3DK5A

Crystal structure of apo-glmu from mycobacterium tuberculosis
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
469
structure length
442
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFYGRIVMAIVEVNAGVYAFDIAALRSALSRLSSNNQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 141
structure length 442
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dk5A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dk5A01
2BO4A 4FRQA 4M28A 4N27A 1H5TB 1GX4A 1QGQA 2I5EA 1ZJ1A 2AM4A 1XATA 2WEEA 3FTTA 3R0SA 1NQIB 4R37A 3OTMA 3C8VA 1NWGB 1V84A 2CU2A 3P47A 1KRUA 3Q4SA 5J49A 1SSMA 4EA7A 5AJPA 2ICYA 3I3AA 1S4PA 2RIJA 4B4GA 1GX0A 4FRDA 4J09A 2FYBA 1NMMB 5FYEA 5CMHA 1NF5B 5L6VA 4D11A 3SXBA 1I52A 3KWDA 4N6AA 4G3PA 4M2BA 1R7YA 2MZBA 1V83A 3CU0A 3F1XA 3DJ4A 5IFYA 1JVDA 1H5RB 3KIAA 3SX7A 4EVWA 3U0YA 3V8ZA 2WGZA 4IRPA 2X65A 1GWWA 3EG4A 4KPZA 4KC1A 5C1LA 3Q80A 2X60A 3OTZA 4Y7UA 4B2WA 3I0IX 2RJ0A 4EEAA 2AM5A 2RJ5A 2RJ6A 1QQ0A 2RJ4A 4EQYA 2FYCB 5FTSA 3FSXA 1IINA 3F1YA 2FKOA 4NAKA 1ZI1A 5DEPA 2QH5A 3SXEA 4Y7TA 2NPOA 1V82A 3E26A 2WAWA 3MQHA 2RJ7A 2XMHA 3TIOA 3U2TA 2I5KA 1H5SB 2WLEA 3BXYA 3VBIA 1QGSA 4Y9XA 2X5ZA 1V67A 3VBJA 1J2ZA 5HS2A 2P2OA 4G3SA 1TZFA 2JF3A 4ZDQA 3V0LA 3T7MA 2XATA 4EA9A 3R5CA 3CGXA 4MZUA 4HO9A 3V0QA 4KNRA 1EZIA 1H5RA 1QRLA 5C48A 2VSIA 4B4MA 4IRQA 1XHBA 4KRVA 5EJ1A 3CKQA 5CQNX 2TDTA 4E6UA 1FGXA 5C3BA 4BMAA 1FXOA 1MP5A 5AFUV 1ZDFA 4D11C 3OH4A 4KNXA 4FRMA 4K6RA 1QWJA 2VFZA 1G3LA 1NKHB 4M2AA 2VXMA 1R80A 3OH2A 4E1KA 4M98A 4LW3A 5CMGX 5CMFX 1INJA 3V4EA 4EEOA 3MC4A 4HO3A 2X5SA 4EEMA 4N69A 3IGJA 1H7FA 1JV3A 1FO9A 1MP4A 1VGTA 1YP3A 3V0PA 2AQ9A 3OUPA 3GVDA 1VZTA 3LW6A 2VSHA 1G97A 1H5SA 3V8YA 1H7HA 3BRKX 4HURA 4HZDA 5AJNA 1SS9A 4MYBA 3D8VA 3SRTA 3R8YA 2AE7A 3I0KA 1O23B 4CVHA 1ON6A 1G23A 1VPAA 2RJ1A 2O1FA 1FWYA 2QIVX 1KGQA 4E79A 3O3PA 4HO6A 1ZCTA 3SPTA 2P73A 1ZIZA 5C4DA 1O7OA 4LW6A 4KXOA 4M4KA 2A8WA 2PGVA 2V0HA 1VGUA 3I0EA 4CJCA 2QKXA 5JQQA 2YC5A 1QRGA 4KC2A 2VXLA 3IOIA 4Y6NA 1KHRA 1R7UA 3ECTA 4HO8A 1G8OA 3EH0A 2JCOA 1VICA 3OW5A 4AA7A 2YESA 4Y6UA 4B4BA 4MFGA 4FRPA 1QREA 4M99A 3T57A 3VBLA 1H7EA 1PZYB 3HL3A 4E75A 1QG8A 1G95A 3OC9A 5ADXU 3JQYA 1ZI4A 1ZJOA 4HOCA 1OMXA 3RMWA 2Y4KA 3TISA 2E8BA 2YQJA 1JV1A 2I7BA 2YQHA 3OGZA 4FRBA 3U2VA 3NGWA 3OH0A 1ZHJA 4G3QA 2V0JA 1LZ7A 3V90A 2IU8A 2W0WA 5C4FA 1FO8A 4Y7FA 5F42A 3D5NA 2GGOA 4HO0A 4P00A 3KWEA 4FROA 1S80A 2IU9A 1G9RA 2YQCA 3Q1XA 5C1HA 5FUHA 4B5BA 5FV9A 2WVKA 1FG5N 3OH3A 3JUJA 5FU0A 1G93A 5DEMA 1INIA 1YROB 1KWSA 3I0FA 5C8RA 1QRMA 1R7TA 2NXVA 1H5TA 4UEGA 1Z90A 3GUEA 4D48A 1H7GA 3FSCA 2FYDB 3DHOA 2P6WA 3OAMA 4ARWA 5C4BA 1KGTA 1HJJA 2APCA 2WVLA 3BCVA 3ZGFA 1LZ0A 2VHEA 5I1FA 2Y6PA 5EIYA 1S4OA 1G2VA 4FRHA 3Q7UA 3I3XA 2W0VA 2WLFA 5E3RA 4Y62A 1MC3A 3SX3A 1SSQA 2RITA 3I0LA 4EEGA 2VS4A 1ZDGA 4Y7VA 4B2XA 1VGZA 1WT2A 3CKJA 3FWWA 1VH1A 2JCLA 3U2WA 5C3DA 2O1HA 3K8DA 3R2WA 1TVYA 3CJ8A 4L41C 1EYRA 1JVGA 2IC7A 3I0GA 3CKNA 4JISA 2FYAA 4KPXA 3E25A 2RIYA 5C3AA 5CQOA 4IHHA 4DCLA 1FRWA 5DDVA 1VGWA 2IUAA 3VBMA 1LXAA 1W55A 2WVMA 5E3PA 1R7VA 2FY7A 4EE3A 4HO2A 1E5KA 3RSBA 5E3QA 4AAWA 1GQ9A 1H7LA 2RIXA 3U2UA 3VBPA 4J18A 3R3IA 1TW1A 4E6TA 3I0CA 3DUVA 1K4VA 2ZU8A 3TDTA 3VBKA 3ZF8A 2Y4LA 5AJOA 2RIZA 3BSSA 1ON8A 3SXAA 2BO7A 4KC4A 4FRAA 3V0MA 3IOJA 4HUSA 4FQWA 4NALA 4N6BA 3CKVA 4ECMA 4ISXA 4IHFA 1IIMA 3T7NA 1FR8A 3HSQA 2UX8A 1LZJA 5CQPA 4Y7GA 4B3UA 1LVWA 1MP3A 4NANA 3ZGGA 2OI5A 3TK8A 2AGDA 2YQSA 1H7QA 2FFUA 3POLA 1YP4A 3PKQA 1LL3A 2PGYA 1KK5A 1KK6A 5ADXV 2AM3A 1WT0A 1WVCA 4Y64A 5C47A 4KT7A 1YP2A 3U2XA 2D7IA 1ZCUA 1KQAA 4R7PA 3BFPA 2VS3A 2WLDA 2AECA 4H7OA 1R7XA 3P1BA 3PNNA 3R5AA 5U2KA 1SSTA 3FSYA 1ZCYA 3CKOA 4R36A 4EA8A 1HM8A 2XMEA 1QRFA 1O0RA 2OI6A 3R5DA 2RJ9A 4NAIA 3V91A 3USQA 4MNDA 2Y4MA 4BQHA 2AH9A 2Y4JA 2WLGA 1JYLA 3TZTA 2D0JA 1XZ6A 2YC3A 1V3WA 1GQCA 3SX5A 3FOQA 