3FSYA 3OU9A 4CVHA 1QQ0A 3U2UA 1VGWA 3E26A 4EE5A 5CMHA 3U2TA 1KHRA 5DEMA 1PZTA 3T7MA 2FYDB 2RJ5A 2GGOA 2FY7A 2WE9A 3JQYA 1V84A 3ZGFA 1ZI4A 1EYRA 2WLCA 4Y64A 5C1GA 3IOHA 4JISA 5HS2A 1KK6A 1FO9A 5DEPA 3PMOA 3OKRA 2YQJA 1QGQA 2I7BA 3SX5A 4LW6A 1HM0A 1W57A 1FWYA 2FYAA 1G93A 3HL3A 5FV9A 4N27A 4FIXA 3CKQA 1YP3A 5CMIA 4D11C 1Z90A 1INIA 5E3PA 5IFYA 2TDTA 1HV9A 3R1WA 2QKXA 2JF2A 3EEVA 1ZDGA 1MP4A 1LZIA 1ZCYA 1FZWA 2JCLA 1QREA 1S4OA 1H7GA 4KC1A 1YROB 1VM8A 4G3SA 1NHEB 1HJLA 4KXOA 2X5SA 2BO6A 3FSBA 1ZI1A 1ZI5A 5C4BA 1G1LA 1XHDA 3SXAA 5DG3A 3BSWA 1H7FA 2BO8A 1FXOA 1H7LA 2XATA 3RSBA 1TDTA 4MIXA 1FR8A 2PX7A 3JTJA 4FRLA 4Y6UA 3V0QA 4KNXA 4HO6A 3IOJA 1VGZA 3ZF8A 1G2VA 2FYCB 2AE7A 2P72A 4KPZA 3SXBA 2YC3A 3PKPA 1O0RA 4LW3A 4M28A 2YQCA 1NWGB 5C48A 1O7OA 3CKJA 2OI5A 2I5EA 5C1HA 5AJOA 3RMWA 4M98A 3I0CA 1OCXA 1H4DA 4J18A 3QVBA 3ZGGA 1H4CA 1OQMB 1GQCA 1R7UA 2RJ9A 3O3PA 4HO8A 3F1XA 3JUKA 4EVWA 5BXCA 3VBPA 4EQYA 1GA8A 3GVDA 4Y9XA 1GQ9A 4EEAA 1LZJA 2XMHA 5DDVA 2Z86A 2PA4A 5DDTA 3SRTA 4D0ZA 3BFPA 2AECA 4NAKA 3I0JA 3V4EA 1HM8A 1G9RA 2Y4LA 1OMXA 3BSYA 5JQQA 3BXYA 1TVYA 2Q4JA 4EABA 3SX8A 2Y4MA 3TV0A 5FU0A 2RJ8A 1NQIB 2WEEA 5CQMX 3C8VA 3VBKA 4FCUA 4HOCA 2O1FA 4BQHA 1S80A 3VBJA 3ZLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC3 A;  1VGU A;  2V0J A;  1H5T A;  3I0I X;  2VS4 A;  3OW5 A;  2VHE A;  1R80 A;  5EJ1 A;  2GGQ A;  3OC9 A;  5CQP A;  1G3L A;  3SXG A;  4HUR A;  3KWD A;  5EJZ A;  4B3U A;  5ADX V;  5FU8 A;  5C36 A;  4M99 A;  1H5S C;  4ISX A;  2BO7 A;  3R5B A;  3OTZ A;  1KRV A;  2Y4J A;  3SXC A;  3TK8 A;  2APC A;  1ZDF A;  5FYE A;  3TIO A;  4E6U A;  1JYL A;  1YP2 A;  3VBN A;  1SST A;  5C4C A;  2V0H A;  4MFG A;  1KRR A;  1ZJ1 A;  4B5B A;  5AFU V;  2JF3 A;  3ECT A;  1QRF A;  2A8W A;  1SSQ A;  1VH1 A;  1H4E A;  5I1F A;  5FTV A;  2RIX A;  3R2W A;  5E3R A;  4FQW A;  4FRE A;  2ZU9 A;  1GX0 A;  3POL A;  1V67 A;  5C47 A;  4EEM A;  1W55 A;  1QRM A;  1JYK A;  1H5S D;  2WAW A;  2CU2 A;  3DK5 A;  1H7T A;  3TIS A;  1QWJ A;  1VPA A;  4EA9 A;  1MR9 A;  3HSQ A;  3FS8 A;  2YCM A;  1G0R A;  5CQL X;  1FO8 A;  3FOQ A;  3V0L A;  4EA7 A;  3OH2 A;  4N69 A;  3F1Y A;  3R5C A;  5C3A A;  1R82 A;  2RJ4 A;  4EEO A;  4E79 A;  3I0D A;  2VXL A;  2QIA A;  2AQ9 A;  1KWS A;  4R37 A;  1H7H A;  3D5N A;  2P2O A;  1VZU A;  1R7Y A;  3USR A;  2AM3 A;  2V0L A;  4ARW A;  4EE4 A;  2JCJ A;  3FWW A;  2MZB A;  1THJ A;  1JV3 A;  1LL3 A;  3F1C A;  3CGX A;  3CKV A;  3CKO A;  4KT7 A;  1QG8 A;  4MZU A;  1ON8 A;  2JCK A;  1KK5 A;  4Y7F A;  5L6V A;  3P47 A;  4EAA A;  1ON6 A;  1VZX A;  3I0F A;  2WLF A;  3OH1 A;  4DCL A;  4DDZ A;  1G23 A;  2E8B A;  1PZY B;  3BRK X;  3R8Y A;  2XWM A;  3P1B A;  1JV1 A;  1QGS A;  2AH9 A;  2YES A;  4HZC A;  1GWW A;  5E3Q A;  1R7V A;  5AJP A;  1T3D A;  2OEF A;  2NXV A;  4Y63 A;  1FGX A;  3R0S A;  4HO9 A;  4YS8 A;  1FRW