4JD0A 3BSWA 4EABA 1G0RA 2QIAA 4P02A 2ZU9A 5DDTA 3SXDA 3R3RA 1WT3A 1VZUA 3I0DA 5C36A 2D7RA 1TDTA 4C2SA 3VNPA 1W57A 2O1GA 4M9CA 1ZJ0A 3K8EA 3V0NA 3ZLKA 4ASYA 2WE9A 2Z86A 4XWIA 3IXCA 1FR9A 1FXJA 1H4EA 1VM8A 2OI7A 2Q4JA 4HO4A 1S4NA 3PKPA 4HO5A 4GBPA 5IDTA 4IHGA 3NZ2A 1GA8A 2PA4A 2YCMA 3KWCA 1H4DA 2JCKA 3SX8A 5FTVA 3TQDA 5BXCA 1GWVA 1MR7A 1H5SC 2QGIA 3V0OA 2GGQA 2XWNA 1R81A 1XHDA 2BO8A 2WLCA 3JTJA 1HV9A 4EE4A 1KRRA 1JYKA 1ZCVA 3IOHA 3N9WA 1OCXA 4AC3A 2ZU7A 4AYLA 3JUKA 3FSBA 1ZI5A 3DK5A 1WSZA 1H4CA 4YS8A 5EJZA 1ZJPA 1FGGA 2RJ8A 1KK4A 5FU8A 3ZLLA 3ST8A 1PZTA 5DG3A 4FREA 4Y63A 1HM9A 4CJ8A 4HG6A 1ZI3A 2JF2A 2E3DA 1MR9A 5C4CA 3SXCA 5CMJA 5CQLX 2DPWA 1H3MA 5CQMX 5C49A 2ICXA 1KRVA 3I0HA 5L6SA 2AESA 1VH3A 4KQLA 2V0LA 3RMVA 2Y7AA 2V0IA 1R82A 4G87A 2OEFA 4FCEA 2PX7A 3R1WA 3EEVA 2OEGA 4ASJA 1W77A 4EGGA 1OMZA 2VD4A 3EE5A 1LZIA 4MYOA 3I0JA 3GOSA 2P72A 3OH1A 2XWLA 4EE5A 4CJBA 3HJJA 4EAAA 1ZJ3A 2Z87A 5IDSA 3FS8A 4HCQA 4HZCA 2BO6A 4D0TA 3R5BA 3T7OA 3D98A 2JCJA 2V0KA 5C38A 1TW5A 1HM0A 4B42A 4FRLA 1THJA 3QVBA 1HJLA 1H5SD 1G1LA 3VBNA 3USRA 3TWDA 2VS5A 3BSYA 1T3DA 1LL2A 4FCUA 5CMIA 3MQGA 5C4EA 4AYJA 1FZWA 1FOAA 1MRLA 5C1GA 4DECA 3OKRA 2FFVA 3OU9A 3F1CA 1NHEB 1O7QA 3TV0A 1ZJ2A 1WT1A 3SXGA 1VZXA 1LL0A 3PMOA 2A8UA 4D0ZA 1H7TA 2XWMA 3U0XA 1OQMB 5AFUU 4DE7A 4DDZA
chains in the Genus database with same CATH superfamily
2BO4A 4FRQA 4M28A 4N27A 1H5TB 1GX4A 1QGQA 2I5EA 1ZJ1A 2AM4A 1XATA 2WEEA 3FTTA 3R0SA 1NQIB 4R37A 3OTMA 3C8VA 1NWGB 1V84A 2CU2A 3P47A 1KRUA 3Q4SA 5J49A 1SSMA 4EA7A 5AJPA 2ICYA 3I3AA 1S4PA 2RIJA 4B4GA 1GX0A 4FRDA 4J09A 2FYBA 1NMMB 5FYEA 5CMHA 1NF5B 5L6VA 4D11A 3SXBA 1I52A 3KWDA 4N6AA 4G3PA 4M2BA 1R7YA 2MZBA 1V83A 3CU0A 3F1XA 4FIXA 3DJ4A 5IFYA 1JVDA 1H5RB 3KIAA 3SX7A 4EVWA 3U0YA 3V8ZA 2WGZA 4IRPA 2X65A 1GWWA 3EG4A 4KPZA 4KC1A 5C1LA 3Q80A 2X60A 3OTZA 4Y7UA 4B2WA 3I0IX 2RJ0A 4EEAA 2AM5A 2RJ5A 2RJ6A 1QQ0A 3GQ8A 2RJ4A 4EQYA 2FYCB 5FTSA 3FSXA 1IINA 3F1YA 2FKOA 4NAKA 1ZI1A 5DEPA 2QH5A 3SXEA 4Y7TA 2NPOA 1V82A 3E26A 2WAWA 3MQHA 2RJ7A 2XMHA 3TIOA 3U2TA 2I5KA 1H5SB 2WLEA 3BXYA 3VBIA 1QGSA 4Y9XA 2X5ZA 1V67A 3VBJA 1J2ZA 5HS2A 2P2OA 4G3SA 1TZFA 2JF3A 4ZDQA 3V0LA 3T7MA 2XATA 4EA9A 3R5CA 3CGXA 4MZUA 4HO9A 1M8NA 4KNRA 1EZIA 1H5RA 1QRLA 3V0QA 5C48A 2VSIA 4B4MA 4IRQA 1XHBA 4KRVA 5EJ1A 3CKQA 5CQNX 2TDTA 4E6UA 1FGXA 5C3BA 4BMAA 1FXOA 1MP5A 5AFUV 1ZDFA 4D11C 3OH4A 4KNXA 4FRMA 4K6RA 1QWJA 2VFZA 1G3LA 1NKHB 4M2AA 2VXMA 3OH2A 1R80A 4E1KA 4M98A 4LW3A 5CMGX 4MIXA 5CMFX 1INJA 3V4EA 4EEOA 3MC4A 4HO3A 2X5SA 4EEMA 4N69A 3IGJA 1H7FA 1JV3A 1FO9A 1MP4A 1VGTA 1YP3A 3V0PA 2AQ9A 3OUPA 3GVDA 1VZTA 3LW6A 2VSHA 1G97A 1H5SA 3V8YA 1H7HA 3BRKX 4HURA 4HZDA 5AJNA 1SS9A 4MYBA 3D8VA 3SRTA 3R8YA 2AE7A 3I0KA 1O23B 4CVHA 1ON6A 1G23A 1VPAA 2RJ1A 2O1FA 1FWYA 2QIVX 1KGQA 4E79A 3O3PA 4HO6A 1ZCTA 3SPTA 2P73A 1ZIZA 5C4DA 1O7OA 4LW6A 4KXOA 4M4KA 2A8WA 2PGVA 2V0HA 1VGUA 3I0EA 4CJCA 2QKXA 5JQQA 2YC5A 1QRGA 4KC2A 2VXLA 3IOIA 4Y6NA 1KHRA 1R7UA 1L0SA 3ECTA 4HO8A 1G8OA 3EH0A 2JCOA 1VICA 3OW5A 4AA7A 2YESA 4Y6UA 4B4BA 4MFGA 4FRPA 1QREA 4M99A 3T57A 3VBLA 1H7EA 1PZYB 3HL3A 4E75A 1QG8A 1G95A 3OC9A 5ADXU 3JQYA 1ZI4A 5D92A 1ZJOA 4HOCA 1OMXA 3RMWA 2Y4KA 3TISA 2E8BA 2YQJA 1JV1A 3OGZA 2I7BA 2YQHA 4FRBA 3U2VA 1EWWA 3OH0A 3NGWA 1ZHJA 4G3QA 2V0JA 1LZ7A 3V90A 2IU8A 2W0WA 5D91A 5C4FA 1FO8A 1N4IA 4Y7FA 5F42A 3D5NA 2GGOA 4HO0A 4P00A 3KWEA 4FROA 1S80A 2IU9A 1G9RA 2YQCA 3Q1XA 5C1HA 5FUHA 4B5BA 5FV9A 2WVKA 1FG5N 3OH3A 3JUJA 5FU0A 1G93A 5DEMA 1INIA 1YROB 1KWSA 3I0FA 3SUCA 5C8RA 1QRMA 1R7TA 2NXVA 1H5TA 4UEGA 1Z90A 3GUEA 4D48A 1H7GA 3FSCA 2FYDB 3DHOA 2P6WA 3OAMA 4ARWA 5C4BA 1KGTA 1HJJA 2APCA 2WVLA 3BCVA 3ZGFA 1LZ0A 2VHEA 5I1FA 2Y6PA 5EIYA 2J0BA 1S4OA 1G2VA 4FRHA 3Q7UA 3I3XA 2W0VA 2WLFA 5E3RA 4Y62A 1MC3A 3SX3A 1SSQA 2RITA 3I0LA 4EEGA 2VS4A 1ZDGA 4Y7VA 4B2XA 1VGZA 1WT2A 3CKJA 3FWWA 1VH1A 2JCLA 3U2WA 5C3DA 2O1HA 3K8DA 3R2WA 1TVYA 3CJ8A 4L41C 1EYRA 1JVGA 2J0AA 2IC7A 3I0GA 3CKNA 4JISA 2FYAA 4KPXA 3E25A 2RIYA 5C3AA 5CQOA 4IHHA 4DCLA 3GQAA 1FRWA 5DDVA 1VGWA 2IUAA 3VBMA 1LXAA 1W55A 2WVMA 5E3PA 1R7VA 2FY7A 4EE3A 4HO2A 1E5KA 3RSBA 5E3QA 4AAWA 1GQ9A 1H7LA 2RIXA 3U2UA 3VBPA 4J18A 3R3IA 1TW1A 4E6TA 3I0CA 3DUVA 1K4VA 2ZU8A 3TDTA 3VBKA 3ZF8A 2Y4LA 5AJOA 2RIZA 3BSSA 1ON8A 3SXAA 2BO7A 4KC4A 4FRAA 3V0MA 3IOJA 4HUSA 4FQWA 4NALA 4N6BA 3CKVA 4ECMA 4ISXA 4IHFA 1IIMA 3T7NA 1FR8A 3HSQA 2UX8A 1LZJA 4O6NA 4Y7GA 5CQPA 4B3UA 1LVWA 1MP3A 4NANA 3ZGGA 2OI5A 3TK8A 2AGDA 2YQSA 1H7QA 2FFUA 3POLA 1YP4A 3PKQA 1LL3A 2PGYA 1KK5A 1KK6A 5ADXV 2AM3A 1WT0A 1WVCA 4Y64A 5C47A 4KT7A 1YP2A 3U2XA 2D7IA 1ZCUA 1KQAA 4R7PA 3BFPA 2VS3A 2WLDA 2AECA 4H7OA 1R7XA 3P1BA 3PNNA 3R5AA 5U2KA 1SSTA 3FSYA 3GQ9A 1ZCYA 3CKOA 4R36A 4EA8A 1HM8A 2XMEA 1QRFA 1O0RA 2OI6A 3R5DA 2RJ9A 4NAIA 3V91A 3USQA 4MNDA 3GQ7A 2Y4MA 4BQHA 2AH9A 2Y4JA 2WLGA 1JYLA 3TZTA 2D0JA 1XZ6A 2YC3A 1V3WA 1GQCA 3SX5A 3FOQA 4JD0A 3BSWA 4EABA 1G0RA 2QIAA 4P02A 2ZU9A 5DDTA 3SXDA 3R3RA 1WT3A 1VZUA 3I0DA 5C36A 2D7RA 1TDTA 4C2SA 3VNPA 1W57A 2O1GA 4M9CA 1ZJ0A 3K8EA 3V0NA 3ZLKA 4ASYA 2C0NA 2WE9A 2Z86A 4XWIA 3IXCA 1FR9A 1FXJA 1H4EA 1VM8A 2OI7A 2Q4JA 4HO4A 1S4NA 3PKPA 4HO5A 4GBPA 5IDTA 4IHGA 3NZ2A 1GA8A 2PA4A 2YCMA 3KWCA 1H4DA 2JCKA 3SX8A 2VK9A 5FTVA 3TQDA 5BXCA 1GWVA 1MR7A 1H5SC 2QGIA 3V0OA 2GGQA 2XWNA 1R81A 1XHDA 2BO8A 2WLCA 3JTJA 1HV9A 4EE4A 1KRRA 1JYKA 1ZCVA 3IOHA 3N9WA 1OCXA 4AC3A 2ZU7A 4AYLA 3JUKA 3FSBA 1ZI5A 3DK5A 1WSZA 1H4CA 4YS8A 5EJZA 1ZJPA 1FGGA 2RJ8A 4O6MA 1KK4A 5FU8A 3ZLLA 3ST8A 1PZTA 5DG3A 4FREA 4Y63A 1HM9A 4CJ8A 4HG6A 1ZI3A 2JF2A 2E3DA 1MR9A 5C4CA 4FIYA 3SXCA 5CMJA 5CQLX 2DPWA 1H3MA 5CQMX 5C49A 2ICXA 1KRVA 3I0HA 5L6SA 2AESA 1VH3A 4KQLA 2V0LA 3RMVA 2Y7AA 2V0IA 1R82A 4G87A 2OEFA 4FCEA 2PX7A 3R1WA 3EEVA 2OEGA 4ASJA 1W77A 4EGGA 1OMZA 2VD4A 3EE5A 1LZIA 4MYOA 3I0JA 3GOSA 3OH1A 2P72A 2XWLA 4EE5A 4CJBA 3HJJA 4EAAA 1ZJ3A 2Z87A 4Q7CA 3FS8A 4HCQA 5IDSA 4HZCA 2BO6A 4D0TA 3R5BA 3T7OA 3D98A 2JCJA 2V0KA 5C38A 1TW5A 1HM0A 4B42A 4FRLA 1THJA 3QVBA 1HJLA 1H5SD 1G1LA 3VBNA 3USRA 3TWDA 2VS5A 3BSYA 1T3DA 1LL2A 4FCUA 5CMIA 3MQGA 5C4EA 4AYJA 1FZWA 1FOAA 1MRLA 5C1GA 4DECA 3OKRA 2FFVA 3OU9A 3F1CA 1NHEB 1O7QA 3TV0A 1ZJ2A 1WT1A 3SXGA 1VZXA 1Z2FA 1LL0A 3PMOA 2A8UA 4D0ZA 1H7TA 2XWMA 3U0XA 1OQMB 5AFUU 4DE7A 4DDZA
chains in the Genus database with same CATH topology
2BO4A 4FRQA 4M28A 4N27A 1H5TB 1GX4A 1QGQA 2I5EA 1ZJ1A 2AM4A 1XATA 2WEEA 3FTTA 3R0SA 1NQIB 4R37A 3OTMA 3C8VA 1NWGB 1V84A 2CU2A 3P47A 1KRUA 3Q4SA 5J49A 1SSMA 4EA7A 5AJPA 2ICYA 3I3AA 1S4PA 2RIJA 4B4GA 1GX0A 4FRDA 4J09A 2FYBA 1NMMB 5FYEA 5CMHA 1NF5B 5L6VA 4D11A 3SXBA 1I52A 3KWDA 4N6AA 4G3PA 4M2BA 1R7YA 2MZBA 1V83A 3CU0A 3F1XA 4FIXA 3DJ4A 5IFYA 1JVDA 1H5RB 3KIAA 3SX7A 4EVWA 3U0YA 3V8ZA 2WGZA 4IRPA 2X65A 1GWWA 3EG4A 4KPZA 4KC1A 5C1LA 3Q80A 2X60A 3OTZA 4Y7UA 4B2WA 3I0IX 2RJ0A 4EEAA 2AM5A 2RJ5A 2RJ6A 1QQ0A 2RJ4A 4EQYA 2FYCB 5FTSA 3FSXA 1IINA 3F1YA 2FKOA 4NAKA 1ZI1A 5DEPA 2QH5A 3SXEA 4Y7TA 2NPOA 1V82A 3E26A 2WAWA 3MQHA 2RJ7A 2XMHA 3TIOA 3U2TA 2I5KA 1H5SB 2WLEA 3BXYA 3VBIA 1QGSA 4Y9XA 2X5ZA 1V67A 3VBJA 1J2ZA 5HS2A 2P2OA 4G3SA 1TZFA 2JF3A 4ZDQA 3V0LA 3T7MA 2XATA 4EA9A 3R5CA 3CGXA 4MZUA 4HO9A 3V0QA 4KNRA 1EZIA 1H5RA 1QRLA 5C48A 2VSIA 4B4MA 4IRQA 1XHBA 4KRVA 5EJ1A 3CKQA 5CQNX 2TDTA 4E6UA 1FGXA 5C3BA 4BMAA 1FXOA 1MP5A 5AFUV 1ZDFA 4D11C 3OH4A 4KNXA 4FRMA 4K6RA 1QWJA 2VFZA 1G3LA 1NKHB 4M2AA 2VXMA 1R80A 3OH2A 4E1KA 4M98A 4LW3A 5CMGX 4MIXA 5CMFX 1INJA 3V4EA 4EEOA 3MC4A 4HO3A 2X5SA 4EEMA 4N69A 3IGJA 1H7FA 1JV3A 1FO9A 1MP4A 1VGTA 1YP3A 3V0PA 2AQ9A 3OUPA 3GVDA 1VZTA 3LW6A 2VSHA 1G97A 1H5SA 3V8YA 1H7HA 3BRKX 4HURA 4HZDA 5AJNA 1SS9A 4MYBA 3D8VA 3SRTA 3R8YA 2AE7A 3I0KA 1O23B 4CVHA 1ON6A 1G23A 1VPAA 2RJ1A 2O1FA 1FWYA 2QIVX 