A;  2RIJ A;  4E75 A;  2RIY A;  3BCV A;  4N6B A;  2V0I A;  5FTS A;  4NAN A;  3U2X A;  1VH3 A;  4Y62 A;  1TW5 A;  4IRP A;  4B4G A;  1E5K A;  3R3R A;  3USQ A;  3VBL A;  3FTT A;  4HO0 A;  1GX4 A;  5C49 A;  1GWV A;  4NAI A;  5C3D A;  4NAL A;  4HUS A;  1H3M A;  3R5D A;  1H5R A;  2OEG A;  4N6A A;  3OH0 A;  4B42 A;  4CJ8 A;  2W0V A;  2NPO A;  1NKH B;  3Q80 A;  5IDT A;  1G95 A;  4M2A A;  2D0J A;  2PGY A;  2X60 A;  3KIA A;  3JUJ A;  4B2W A;  2QGI A;  4AYJ A;  3SX7 A;  4ASJ A;  3D8V A;  2RJ0 A;  4KPX A;  4R36 A;  1QRL A;  4H7O A;  4FRH A;  4C2S A;  4FRQ A;  4BMA A;  2RJ7 A;  5C3B A;  2O1H A;  4HO4 A;  3U2W A;  1KRU A;  2UX8 A;  4Y7G A;  1FXJ A;  4R7P A;  4G3P A;  2Z87 A;  3EE5 A;  2VSI A;  3SPT A;  1XAT A;  4GBP A;  1QRG A;  4ECM A;  2VSH A;  3V8Y A;  3OH3 A;  5J49 A;  3OUP A;  3TZT A;  3VBI A;  2VFZ A;  3I3A A;  3V91 A;  1WT3 A;  5C4E A;  1WSZ A;  1FGG A;  3OTM A;  4ASY A;  1FR9 A;  4Y7V A;  3SXE A;  2AM5 A;  2WLE A;  3NZ2 A;  2O1G A;  2OI6 A;  5C1L A;  3CKN A;  1LL0 A;  2XWN A;  5CQN X;  3OGZ A;  2Y7A A;  3I0L A;  5CMF X;  1ZI3 A;  2ICY A;  3K8E A;  4FRD A;  1JVG A;  2IU9 A;  3I3X A;  2X5Z A;  2FYB A;  4B2X A;  4KC4 A;  1V3W A;  2ZU8 A;  1S4P A;  1WVC A;  2YQS A;  1H5S B;  1ZJO A;  1SS9 A;  2QIV X;  2D7R A;  3VNP A;  4KNR A;  3I0E A;  2A8U A;  4P00 A;  2VD4 A;  1KQA A;  4E1K A;  1R81 A;  4HCQ A;  4EE3 A;  4IHG A;  2P73 A;  2WLD A;  3KWC A;  3LW6 A;  4ZDQ A;  5C4D A;  1ZJ0 A;  2JCO A;  4EEG A;  2FKO A;  2WVM A;  3PNN A;  1LL2 A;  1HJJ A;  3DUV A;  1SSM A;  3I0G A;  2WVK A;  3K8D A;  4D0T A;  1WT2 A;  2RJ6 A;  4AYL A;  4J09 A;  1G8O A;  3DHO A;  4IHH A;  1VIC A;  1MP3 A;  3ZLL A;  3CJ8 A;  3BSS A;  4AA7 A;  1IIN A;  4Y6N A;  2XME A;  2WVL A;  5AJN A;  2D7I A;  3OH4 A;  1H7Q A;  1INJ A;  4D11 A;  3OAM A;  4CJC A;  1LXA A;  3D98 A;  1FOA A;  5F42 A;  4HO3 A;  5C4F A;  1H7E A;  3R3I A;  2IU8 A;  1ZHJ A;  1FG5 N;  2VS5 A;  5CMJ A;  2WGZ A;  2PGV A;  3IOI A;  4M9C A;  1J2Z A;  1KK4 A;  1XZ6 A;  2E3D A;  4DEC A;  1O7Q A;  1W77 A;  3E25 A;  1OMZ A;  4MYO A;  3RMV A;  4K6R A;  3T57 A;  4HG6 A;  3V0O A;  5U2K A;  1WT0 A;  3Q4S A;  4HO5 A;  4MYB A;  2IUA A;  3Q1X A;  2BO4 A;  5ADX U;  4IRQ A;  3EG4 A;  2IC7 A;  1VGT A;  3MC4 A;  4HO2 A;  2W0W A;  1NMM B;  4XWI A;  1R7X A;  2V0K A;  4B4B A;  4FRB A;  4HZD A;  3MQH A;  1ZIZ A;  3I0K A;  1G97 A;  3T7N A;  3R5A A;  2VXM A;  4DE7 A;  4M2B A;  2RJ1 A;  3EH0 A;  1V83 A;  2P6W A;  1LVW A;  1LZ7 A;  4G87 A;  4FRA A;  3T7O A;  5AFU U;  3MQG A;  1ZJ3 A;  4AAW A;  1ZCV A;  4JD0 A;  5CMG X;  2ICX A;  5C8R A;  3IXC A;  3V8Z A;  1ZJP A;  3GOS A;  2Y6P A;  3ST8 A;  1S4N A;  1KGQ A;  2XWL A;  3KWE A;  3V0M A;  1TW1 A;  1ZJ2 A;  2YQH A;  4UEG A;  3U2V A;  4IHF A;  1WT1 A;  2ZU7 A;  5FUH A;  1VZT A;  1JVD A;  1MP5 A;  3V0P A;  3TQD A;  3V90 A;  3TDT A;  2AM4 A;  3NGW A;  1XHB A;  4G3Q A;  3IGJ A;  2YC5 A;  3FSX A;  3FSC A;  3GUE A;  2AGD A;  1KGT A;  3N9W A;  3PKQ A;  3Q7U A;  2OI7 A;  4D48 A;  1H5R B;  3U0Y A;  3SXD A;  1MRL A;  2WLG A;  1MC3 A;  4EGG A;  4CJB A;  1K4V A;  4E6T A;  4KRV A;  4M4K A;  1YP4 A;  3VBM A;  2QH5 A;  4KQL A;  4KC2 A;  1LZ0 A;  5L6S A;  2VS3 A;  5CQO A;  1V82 A;  3V0N A;  2I5K A;  3HJJ A;  1O23 B;  3CU0 A;  4MND A;  1I52 A;  4FCE A;  4FRM A;  3I0H A;  3U0X A;  5IDS A;  4B4M A;  4Y7U A;  3TWD A;  2AES A;  5EIY A;  1IIM A;  1ZCT A;  4L41 C;  2X65 A;  1MR7 A;  1ZCU A;  2DPW A;  1NF5 B;  2FFV A;  1H5T B;  2FFU A;  3DJ4 A;  2RIT A;  2RIZ A;  1R7T A;  1HM9 A;  3SX3 A;  4FRO A;  1EZI A;  4EA8 A;  4FRP A;  5C38 A;  2Y4K A;  1TZF A;  4P02 A;  4Y7T A;  1H5S A;  3FSY A;  3OU9 A;  4CVH A;  1QQ0 A;  3U2U A;  1VGW A;  3E26 A;  4EE5 A;  5CMH A;  3U2T A;  1KHR A;  5DEM A;  1PZT A;  3T7M A;  2FYD B;  2RJ5 A;  2GGO A;  2FY7 A;  2WE9 A;  3JQY A;  1V84 A;  3ZGF A;  1ZI4 A;  1EYR A;  2WLC A;  4Y64 A;  5C1G A;  3IOH A;  4JIS A;  5HS2 A;  1KK6 A;  1FO9 A;  5DEP A;  3PMO A;  3OKR A;  2YQJ A;  1QGQ A;  2I7B A;  3SX5 A;  4LW6 A;  1HM0 A;  1W57 A;  1FWY A;  2FYA A;  1G93 A;  3HL3 A;  5FV9 A;  4N27 A;  3CKQ A;  1YP3 A;  5CMI A;  4D11 C;  1Z90 A;  1INI A;  5E3P A;  5IFY A;  2TDT A;  1HV9 A;  3R1W A;  2QKX A;  2JF2 A;  3EEV A;  1ZDG A;  1MP4 A;  1LZI A;  1ZCY A;  1FZW A;  2JCL A;  1QRE A;  1S4O A;  1H7G A;  4KC1 A;  1YRO B;  1VM8 A;  4G3S A;  1NHE B;  1HJL A;  4KXO A;  2X5S A;  2BO6 A;  3FSB A;  1ZI1 A;  1ZI5 A;  5C4B A;  1G1L A;  1XHD A;  3SXA A;  5DG3 A;  3BSW A;  1H7F A;  2BO8 A;  1FXO A;  1H7L A;  2XAT A;  3RSB A;  1TDT A;  1FR8 A;  2PX7 A;  3JTJ A;  4FRL A;  4Y6U A;  3V0Q A;  4KNX A;  4HO6 A;  3IOJ A;  1VGZ A;  3ZF8 A;  1G2V A;  2FYC B;  2AE7 A;  2P72 A;  4KPZ A;  3SXB A;  2YC3 A;  3PKP A;  1O0R A;  4LW3 A;  4M28 A;  2YQC A;  1NWG B;  5C48 A;  1O7O A;  3CKJ A;  2OI5 A;  2I5E A;  5C1H A;  5AJO A;  3RMW A;  4M98 A;  3I0C A;  1OCX A;  1H4D A;  4J18 A;  3QVB A;  3ZGG A;  1H4C A;  1OQM B;  1GQC A;  1R7U A;  2RJ9 A;  3O3P A;  4HO8 A;  3F1X A;  3JUK A;  4EVW A;  5BXC A;  3VBP A;  4EQY A;  1GA8 A;  3GVD A;  4Y9X A;  1GQ9 A;  4EEA A;  1LZJ A;  2XMH A;  5DDV A;  2Z86 A;  2PA4 A;  5DDT A;  3SRT A;  4D0Z A;  3BFP A;  2AEC A;  4NAK A;  3I0J A;  3V4E A;  1HM8 A;  1G9R A;  2Y4L A;  1OMX A;  3BSY A;  5JQQ A;  3BXY A;  1TVY A;  2Q4J A;  4EAB A;  3SX8 A;  2Y4M A;  3TV0 A;  5FU0 A;  2RJ8 A;  1NQI B;  2WEE A;  5CQM X;  3C8V A;  3VBK A;  4FCU A;  4HOC A;  2O1F A;  4BQH A;  1S80 A;  3VBJ A;  3ZLK A; 
#chains in the Genus database with same CATH topology