1KGQA 4E79A 3O3PA 4HO6A 1ZCTA 3SPTA 2P73A 1ZIZA 5C4DA 1O7OA 4LW6A 4KXOA 4M4KA 2A8WA 2PGVA 2V0HA 1VGUA 3I0EA 4CJCA 2QKXA 5JQQA 2YC5A 1QRGA 4KC2A 2VXLA 3IOIA 4Y6NA 1KHRA 1R7UA 3ECTA 4HO8A 1G8OA 3EH0A 2JCOA 1VICA 3OW5A 4AA7A 2YESA 4Y6UA 4B4BA 4MFGA 4FRPA 1QREA 4M99A 3T57A 3VBLA 1H7EA 1PZYB 3HL3A 4E75A 1QG8A 1G95A 3OC9A 5ADXU 3JQYA 1ZI4A 5D92A 1ZJOA 4HOCA 1OMXA 3RMWA 2Y4KA 3TISA 2E8BA 2YQJA 1JV1A 2I7BA 2YQHA 3OGZA 4FRBA 3U2VA 3NGWA 3OH0A 1ZHJA 4G3QA 2V0JA 1LZ7A 3V90A 2IU8A 2W0WA 5D91A 5C4FA 1FO8A 4Y7FA 5F42A 3D5NA 2GGOA 4HO0A 4P00A 3KWEA 4FROA 1S80A 2IU9A 1G9RA 2YQCA 3Q1XA 5C1HA 5FUHA 4B5BA 5FV9A 2WVKA 1FG5N 3OH3A 3JUJA 5FU0A 1G93A 5DEMA 1INIA 1YROB 1KWSA 3I0FA 5C8RA 1QRMA 1R7TA 2NXVA 1H5TA 4UEGA 1Z90A 3GUEA 4D48A 1H7GA 3FSCA 2FYDB 3DHOA 2P6WA 3OAMA 4ARWA 5C4BA 1KGTA 1HJJA 2APCA 2WVLA 3BCVA 3ZGFA 1LZ0A 2VHEA 5I1FA 2Y6PA 5EIYA 2J0BA 1S4OA 1G2VA 4FRHA 3Q7UA 3I3XA 2W0VA 2WLFA 5E3RA 4Y62A 1MC3A 3SX3A 1SSQA 2RITA 3I0LA 4EEGA 2VS4A 1ZDGA 4Y7VA 4B2XA 1VGZA 1WT2A 3CKJA 3FWWA 1VH1A 2JCLA 3U2WA 5C3DA 2O1HA 3K8DA 3R2WA 1TVYA 3CJ8A 4L41C 1EYRA 1JVGA 2J0AA 2IC7A 3I0GA 3CKNA 4JISA 2FYAA 4KPXA 3E25A 2RIYA 5C3AA 5CQOA 4IHHA 4DCLA 1FRWA 5DDVA 1VGWA 2IUAA 3VBMA 1LXAA 1W55A 2WVMA 5E3PA 1R7VA 2FY7A 4EE3A 4HO2A 1E5KA 3RSBA 5E3QA 4AAWA 1GQ9A 1H7LA 2RIXA 3U2UA 3VBPA 4J18A 3R3IA 1TW1A 4E6TA 3I0CA 3DUVA 1K4VA 2ZU8A 3TDTA 3VBKA 3ZF8A 2Y4LA 5AJOA 2RIZA 3BSSA 1ON8A 3SXAA 2BO7A 4KC4A 4FRAA 3V0MA 3IOJA 4HUSA 4FQWA 4NALA 4N6BA 3CKVA 4ECMA 4ISXA 4IHFA 1IIMA 3T7NA 1FR8A 3HSQA 2UX8A 1LZJA 4O6NA 4Y7GA 5CQPA 4B3UA 1LVWA 1MP3A 4NANA 3ZGGA 2OI5A 3TK8A 2AGDA 2YQSA 1H7QA 2FFUA 3POLA 1YP4A 3PKQA 1LL3A 2PGYA 1KK5A 1KK6A 5ADXV 2AM3A 1WT0A 1WVCA 4Y64A 5C47A 4KT7A 1YP2A 3U2XA 2D7IA 1ZCUA 1KQAA 4R7PA 3BFPA 2VS3A 2WLDA 2AECA 4H7OA 1R7XA 3P1BA 3PNNA 3R5AA 5U2KA 1SSTA 3FSYA 1ZCYA 3CKOA 4R36A 4EA8A 1HM8A 2XMEA 1QRFA 1O0RA 2OI6A 3R5DA 2RJ9A 4NAIA 3V91A 3USQA 4MNDA 2Y4MA 4BQHA 2AH9A 2Y4JA 2WLGA 1JYLA 3TZTA 2D0JA 1XZ6A 2YC3A 1V3WA 1GQCA 3SX5A 3FOQA 4JD0A 3BSWA 4EABA 1G0RA 2QIAA 4P02A 2ZU9A 5DDTA 3SXDA 3R3RA 1WT3A 1VZUA 3I0DA 5C36A 2D7RA 1TDTA 4C2SA 3VNPA 1W57A 2O1GA 4M9CA 1ZJ0A 3K8EA 3V0NA 3ZLKA 4ASYA 2C0NA 2WE9A 2Z86A 4XWIA 3IXCA 1FR9A 1FXJA 1H4EA 1VM8A 2OI7A 2Q4JA 4HO4A 1S4NA 3PKPA 4HO5A 4GBPA 5IDTA 4IHGA 3NZ2A 1GA8A 2PA4A 2YCMA 3KWCA 1H4DA 2JCKA 3SX8A 2VK9A 5FTVA 3TQDA 5BXCA 1GWVA 1MR7A 1H5SC 2QGIA 3V0OA 2GGQA 2XWNA 1R81A 1XHDA 2BO8A 2WLCA 3JTJA 1HV9A 4EE4A 1KRRA 1JYKA 1ZCVA 3IOHA 3N9WA 1OCXA 4AC3A 2ZU7A 4AYLA 3JUKA 3FSBA 1ZI5A 3DK5A 1WSZA 1H4CA 4YS8A 5EJZA 1ZJPA 1FGGA 2RJ8A 4O6MA 1KK4A 5FU8A 3ZLLA 3ST8A 1PZTA 5DG3A 4FREA 4Y63A 1HM9A 4CJ8A 4HG6A 1ZI3A 2JF2A 2E3DA 1MR9A 5C4CA 4FIYA 3SXCA 5CMJA 5CQLX 2DPWA 1H3MA 5CQMX 5C49A 2ICXA 1KRVA 3I0HA 5L6SA 2AESA 1VH3A 4KQLA 2V0LA 3RMVA 2Y7AA 2V0IA 1R82A 4G87A 2OEFA 4FCEA 2PX7A 3R1WA 3EEVA 2OEGA 4ASJA 1W77A 4EGGA 1OMZA 2VD4A 3EE5A 1LZIA 4MYOA 3I0JA 3GOSA 2P72A 3OH1A 2XWLA 4EE5A 4CJBA 3HJJA 4EAAA 1ZJ3A 2Z87A 4Q7CA 3FS8A 4HCQA 5IDSA 4HZCA 2BO6A 4D0TA 3R5BA 3T7OA 3D98A 2JCJA 2V0KA 5C38A 1TW5A 1HM0A 4B42A 4FRLA 1THJA 3QVBA 1HJLA 1H5SD 1G1LA 3VBNA 3USRA 3TWDA 2VS5A 3BSYA 1T3DA 1LL2A 4FCUA 5CMIA 3MQGA 5C4EA 4AYJA 1FZWA 1FOAA 1MRLA 5C1GA 4DECA 3OKRA 2FFVA 3OU9A 3F1CA 1NHEB 1O7QA 3TV0A 1ZJ2A 1WT1A 3SXGA 1VZXA 1LL0A 3PMOA 2A8UA 4D0ZA 1H7TA 2XWMA 3U0XA 1OQMB 5AFUU 4DE7A 4DDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO4 A;  4FRQ A;  4M28 A;  4N27 A;  1H5T B;  1GX4 A;  1QGQ A;  2I5E A;  1ZJ1 A;  2AM4 A;  1XAT A;  2WEE A;  3FTT A;  3R0S A;  1NQI B;  4R37 A;  3OTM A;  3C8V A;  1NWG B;  1V84 A;  2CU2 A;  3P47 A;  1KRU A;  3Q4S A;  5J49 A;  1SSM A;  4EA7 A;  5AJP A;  2ICY A;  3I3A A;  1S4P A;  2RIJ A;  4B4G A;  1GX0 A;  4FRD A;  4J09 A;  2FYB A;  1NMM B;  5FYE A;  5CMH A;  1NF5 B;  5L6V A;  4D11 A;  3SXB A;  1I52 A;  3KWD A;  4N6A A;  4G3P A;  4M2B A;  1R7Y A;  2MZB A;  1V83 A;  3CU0 A;  3F1X A;  3DJ4 A;  5IFY A;  1JVD A;  1H5R B;  3KIA A;  3SX7 A;  4EVW A;  3U0Y A;  3V8Z A;  2WGZ A;  4IRP A;  2X65 A;  1GWW A;  3EG4 A;  4KPZ A;  4KC1 A;  5C1L A;  3Q80 A;  2X60 A;  3OTZ A;  4Y7U A;  4B2W A;  3I0I X;  2RJ0 A;  4EEA A;  2AM5 A;  2RJ5 A;  2RJ6 A;  1QQ0 A;  2RJ4 A;  4EQY A;  2FYC B;  5FTS A;  3FSX A;  1IIN A;  3F1Y A;  2FKO A;  4NAK A;  1ZI1 A;  5DEP A;  2QH5 A;  3SXE A;  4Y7T A;  2NPO A;  1V82 A;  3E26 A;  2WAW A;  3MQH A;  2RJ7 A;  2XMH A;  3TIO A;  3U2T A;  2I5K A;  1H5S B;  2WLE A;  3BXY A;  3VBI A;  1QGS A;  4Y9X A;  2X5Z A;  1V67 A;  3VBJ A;  1J2Z A;  5HS2 A;  2P2O A;  4G3S A;  1TZF A;  2JF3 A;  4ZDQ A;  3V0L A;  3T7M A;  2XAT A;  4EA9 A;  3R5C A;  3CGX A;  4MZU A;  4HO9 A;  3V0Q A;  4KNR A;  1EZI A;  1H5R A;  1QRL A;  5C48 A;  2VSI A;  4B4M A;  4IRQ A;  1XHB A;  4KRV A;  5EJ1 A;  3CKQ A;  5CQN X;  2TDT A;  4E6U A;  1FGX A;  5C3B A;  4BMA A;  1FXO A;  1MP5 A;  5AFU V;  1ZDF A;  4D11 C;  3OH4 A;  4KNX A;  4FRM A;  4K6R A;  1QWJ A;  2VFZ A;  1G3L A;  1NKH B;  4M2A A;  2VXM A;  1R80 A;  3OH2 A;  4E1K A;  4M98 A;  4LW3 A;  5CMG X;  5CMF X;  1INJ A;  3V4E A;  4EEO A;  3MC4 A;  4HO3 A;  2X5S A;  4EEM A;  4N69 A;  3IGJ A;  1H7F A;  1JV3 A;  1FO9 A;  1MP4 A;  1VGT A;  1YP3 A;  3V0P A;  2AQ9 A;  3OUP A;  3GVD A;  1VZT A;  3LW6 A;  2VSH A;  1G97 A;  1H5S A;  3V8Y A;  1H7H A;  3BRK X;  4HUR A;  4HZD A;  5AJN A;  1SS9 A;  4MYB A;  3D8V A;  3SRT A;  3R8Y A;  2AE7 A;  3I0K A;  1O23 B;  4CVH A;  1ON6 A;  1G23 A;  1VPA A;  2RJ1 A;  2O1F A;  1FWY A;  2QIV X;  1KGQ A;  4E79 A;  3O3P A;  4HO6 A;  1ZCT A;  3SPT A;  2P73 A;  1ZIZ A;  5C4D A;  1O7O A;  4LW6 A;  4KXO A;  4M4K A;  2A8W A;  2PGV A;  2V0H A;  1VGU A;  3I0E A;  4CJC A;  2QKX A;  5JQQ A;  2YC5 A;  1QRG A;  4KC2 A;  2VXL A;  3IOI A;  4Y6N A;  1KHR A;  1R7U A;  3ECT A;  4HO8 A;  1G8O A;  3EH0 A;  2JCO A;  1VIC A;  3OW5 A;  4AA7 A;  2YES A;  4Y6U A;  4B4B A;  4MFG A;  4FRP A;  1QRE A;  4M99 A;  3T57 A;  3VBL A;  1H7E A;  1PZY B;  3HL3 A;  4E75 A;  1QG8 A;  1G95 A;  3OC9 A;  5ADX U;  3JQY A;  1ZI4 A;  1ZJO A;  4HOC A;  1OMX A;  3RMW A;  2Y4K A;  3TIS A;  2E8B A;  2YQJ A;  1JV1 A;  2I7B A;  2YQH A;  3OGZ A;  4FRB A;  3U2V A;  3NGW A;  3OH0 A;  1ZHJ A;  4G3Q A;  2V0J A;  1LZ7 A;  3V90 A;  2IU8 A;  2W0W A;  5C4F A;  1FO8 A;  4Y7F A;  5F42 A;  3D5N A;  2GGO A;  4HO0 A;  4P00 A;  3KWE A;  4FRO A;  1S80 A;  2IU9 A;  1G9R A;  2YQC A;  3Q1X A;  5C1H A;  5FUH A;  4B5B A;  5FV9 A;  2WVK A;  1FG5 N;  3OH3 A;  3JUJ A;  5FU0 A;  1G93 A;  5DEM A;  1INI A;  1YRO B;  1KWS A;  3I0F A;  5C8R A;  1QRM A;  1R7T A;  2NXV A;  1H5T A;  4UEG A;  1Z90 A;  3GUE A;  4D48 A;  1H7G A;  3FSC A;  2FYD B;  3DHO A;  2P6W A;  3OAM A;  4ARW A;  5C4B A;  1KGT A;  1HJJ A;  2APC A;  2WVL A;  3BCV A;  3ZGF A;  1LZ0 A;  2VHE A;  5I1F A;  2Y6P A;  5EIY A;  1S4O A;  1G2V A;  4FRH A;  3Q7U A;  3I3X A;  2W0V A;  2WLF A;  5E3R A;  4Y62 A;  1MC3 A;  3SX3 A;  1SSQ A;  2RIT A;  3I0L A;  4EEG A;  2VS4 A;  1ZDG A;  4Y7V A;  4B2X A;  1VGZ A;  1WT2 A;  3CKJ A;  3FWW A;  1VH1 A;  2JCL A;  3U2W A;  5C3D A;  2O1H A;  3K8D A;  3R2W A;  1TVY A;  3CJ8 A;  4L41 C;  1EYR A;  1JVG A;  2IC7 A;  3I0G A;  3CKN A;  4JIS A;  2FYA A;  4KPX A;  3E25 A;  2RIY A;  5C3A A;  5CQO A;  4IHH A;  4DCL A;  1FRW A;  5DDV A;  1VGW A;  2IUA A;  3VBM A;  1LXA A;  1W55 A;  2WVM A;  5E3P A;  1R7V A;  2FY7 A;  4EE3 A;  4HO2 A;  1E5K A;  3RSB A;  5E3Q A;  4AAW A;  1GQ9 A;  1H7L A;  2RIX A;  3U2U A;  3VBP A;  4J18 A;  3R3I A;  1TW1 A;  4E6T A;  3I0C A;  3DUV A;  1K4V A;  2ZU8 A;  3TDT A;  3VBK A;  3ZF8 A;  2Y4L A;  5AJO A;  2RIZ A;  3BSS A;  1ON8 A;  3SXA A;  2BO7 A;  4KC4 A;  4FRA A;  3V0M A;  3IOJ A;  