 4AC3 A;  1VGU A;  2V0J A;  1H5T A;  3I0I X;  2VS4 A;  3OW5 A;  2VHE A;  1R80 A;  5EJ1 A;  2GGQ A;  3OC9 A;  5CQP A;  1G3L A;  3SXG A;  4HUR A;  3KWD A;  5EJZ A;  4B3U A;  5ADX V;  5FU8 A;  5C36 A;  4M99 A;  1H5S C;  4ISX A;  2BO7 A;  3R5B A;  3OTZ A;  1KRV A;  2Y4J A;  3SXC A;  3TK8 A;  2APC A;  1ZDF A;  5FYE A;  3TIO A;  4E6U A;  1JYL A;  1YP2 A;  3VBN A;  1SST A;  5C4C A;  2V0H A;  4MFG A;  1KRR A;  1ZJ1 A;  4B5B A;  5AFU V;  2JF3 A;  3ECT A;  1QRF A;  2A8W A;  1SSQ A;  1VH1 A;  1H4E A;  5I1F A;  5FTV A;  2RIX A;  3R2W A;  5E3R A;  4FQW A;  4FRE A;  2ZU9 A;  1GX0 A;  3POL A;  1V67 A;  5C47 A;  4EEM A;  1W55 A;  1QRM A;  1JYK A;  1H5S D;  2WAW A;  2CU2 A;  3DK5 A;  1H7T A;  3TIS A;  1QWJ A;  1VPA A;  4EA9 A;  1MR9 A;  3HSQ A;  3FS8 A;  2YCM A;  1G0R A;  5CQL X;  1FO8 A;  3FOQ A;  3V0L A;  4EA7 A;  3OH2 A;  4N69 A;  3F1Y A;  3R5C A;  5C3A A;  1R82 A;  2RJ4 A;  4EEO A;  4E79 A;  3I0D A;  2VXL A;  2QIA A;  5D92 A;  2AQ9 A;  1KWS A;  4R37 A;  1H7H A;  3D5N A;  2P2O A;  1VZU A;  1R7Y A;  3USR A;  2AM3 A;  2V0L A;  4ARW A;  4EE4 A;  2JCJ A;  3FWW A;  2MZB A;  1THJ A;  1JV3 A;  1LL3 A;  3F1C A;  3CGX A;  3CKV A;  3CKO A;  4KT7 A;  1QG8 A;  4MZU A;  1ON8 A;  2JCK A;  1KK5 A;  4Y7F A;  5L6V A;  3P47 A;  4EAA A;  1ON6 A;  1VZX A;  3I0F A;  2WLF A;  3OH1 A;  4DCL A;  4DDZ A;  1G23 A;  2E8B A;  1PZY B;  3BRK X;  3R8Y A;  2XWM A;  3P1B A;  1JV1 A;  1QGS A;  2AH9 A;  2YES A;  4HZC A;  1GWW A;  5E3Q A;  1R7V A;  5AJP A;  1T3D A;  2OEF A;  2NXV A;  4Y63 A;  1FGX A;  3R0S A;  4HO9 A;  4YS8 A;  1FRW A;  2RIJ A;  4E75 A;  2RIY A;  3BCV A;  4N6B A;  2V0I A;  5FTS A;  4NAN A;  3U2X A;  1VH3 A;  4Y62 A;  1TW5 A;  4IRP A;  4B4G A;  1E5K A;  3R3R A;  3USQ A;  3VBL A;  3FTT A;  4HO0 A;  1GX4 A;  5C49 A;  1GWV A;  4NAI A;  5C3D A;  4NAL A;  4HUS A;  1H3M A;  3R5D A;  1H5R A;  2OEG A;  3OH0 A;  4N6A A;  4B42 A;  4CJ8 A;  2W0V A;  2NPO A;  1NKH B;  3Q80 A;  5IDT A;  1G95 A;  4M2A A;  2D0J A;  2PGY A;  4O6M A;  2X60 A;  3KIA A;  3JUJ A;  4B2W A;  2QGI A;  4AYJ A;  3SX7 A;  4ASJ A;  3D8V A;  2RJ0 A;  4KPX A;  4R36 A;  2C0N A;  1QRL A;  4H7O A;  4FRH A;  4C2S A;  4FRQ A;  4BMA A;  2RJ7 A;  5C3B A;  2O1H A;  4HO4 A;  3U2W A;  1KRU A;  2UX8 A;  4Y7G A;  1FXJ A;  4R7P A;  4G3P A;  2Z87 A;  3EE5 A;  2VSI A;  3SPT A;  1XAT A;  4GBP A;  1QRG A;  2VK9 A;  4ECM A;  2VSH A;  3V8Y A;  3OH3 A;  5J49 A;  2J0B A;  3OUP A;  3TZT A;  3VBI A;  2VFZ A;  3I3A A;  3V91 A;  1WT3 A;  5C4E A;  1WSZ A;  1FGG A;  3OTM A;  4ASY A;  1FR9 A;  4Y7V A;  3SXE A;  2AM5 A;  2WLE A;  3NZ2 A;  2O1G A;  2OI6 A;  5C1L A;  3CKN A;  1LL0 A;  2XWN A;  5CQN X;  3OGZ A;  4O6N A;  2Y7A A;  3I0L A;  5CMF X;  1ZI3 A;  2ICY A;  3K8E A;  4FRD A;  1JVG A;  2IU9 A;  3I3X A;  2X5Z A;  2FYB A;  4B2X A;  4KC4 A;  1V3W A;  2ZU8 A;  1S4P A;  1WVC A;  1EWW A;  2YQS A;  1H5S B;  1ZJO A;  1SS9 A;  2QIV X;  2D7R A;  3VNP A;  4KNR A;  3I0E A;  2A8U A;  4P00 A;  2VD4 A;  1KQA A;  4E1K A;  1R81 A;  4HCQ A;  4EE3 A;  4IHG A;  2P73 A;  2WLD A;  3KWC