4HUS A;  4FQW A;  4NAL A;  4N6B A;  3CKV A;  4ECM A;  4ISX A;  4IHF A;  1IIM A;  3T7N A;  1FR8 A;  3HSQ A;  2UX8 A;  1LZJ A;  5CQP A;  4Y7G A;  4B3U A;  1LVW A;  1MP3 A;  4NAN A;  3ZGG A;  2OI5 A;  3TK8 A;  2AGD A;  2YQS A;  1H7Q A;  2FFU A;  3POL A;  1YP4 A;  3PKQ A;  1LL3 A;  2PGY A;  1KK5 A;  1KK6 A;  5ADX V;  2AM3 A;  1WT0 A;  1WVC A;  4Y64 A;  5C47 A;  4KT7 A;  1YP2 A;  3U2X A;  2D7I A;  1ZCU A;  1KQA A;  4R7P A;  3BFP A;  2VS3 A;  2WLD A;  2AEC A;  4H7O A;  1R7X A;  3P1B A;  3PNN A;  3R5A A;  5U2K A;  1SST A;  3FSY A;  1ZCY A;  3CKO A;  4R36 A;  4EA8 A;  1HM8 A;  2XME A;  1QRF A;  1O0R A;  2OI6 A;  3R5D A;  2RJ9 A;  4NAI A;  3V91 A;  3USQ A;  4MND A;  2Y4M A;  4BQH A;  2AH9 A;  2Y4J A;  2WLG A;  1JYL A;  3TZT A;  2D0J A;  1XZ6 A;  2YC3 A;  1V3W A;  1GQC A;  3SX5 A;  3FOQ A;  4JD0 A;  3BSW A;  4EAB A;  1G0R A;  2QIA A;  4P02 A;  2ZU9 A;  5DDT A;  3SXD A;  3R3R A;  1WT3 A;  1VZU A;  3I0D A;  5C36 A;  2D7R A;  1TDT A;  4C2S A;  3VNP A;  1W57 A;  2O1G A;  4M9C A;  1ZJ0 A;  3K8E A;  3V0N A;  3ZLK A;  4ASY A;  2WE9 A;  2Z86 A;  4XWI A;  3IXC A;  1FR9 A;  1FXJ A;  1H4E A;  1VM8 A;  2OI7 A;  2Q4J A;  4HO4 A;  1S4N A;  3PKP A;  4HO5 A;  4GBP A;  5IDT A;  4IHG A;  3NZ2 A;  1GA8 A;  2PA4 A;  2YCM A;  3KWC A;  1H4D A;  2JCK A;  3SX8 A;  5FTV A;  3TQD A;  5BXC A;  1GWV A;  1MR7 A;  1H5S C;  2QGI A;  3V0O A;  2GGQ A;  2XWN A;  1R81 A;  1XHD A;  2BO8 A;  2WLC A;  3JTJ A;  1HV9 A;  4EE4 A;  1KRR A;  1JYK A;  1ZCV A;  3IOH A;  3N9W A;  1OCX A;  4AC3 A;  2ZU7 A;  4AYL A;  3JUK A;  3FSB A;  1ZI5 A;  3DK5 A;  1WSZ A;  1H4C A;  4YS8 A;  5EJZ A;  1ZJP A;  1FGG A;  2RJ8 A;  1KK4 A;  5FU8 A;  3ZLL A;  3ST8 A;  1PZT A;  5DG3 A;  4FRE A;  4Y63 A;  1HM9 A;  4CJ8 A;  4HG6 A;  1ZI3 A;  2JF2 A;  2E3D A;  1MR9 A;  5C4C A;  3SXC A;  5CMJ A;  5CQL X;  2DPW A;  1H3M A;  5CQM X;  5C49 A;  2ICX A;  1KRV A;  3I0H A;  5L6S A;  2AES A;  1VH3 A;  4KQL A;  2V0L A;  3RMV A;  2Y7A A;  2V0I A;  1R82 A;  4G87 A;  2OEF A;  4FCE A;  2PX7 A;  3R1W A;  3EEV A;  2OEG A;  4ASJ A;  1W77 A;  4EGG A;  1OMZ A;  2VD4 A;  3EE5 A;  1LZI A;  4MYO A;  3I0J A;  3GOS A;  2P72 A;  3OH1 A;  2XWL A;  4EE5 A;  4CJB A;  3HJJ A;  4EAA A;  1ZJ3 A;  2Z87 A;  5IDS A;  3FS8 A;  4HCQ A;  4HZC A;  2BO6 A;  4D0T A;  3R5B A;  3T7O A;  3D98 A;  2JCJ A;  2V0K A;  5C38 A;  1TW5 A;  1HM0 A;  4B42 A;  4FRL A;  1THJ A;  3QVB A;  1HJL A;  1H5S D;  1G1L A;  3VBN A;  3USR A;  3TWD A;  2VS5 A;  3BSY A;  1T3D A;  1LL2 A;  4FCU A;  5CMI A;  3MQG A;  5C4E A;  4AYJ A;  1FZW A;  1FOA A;  1MRL A;  5C1G A;  4DEC A;  3OKR A;  2FFV A;  3OU9 A;  3F1C A;  1NHE B;  1O7Q A;  3TV0 A;  1ZJ2 A;  1WT1 A;  3SXG A;  1VZX A;  1LL0 A;  3PMO A;  2A8U A;  4D0Z A;  1H7T A;  2XWM A;  3U0X A;  1OQM B;  5AFU U;  4DE7 A;  4DDZ A; 
#chains in the Genus database with same CATH topology
 2BO4 A;  4FRQ A;  4M28 A;  4N27 A;  1H5T B;  1GX4 A;  1QGQ A;  2I5E A;  1ZJ1 A;  2AM4 A;  1XAT A;  2WEE A;  3FTT A;  3R0S A;  1NQI B;  4R37 A;  3OTM A;  3C8V A;  1NWG B;  1V84 A;  2CU2 A;  3P47 A;  1KRU A;  3Q4S A;  5J49 A;  1SSM A;  4EA7 A;  5AJP A;  2ICY A;  3I3A A;  1S4P A;  2RIJ A;  4B4G A;  1GX0 A;  4FRD A;  4J09 A;  2FYB A;  1NMM B;  5FYE A;  5CMH A;  1NF5 B;  5L6V A;  4D11 A;  3SXB A;  1I52 A;  3KWD A;  4N6A A;  4G3P A;  4M2B A;  1R7Y A;  2MZB A;  1V83 A;  3CU0 A;  3F1X A;  4FIX A;  3DJ4 A;  5IFY A;  1JVD A;  1H5R B;  3KIA A;  3SX7 A;  4EVW A;  3U0Y A;  3V8Z A;  2WGZ A;  4IRP A;  2X65 A;  1GWW A;  3EG4 A;  4KPZ A;  4KC1 A;  5C1L A;  3Q80 A;  2X60 A;  3OTZ A;  4Y7U A;  4B2W A;  3I0I X;  2RJ0 A;  4EEA A;  2AM5 A;  2RJ5 A;  2RJ6 A;  1QQ0 A;  3GQ8 A;  2RJ4 A;  4EQY A;  2FYC B;  5FTS A;  3FSX A;  1IIN A;  3F1Y A;  2FKO A;  4NAK A;  1ZI1 A;  5DEP A;  2QH5 A;  3SXE A;  4Y7T A;  2NPO A;  1V82 A;  