A;  3LW6 A;  4ZDQ A;  5C4D A;  1ZJ0 A;  2JCO A;  4EEG A;  2FKO A;  2WVM A;  3PNN A;  1LL2 A;  1HJJ A;  3DUV A;  1SSM A;  3I0G A;  2WVK A;  3K8D A;  4D0T A;  1WT2 A;  2RJ6 A;  4AYL A;  4J09 A;  1G8O A;  3DHO A;  4IHH A;  1VIC A;  1MP3 A;  3ZLL A;  3CJ8 A;  3BSS A;  4AA7 A;  1IIN A;  4Y6N A;  2XME A;  2WVL A;  5AJN A;  2D7I A;  3OH4 A;  1H7Q A;  1INJ A;  4D11 A;  3OAM A;  1N4I A;  4CJC A;  1LXA A;  3D98 A;  1FOA A;  5F42 A;  4HO3 A;  5C4F A;  1H7E A;  3R3I A;  2IU8 A;  1ZHJ A;  1FG5 N;  2VS5 A;  5CMJ A;  2WGZ A;  2PGV A;  3IOI A;  4M9C A;  1J2Z A;  1KK4 A;  1XZ6 A;  2E3D A;  4DEC A;  1O7Q A;  1W77 A;  3E25 A;  1OMZ A;  4MYO A;  3RMV A;  4K6R A;  3T57 A;  4HG6 A;  3V0O A;  5U2K A;  1WT0 A;  3Q4S A;  4HO5 A;  4MYB A;  1M8N A;  2IUA A;  3Q1X A;  2BO4 A;  5ADX U;  4IRQ A;  3EG4 A;  2IC7 A;  1VGT A;  3MC4 A;  4FIY A;  4HO2 A;  2W0W A;  1NMM B;  4XWI A;  1Z2F A;  1R7X A;  2V0K A;  4B4B A;  4FRB A;  4HZD A;  3MQH A;  1ZIZ A;  3I0K A;  1G97 A;  3T7N A;  3R5A A;  2VXM A;  4DE7 A;  2J0A A;  4M2B A;  2RJ1 A;  3EH0 A;  1V83 A;  2P6W A;  1LVW A;  1LZ7 A;  4G87 A;  4FRA A;  3T7O A;  5AFU U;  3MQG A;  1ZJ3 A;  5D91 A;  4AAW A;  1ZCV A;  4JD0 A;  5CMG X;  2ICX A;  5C8R A;  3IXC A;  3V8Z A;  1ZJP A;  3GOS A;  2Y6P A;  3ST8 A;  1S4N A;  1KGQ A;  2XWL A;  3KWE A;  3V0M A;  1TW1 A;  1ZJ2 A;  2YQH A;  4UEG A;  3U2V A;  4IHF A;  1WT1 A;  2ZU7 A;  5FUH A;  1VZT A;  1JVD A;  1MP5 A;  3V0P A;  3TQD A;  3V90 A;  3TDT A;  2AM4 A;  3NGW A;  1XHB A;  4G3Q A;  3IGJ A;  2YC5 A;  3FSX A;  3FSC A;  3GUE A;  2AGD A;  1KGT A;  3N9W A;  3PKQ A;  3Q7U A;  2OI7 A;  4D48 A;  1H5R B;  3U0Y A;  3SXD A;  1MRL A;  3GQA A;  2WLG A;  1MC3 A;  4EGG A;  4CJB A;  1K4V A;  4E6T A;  4KRV A;  4M4K A;  1YP4 A;  3VBM A;  2QH5 A;  4KQL A;  4KC2 A;  1LZ0 A;  5L6S A;  2VS3 A;  5CQO A;  1V82 A;  3V0N A;  2I5K A;  3HJJ A;  1O23 B;  3CU0 A;  4MND A;  1I52 A;  4FCE A;  4FRM A;  3I0H A;  3U0X A;  4Q7C A;  5IDS A;  4B4M A;  4Y7U A;  3TWD A;  2AES A;  5EIY A;  1IIM A;  1ZCT A;  4L41 C;  2X65 A;  1MR7 A;  1ZCU A;  2DPW A;  1NF5 B;  2FFV A;  1H5T B;  2FFU A;  3DJ4 A;  2RIT A;  2RIZ A;  1R7T A;  1HM9 A;  3SX3 A;  4FRO A;  1EZI A;  4EA8 A;  4FRP A;  5C38 A;  2Y4K A;  1TZF A;  4P02 A;  4Y7T A;  1H5S A;  3FSY A;  3OU9 A;  4CVH A;  1QQ0 A;  3U2U A;  1VGW A;  3E26 A;  4EE5 A;  5CMH A;  3U2T A;  1KHR A;  5DEM A;  1PZT A;  3T7M A;  2FYD B;  2RJ5 A;  2GGO A;  2FY7 A;  2WE9 A;  3JQY A;  1V84 A;  3ZGF A;  1ZI4 A;  1EYR A;  2WLC A;  4Y64 A;  5C1G A;  3IOH A;  4JIS A;  5HS2 A;  1KK6 A;  1FO9 A;  5DEP A;  3PMO A;  3OKR A;  2YQJ A;  1QGQ A;  2I7B A;  3SX5 A;  4LW6 A;  1HM0 A;  1W57 A;  1FWY A;  2FYA A;  3GQ8 A;  1G93 A;  3HL3 A;  5FV9 A;  4N27 A;  4FIX A;  3CKQ A;  1YP3 A;  5CMI A;  4D11 C;  1Z90 A;  1INI A;  5E3P A;  5IFY A;  2TDT A;  1HV9 A;  3R1W