3E26 A;  2WAW A;  3MQH A;  2RJ7 A;  2XMH A;  3TIO A;  3U2T A;  2I5K A;  1H5S B;  2WLE A;  3BXY A;  3VBI A;  1QGS A;  4Y9X A;  2X5Z A;  1V67 A;  3VBJ A;  1J2Z A;  5HS2 A;  2P2O A;  4G3S A;  1TZF A;  2JF3 A;  4ZDQ A;  3V0L A;  3T7M A;  2XAT A;  4EA9 A;  3R5C A;  3CGX A;  4MZU A;  4HO9 A;  1M8N A;  4KNR A;  1EZI A;  1H5R A;  1QRL A;  3V0Q A;  5C48 A;  2VSI A;  4B4M A;  4IRQ A;  1XHB A;  4KRV A;  5EJ1 A;  3CKQ A;  5CQN X;  2TDT A;  4E6U A;  1FGX A;  5C3B A;  4BMA A;  1FXO A;  1MP5 A;  5AFU V;  1ZDF A;  4D11 C;  3OH4 A;  4KNX A;  4FRM A;  4K6R A;  1QWJ A;  2VFZ A;  1G3L A;  1NKH B;  4M2A A;  2VXM A;  3OH2 A;  1R80 A;  4E1K A;  4M98 A;  4LW3 A;  5CMG X;  4MIX A;  5CMF X;  1INJ A;  3V4E A;  4EEO A;  3MC4 A;  4HO3 A;  2X5S A;  4EEM A;  4N69 A;  3IGJ A;  1H7F A;  1JV3 A;  1FO9 A;  1MP4 A;  1VGT A;  1YP3 A;  3V0P A;  2AQ9 A;  3OUP A;  3GVD A;  1VZT A;  3LW6 A;  2VSH A;  1G97 A;  1H5S A;  3V8Y A;  1H7H A;  3BRK X;  4HUR A;  4HZD A;  5AJN A;  1SS9 A;  4MYB A;  3D8V A;  3SRT A;  3R8Y A;  2AE7 A;  3I0K A;  1O23 B;  4CVH A;  1ON6 A;  1G23 A;  1VPA A;  2RJ1 A;  2O1F A;  1FWY A;  2QIV X;  1KGQ A;  4E79 A;  3O3P A;  4HO6 A;  1ZCT A;  3SPT A;  2P73 A;  1ZIZ A;  5C4D A;  1O7O A;  4LW6 A;  4KXO A;  4M4K A;  2A8W A;  2PGV A;  2V0H A;  1VGU A;  3I0E A;  4CJC A;  2QKX A;  5JQQ A;  2YC5 A;  1QRG A;  4KC2 A;  2VXL A;  3IOI A;  4Y6N A;  1KHR A;  1R7U A;  1L0S A;  3ECT A;  4HO8 A;  1G8O A;  3EH0 A;  2JCO A;  1VIC A;  3OW5 A;  4AA7 A;  2YES A;  4Y6U A;  4B4B A;  4MFG A;  4FRP A;  1QRE A;  4M99 A;  3T57 A;  3VBL A;  1H7E A;  1PZY B;  3HL3 A;  4E75 A;  1QG8 A;  1G95 A;  3OC9 A;  5ADX U;  3JQY A;  1ZI4 A;  5D92 A;  1ZJO A;  4HOC A;  1OMX A;  3RMW A;  2Y4K A;  3TIS A;  2E8B A;  2YQJ A;  1JV1 A;  3OGZ A;  2I7B A;  2YQH A;  4FRB A;  3U2V A;  1EWW A;  3OH0 A;  3NGW A;  1ZHJ A;  4G3Q A;  2V0J A;  1LZ7 A;  3V90 A;  2IU8 A;  2W0W A;  5D91 A;  5C4F A;  1FO8 A;  1N4I A;  4Y7F A;  5F42 A;  3D5N A;  2GGO A;  4HO0 A;  4P00 A;  3KWE A;  4FRO A;  1S80 A;  2IU9 A;  1G9R A;  2YQC A;  3Q1X A;  5C1H A;  5FUH A;  4B5B A;  5FV9 A;  2WVK A;  1FG5 N;  3OH3 A;  3JUJ A;  5FU0 A;  1G93 A;  5DEM A;  1INI A;  1YRO B;  1KWS A;  3I0F A;  3SUC A;  5C8R A;  1QRM A;  1R7T A;  2NXV A;  1H5T A;  4UEG A;  1Z90 A;  3GUE A;  4D48 A;  1H7G A;  3FSC A;  2FYD B;  3DHO A;  2P6W A;  3OAM A;  4ARW A;  5C4B A;  1KGT A;  1HJJ A;  2APC A;  2WVL A;  3BCV A;  3ZGF A;  1LZ0 A;  2VHE A;  5I1F A;  2Y6P A;  5EIY A;  2J0B A;  1S4O A;  1G2V A;  4FRH A;  3Q7U A;  3I3X A;  2W0V A;  2WLF A;  5E3R A;  4Y62 A;  1MC3 A;  3SX3 A;  1SSQ A;  2RIT A;  3I0L A;  4EEG A;  2VS4 A;  1ZDG A;  4Y7V A;  4B2X A;  1VGZ A;  1WT2 A;  3CKJ A;  3FWW A;  1VH1 A;  2JCL A;  3U2W A;  5C3D A;  2O1H A;  3K8D A;  3R2W A;  1TVY A;  3CJ8 A;  4L41 C;  1EYR A;  1JVG A;  2J0A A;  2IC7 A;  3I0G A;  3CKN A;  4JIS A;  2FYA A;  4KPX A;  3E25 A;  2RIY A;  5C3A A;  5CQO A;  4IHH A;  4DCL A;  3GQA A;  1FRW A;  5DDV A;  1VGW A;  2IUA A;  3VBM A;  1LXA A;  1W55 A;  2WVM A;  5E3P A;  1R7V A;  2FY7 A;  4EE3 A;  4HO2 A;  1E5K A;  3RSB A;  5E3Q A;  4AAW A;  1GQ9 A;  1H7L A;  2RIX A;  3U2U A;  3VBP A;  4J18 A;  3R3I A;  1TW1 A;  4E6T A;  3I0C A;  3DUV A;  1K4V A;  2ZU8 A;  3TDT A;  3VBK A;  3ZF8 A;  2Y4L A;  5AJO A;  2RIZ A;  3BSS A;  1ON8 A;  3SXA A;  2BO7 A;  4KC4 A;  4FRA A;  3V0M A;  3IOJ A;  4HUS A;  4FQW A;  4NAL A;  4N6B A;  3CKV A;  4ECM A;  4ISX A;  4IHF A;  1IIM A;  3T7N A;  1FR8 A;  3HSQ A;  2UX8 A;  1LZJ A;  4O6N A;  4Y7G A;  5CQP A;  4B3U A;  1LVW A;  1MP3 A;  4NAN A;  3ZGG A;  2OI5 A;  3TK8 A;  2AGD A;  2YQS A;  1H7Q A;  2FFU A;  3POL A;  1YP4 A;  3PKQ A;  1LL3 A;  2PGY A;  1KK5 A;  1KK6 A;  5ADX V;  2AM3 A;  1WT0 A;  1WVC A;  4Y64 A;  5C47 A;  4KT7 A;  1YP2 A;  3U2X A;  2D7I A;  1ZCU A;  