A;  2QKX A;  2JF2 A;  3EEV A;  1ZDG A;  1MP4 A;  1LZI A;  1ZCY A;  1FZW A;  2JCL A;  1QRE A;  1S4O A;  1H7G A;  4KC1 A;  1YRO B;  1VM8 A;  4G3S A;  1NHE B;  1HJL A;  4KXO A;  2X5S A;  2BO6 A;  3FSB A;  1ZI1 A;  1ZI5 A;  5C4B A;  1G1L A;  1XHD A;  3SXA A;  5DG3 A;  3BSW A;  1H7F A;  2BO8 A;  1FXO A;  1H7L A;  2XAT A;  3RSB A;  1TDT A;  4MIX A;  1FR8 A;  2PX7 A;  3JTJ A;  3GQ7 A;  3SUC A;  4FRL A;  4Y6U A;  3V0Q A;  4KNX A;  4HO6 A;  3IOJ A;  1VGZ A;  3ZF8 A;  1G2V A;  2FYC B;  2AE7 A;  2P72 A;  4KPZ A;  3SXB A;  2YC3 A;  3PKP A;  1O0R A;  4LW3 A;  4M28 A;  2YQC A;  1NWG B;  5C48 A;  1O7O A;  3GQ9 A;  1L0S A;  2OI5 A;  2I5E A;  3CKJ A;  5C1H A;  5AJO A;  3RMW A;  4M98 A;  3I0C A;  1OCX A;  1H4D A;  4J18 A;  3QVB A;  3ZGG A;  1H4C A;  1OQM B;  1GQC A;  1R7U A;  2RJ9 A;  3O3P A;  4HO8 A;  3F1X A;  3JUK A;  4EVW A;  5BXC A;  3VBP A;  4EQY A;  1GA8 A;  3GVD A;  4Y9X A;  1GQ9 A;  4EEA A;  1LZJ A;  2XMH A;  5DDV A;  2Z86 A;  2PA4 A;  5DDT A;  3SRT A;  4D0Z A;  3BFP A;  2AEC A;  4NAK A;  3I0J A;  3V4E A;  1HM8 A;  1G9R A;  2Y4L A;  1OMX A;  3BSY A;  5JQQ A;  3BXY A;  1TVY A;  2Q4J A;  4EAB A;  3SX8 A;  2Y4M A;  3TV0 A;  5FU0 A;  2RJ8 A;  1NQI B;  2WEE A;  5CQM X;  3C8V A;  3VBK A;  4FCU A;  4HOC A;  2O1F A;  4BQH A;  1S80 A;  3VBJ A;  3ZLK A; 
#chains in the Genus database with same CATH homology
 4AC3 A;  1VGU A;  2V0J A;  1H5T A;  3I0I X;  2VS4 A;  3OW5 A;  2VHE A;  1R80 A;  5EJ1 A;  2GGQ A;  3OC9 A;  5CQP A;  1G3L A;  3SXG A;  4HUR A;  3KWD A;  5EJZ A;  4B3U A;  5ADX V;  5FU8 A;  5C36 A;  4M99 A;  1H5S C;  4ISX A;  2BO7 A;  3R5B A;  3OTZ A;  1KRV A;  2Y4J A;  3SXC A;  3TK8 A;  2APC A;  1ZDF A;  5FYE A;  3TIO A;  4E6U A;  1JYL A;  1YP2 A;  3VBN A;  1SST A;  5C4C A;  2V0H A;  4MFG A;  1KRR A;  1ZJ1 A;  4B5B A;  5AFU V;  2JF3 A;  3ECT A;  1QRF A;  2A8W A;  1SSQ A;  1VH1 A;  1H4E A;  5I1F A;  5FTV A;  2RIX A;  3R2W A;  5E3R A;  4FQW A;  4FRE A;  2ZU9 A;  1GX0 A;  3POL A;  1V67 A;  5C47 A;  4EEM A;  1W55 A;  1QRM A;  1JYK A;  1H5S D;  2WAW A;  2CU2 A;  3DK5 A;  1H7T A;  3TIS A;  1QWJ A;  1VPA A;  4EA9 A;  1MR9 A;  3HSQ A;  3FS8 A;  2YCM A;  1G0R A;  5CQL X;  1FO8 A;  3FOQ A;  3V0L A;  4EA7 A;  3OH2 A;  4N69 A;  3F1Y A;  3R5C A;  5C3A A;  1R82 A;  2RJ4 A;  4EEO A;  4E79 A;  3I0D A;  2VXL A;  2QIA A;  5D92 A;  2AQ9 A;  1KWS A;  4R37 A;  1H7H A;  3D5N A;  2P2O A;  1VZU A;  1R7Y A;  3USR A;  2AM3 A;  2V0L A;  4ARW A;  4EE4 A;  2JCJ A;  3FWW A;  2MZB A;  1THJ A;  1JV3 A;  1LL3 A;  3F1C A;  3CGX A;  3CKV A;  3CKO A;  4KT7 A;  1QG8 A;  4MZU A;  1ON8 A;  2JCK A;  1KK5 A;  4Y7F A;  5L6V A;  3P47 A;  4EAA A;  1ON6 A;  1VZX A;  3I0F A;  2WLF A;  3OH1 A;  4DCL A;  4DDZ A;  1G23 A;  2E8B A;  1PZY B;  3BRK X;  3R8Y A;  2XWM A;  3P1B A;  1JV1 A;  1QGS A;  2AH9 A;  2YES A;  4HZC A;  1GWW A;  5E3Q A;  1R7V A;  5AJP A;  1T3D A;  2OEF A;  2NXV A;  4Y63 A;  1FGX A;  3R0S A;  4HO9 A;  4YS8 A;  1FRW A;  2RIJ A;  4E75 A;  2RIY A;  3BCV A;  4N6B A;  2V0I A;  5FTS A;  4NAN A;  3U2X A;  1VH3 A;  4Y62 A;  1TW5 A;  4IRP A;  4B4G A;  1E5K A;  3R3R A;  3USQ A;  3VBL A;  3FTT A;  4HO0 A;  1GX4 A;  5C49 A;  1GWV A;  4NAI A;  5C3D A;  4NAL A;  4HUS A;  1H3M A;  3R5D A;  1H5R A;  2OEG A;  4N6A A;  3OH0 A;  4B42 A;  4CJ8 A;  2W0V A;  2NPO A;  1NKH B;  3Q80 A;  5IDT A;  1G95 A;  4M2A A;  2D0J A;  2PGY A;  4O6M A;  2X60 A;  3KIA A;  3JUJ A;  4B2W A;  2QGI A;  4AYJ A;  3SX7 A;  4ASJ A;  3D8V A;  2RJ0 A;  4KPX A;  4R36 A;  2C0N A;  1QRL A;  4H7O A;  4FRH A;  4C2S A;  4FRQ A;  4BMA A;  2RJ7 A;  5C3B A;  2O1H A;  4HO4 A;  3U2W A;  1KRU A;  2UX8 A;  4Y7G A;  1FXJ A;  4R7P A;  4G3P A;  2Z87 A;  3EE5 A;  2VSI A;  3SPT A;  1XAT A;  4GBP A;  1QRG A;  2VK9 A;  4ECM A;  2VSH A;  3V8Y A;  3OH3 A;  5J49 A;  2J0B A;  3OUP A;  3TZT A;  3VBI A;  2VFZ A;  3I3A A;  3V91 A;  1WT3 A;  5C4E A;  1WSZ A;  1FGG A;  3OTM A;  4ASY A;  1FR9 A;  4Y7V A;  3SXE A;  2AM5 A;  2WLE A;  3NZ2 A;  2O1G A;  2OI6 A;  5C1L A;  3CKN A;  1LL0 A;  2XWN A;  5CQN X;  3OGZ A;  4O6N A;  2Y7A A;  3I0L A;  5CMF X;  1ZI3 A;  2ICY A;  3K8E A;  4FRD A;  1JVG A;  2IU9 A;  3I3X A;  2X5Z A;  2FYB A;  4B2X A;  4KC4 A;  1V3W A;  2ZU8 A;  1S4P A;  1WVC A;  2YQS A;  1H5S B;  1ZJO A;  1SS9 A;  2QIV X;  2D7R A;  3VNP A;  4KNR A;  3I0E A;  2A8U A;  4P00 A;  2VD4 A;  1KQA A;  4E1K A;  1R81 A;  4HCQ A;  4EE3 A;  4IHG A;  2P73 A;  2WLD A;  3KWC A;  3LW6 A;  4ZDQ A;  5C4D A;  1ZJ0 A;  2JCO A;  4EEG A;  2FKO A;  2WVM A;  3PNN A;  1LL2 A;  1HJJ A;  3DUV A;  1SSM A;  3I0G A;  2WVK A;  3K8D A;  4D0T A;  1WT2 A;  2RJ6 A;  4AYL A;  4J09 A;  1G8O A;  3DHO A;  4IHH A;  1VIC A;  1MP3 A;  3ZLL A;  3CJ8 A;  3BSS A;  4AA7 A;  1IIN A;  4Y6N A;  2XME A;  2WVL A;  5AJN A;  2D7I A;  3OH4 A;  1H7Q A;  1INJ A;  4D11 A;  3OAM A;  4CJC A;  1LXA A;  3D98 A;  1FOA A;  5F42 A;  4HO3 A;  5C4F A;  1H7E A;  3R3I A;  2IU8 A;  1ZHJ A;  1FG5 N;  2VS5 A;  5CMJ A;  2WGZ A;  2PGV A;  3IOI A;  4M9C A;  1J2Z A;  1KK4 A;  1XZ6 A;  2E3D A;  4DEC A;  1O7Q A;  1W77 A;  3E25 A;  1OMZ A;  4MYO A;  3RMV A;  4K6R A;  3T57 A;  4HG6 A;  3V0O A;  5U2K A;  1WT0 A;  3Q4S A;  4HO5 A;  4MYB A;  2IUA A;  3Q1X A;  2BO4 A;  5ADX U;  4IRQ A;  3EG4 A;  2IC7 A;  1VGT A;  3MC4 A;  4FIY A;  4HO2 A;  2W0W A;  1NMM B;  4XWI A;  1R7X A;  2V0K A;  4B4B A;  4FRB A;  4HZD A;  3MQH A;  1ZIZ A;  3I0K A;  1G97 A;  3T7N A;  3R5A A;  2VXM A;  4DE7 A;  2J0A A;  4M2B A;  2RJ1 A;  3EH0 A;  1V83 A;  2P6W A;  1LVW A;  1LZ7 A;  4G87 A;  4FRA A;  3T7O A;  5AFU U;  3MQG A;  1ZJ3 A;  5D91 A;  4AAW A;  1ZCV A;  4JD0 A;  5CMG X;  2ICX A;  5C8R A;  3IXC A;  3V8Z A;  1ZJP A;  3GOS A;  2Y6P A;  3ST8 A;  1S4N A;  1KGQ A;  2XWL A;  3KWE A;  3V0M A;  1TW1 A;  1ZJ2 A;  2YQH A;  4UEG A;  3U2V A;  4IHF A;  1WT1 A;  2ZU7 A;  5FUH A;  1VZT A;  1JVD A;  1MP5 A;  3V0P A;  3TQD A;  3V90 A;  3TDT A;  2AM4 A;  3NGW A;  1XHB A;  4G3Q A;  3IGJ A;  2YC5 A;  3FSX A;  3FSC A;  3GUE A;  2AGD A;  1KGT A;  3N9W A;  3PKQ A;  3Q7U A;  2OI7 A;  4D48 A;  1H5R B;  3U0Y A;  3SXD A;  1MRL A;  2WLG A;  1MC3 A;  4EGG A;  4CJB A;  1K4V A;  4E6T A;  4KRV A;  4M4K A;  1YP4 A;  3VBM A;  2QH5 A;  4KQL A;  4KC2 A;  1LZ0 A;  5L6S A;  2VS3 A;  5CQO A;  1V82 A;  3V0N A;  2I5K A;  3HJJ A;  1O23 B;  3CU0 A;  4MND A;  1I52 A;  4FCE A;  4FRM A;  3I0H A;  3U0X A;  4Q7C A;  5IDS A;  4B4M A;  4Y7U A;  3TWD A;  2AES A;  5EIY A;  1IIM A;  1ZCT A;  4L41 C;  2X65 A;  1MR7 A;  1ZCU A;  2DPW A;  1NF5 B;  2FFV A;  1H5T B;  2FFU A;  3DJ4 A;  2RIT A;  2RIZ A;  1R7T A;  1HM9 A;  3SX3 A;  4FRO A;  1EZI A;  4EA8 A;  4FRP A;  5C38 A;  2Y4K A;  1TZF A;  4P02 A;  4Y7T A;  1H5S A;  3FSY A;  3OU9 A;  4CVH A;  1QQ0 A;  3U2U A;  1VGW A;  3E26 A;  4EE5 A;  5CMH A;  3U2T A;  1KHR A;  5DEM A;  1PZT A;  3T7M A;  2FYD B;  2RJ5 A;  2GGO A;  2FY7 A;  2WE9 A;  3JQY A;  1V84 A;  3ZGF A;  1ZI4 A;  1EYR A;  2WLC A;  4Y64 A;  5C1G A;  3IOH A;  4JIS A;  5HS2 A;  1KK6 A;  1FO9 A;  5DEP A;  3PMO A;  3OKR A;  2YQJ A;  1QGQ A;  2I7B A;  3SX5 A;  4LW6 A;  1HM0 A;  1W57 A;  1FWY A;  2FYA A;  1G93 A;  3HL3 A;  5FV9 A;  4N27 A;  4FIX A;  3CKQ A;  1YP3 A;  5CMI A;  4D11 C;  1Z90 A;  1INI A;  5E3P A;  5IFY A;  2TDT A;  1HV9 A;  3R1W A;  2QKX A;  2JF2 A;  3EEV A;  1ZDG A;  1MP4 A;  1LZI A;  1ZCY A;  1FZW A;  2JCL A;  1QRE A;  1S4O A;  1H7G A;  4KC1 A;  1YRO B;  1VM8 A;  4G3S A;  1NHE B;  1HJL A;  4KXO A;  2X5S A;  2BO6 A;  3FSB A;  1ZI1 A;  1ZI5 A;  5C4B A;  1G1L A;  1XHD A;  3SXA A;  5DG3 A;  3BSW A;  1H7F A;  2BO8 A;  1FXO A;  1H7L A;  2XAT A;  3RSB A;  1TDT A;  4MIX A;  1FR8 A;  2PX7 A;  3JTJ A;  4FRL A;  4Y6U A;  3V0Q A;  4KNX A;  4HO6 A;  3IOJ A;  1VGZ A;  3ZF8 A;  1G2V A;  2FYC B;  2AE7 A;  2P72 A;  4KPZ A;  3SXB A;  2YC3 A;  3PKP A;  1O0R A;  4LW3 A;  4M28 A;  2YQC A;  1NWG B;  5C48 A;  1O7O A;  3CKJ A;  2OI5 A;  2I5E A;  5C1H A;  5AJO A;  3RMW A;  4M98 A;  3I0C A;  1OCX A;  1H4D A;  4J18 A;  3QVB A;  3ZGG A;  1H4C A;  1OQM B;  1GQC A;  1R7U A;  2RJ9 A;  3O3P A;  4HO8 A;  3F1X A;  3JUK A;  4EVW A;  5BXC A;  3VBP A;  4EQY A;  1GA8 A;  3GVD A;  4Y9X A;  1GQ9 A;  4EEA A;  1LZJ A;  2XMH A;  5DDV A;  2Z86 A;  2PA4 A;  5DDT A;  3SRT A;  4D0Z A;  3BFP A;  2AEC A;  4NAK A;  3I0J A;  3V4E A;  1HM8 A;  1G9R A;  2Y4L A;  1OMX A;  3BSY A;  5JQQ A;  3BXY A;  1TVY A;  2Q4J A;  4EAB A;  3SX8 A;  2Y4M A;  3TV0 A;  5FU0 A;  2RJ8 A;  1NQI B;  2WEE A;  5CQM X;  3C8V A;  3VBK A;  4FCU A;  4HOC A;  2O1F A;  4BQH A;  1S80 A;  3VBJ A;  3ZLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...