1KQA A;  4R7P A;  3BFP A;  2VS3 A;  2WLD A;  2AEC A;  4H7O A;  1R7X A;  3P1B A;  3PNN A;  3R5A A;  5U2K A;  1SST A;  3FSY A;  3GQ9 A;  1ZCY A;  3CKO A;  4R36 A;  4EA8 A;  1HM8 A;  2XME A;  1QRF A;  1O0R A;  2OI6 A;  3R5D A;  2RJ9 A;  4NAI A;  3V91 A;  3USQ A;  4MND A;  3GQ7 A;  2Y4M A;  4BQH A;  2AH9 A;  2Y4J A;  2WLG A;  1JYL A;  3TZT A;  2D0J A;  1XZ6 A;  2YC3 A;  1V3W A;  1GQC A;  3SX5 A;  3FOQ A;  4JD0 A;  3BSW A;  4EAB A;  1G0R A;  2QIA A;  4P02 A;  2ZU9 A;  5DDT A;  3SXD A;  3R3R A;  1WT3 A;  1VZU A;  3I0D A;  5C36 A;  2D7R A;  1TDT A;  4C2S A;  3VNP A;  1W57 A;  2O1G A;  4M9C A;  1ZJ0 A;  3K8E A;  3V0N A;  3ZLK A;  4ASY A;  2C0N A;  2WE9 A;  2Z86 A;  4XWI A;  3IXC A;  1FR9 A;  1FXJ A;  1H4E A;  1VM8 A;  2OI7 A;  2Q4J A;  4HO4 A;  1S4N A;  3PKP A;  4HO5 A;  4GBP A;  5IDT A;  4IHG A;  3NZ2 A;  1GA8 A;  2PA4 A;  2YCM A;  3KWC A;  1H4D A;  2JCK A;  3SX8 A;  2VK9 A;  5FTV A;  3TQD A;  5BXC A;  1GWV A;  1MR7 A;  1H5S C;  2QGI A;  3V0O A;  2GGQ A;  2XWN A;  1R81 A;  1XHD A;  2BO8 A;  2WLC A;  3JTJ A;  1HV9 A;  4EE4 A;  1KRR A;  1JYK A;  1ZCV A;  3IOH A;  3N9W A;  1OCX A;  4AC3 A;  2ZU7 A;  4AYL A;  3JUK A;  3FSB A;  1ZI5 A;  3DK5 A;  1WSZ A;  1H4C A;  4YS8 A;  5EJZ A;  1ZJP A;  1FGG A;  2RJ8 A;  4O6M A;  1KK4 A;  5FU8 A;  3ZLL A;  3ST8 A;  1PZT A;  5DG3 A;  4FRE A;  4Y63 A;  1HM9 A;  4CJ8 A;  4HG6 A;  1ZI3 A;  2JF2 A;  2E3D A;  1MR9 A;  5C4C A;  4FIY A;  3SXC A;  5CMJ A;  5CQL X;  2DPW A;  1H3M A;  5CQM X;  5C49 A;  2ICX A;  1KRV A;  3I0H A;  5L6S A;  2AES A;  1VH3 A;  4KQL A;  2V0L A;  3RMV A;  2Y7A A;  2V0I A;  1R82 A;  4G87 A;  2OEF A;  4FCE A;  2PX7 A;  3R1W A;  3EEV A;  2OEG A;  4ASJ A;  1W77 A;  4EGG A;  1OMZ A;  2VD4 A;  3EE5 A;  1LZI A;  4MYO A;  3I0J A;  3GOS A;  3OH1 A;  2P72 A;  2XWL A;  4EE5 A;  4CJB A;  3HJJ A;  4EAA A;  1ZJ3 A;  2Z87 A;  4Q7C A;  3FS8 A;  4HCQ A;  5IDS A;  4HZC A;  2BO6 A;  4D0T A;  3R5B A;  3T7O A;  3D98 A;  2JCJ A;  2V0K A;  5C38 A;  1TW5 A;  1HM0 A;  4B42 A;  4FRL A;  1THJ A;  3QVB A;  1HJL A;  1H5S D;  1G1L A;  3VBN A;  3USR A;  3TWD A;  2VS5 A;  3BSY A;  1T3D A;  1LL2 A;  4FCU A;  5CMI A;  3MQG A;  5C4E A;  4AYJ A;  1FZW A;  1FOA A;  1MRL A;  5C1G A;  4DEC A;  3OKR A;  2FFV A;  3OU9 A;  3F1C A;  1NHE B;  1O7Q A;  3TV0 A;  1ZJ2 A;  1WT1 A;  3SXG A;  1VZX A;  1Z2F A;  1LL0 A;  3PMO A;  2A8U A;  4D0Z A;  1H7T A;  2XWM A;  3U0X A;  1OQM B;  5AFU U;  4DE7 A;  4DDZ A; 
#chains in the Genus database with same CATH homology
 2BO4 A;  4FRQ A;  4M28 A;  4N27 A;  1H5T B;  1GX4 A;  1QGQ A;  2I5E A;  1ZJ1 A;  2AM4 A;  1XAT A;  2WEE A;  3FTT A;  3R0S A;  1NQI B;  4R37 A;  3OTM A;  3C8V A;  1NWG B;  1V84 A;  2CU2 A;  3P47 A;  1KRU A;  3Q4S A;  5J49 A;  1SSM A;  4EA7 A;  5AJP A;  2ICY A;  3I3A A;  1S4P A;  2RIJ A;  4B4G A;  1GX0 A;  4FRD A;  4J09 A;  2FYB A;  1NMM B;  5FYE A;  5CMH A;  1NF5 B;  5L6V A;  4D11 A;  3SXB A;  1I52 A;  3KWD A;  4N6A A;  4G3P A;  4M2B A;  1R7Y A;  2MZB A;  1V83 A;  3CU0 A;  3F1X A;  4FIX A;  3DJ4 A;  5IFY A;  1JVD A;  1H5R B;  3KIA A;  3SX7 A;  4EVW A;  3U0Y A;  3V8Z A;  2WGZ A;  4IRP A;  2X65 A;  1GWW A;  3EG4 A;  4KPZ A;  4KC1 A;  5C1L A;  3Q80 A;  2X60 A;  3OTZ A;  4Y7U A;  4B2W A;  3I0I X;  2RJ0 A;  4EEA A;  2AM5 A;  2RJ5 A;  2RJ6 A;  1QQ0 A;  2RJ4 A;  4EQY A;  2FYC B;  5FTS A;  3FSX A;  1IIN A;  3F1Y A;  2FKO A;  4NAK A;  1ZI1 A;  5DEP A;  2QH5 A;  3SXE A;  4Y7T A;  2NPO A;  1V82 A;  3E26 A;  2WAW A;  3MQH A;  2RJ7 A;  2XMH A;  3TIO A;  3U2T A;  2I5K A;  1H5S B;  2WLE A;  3BXY A;  3VBI A;  1QGS A;  4Y9X A;  2X5Z A;  1V67 A;  3VBJ A;  1J2Z A;  5HS2 A;  2P2O A;  4G3S A;  1TZF A;  2JF3 A;  4ZDQ A;  3V0L A;  3T7M A;  2XAT A;  4EA9 A;  3R5C A;  3CGX A;  4MZU A;  4HO9 A;  3V0Q A;  4KNR A;  1EZI A;  1H5R A;  1QRL A;  5C48 A;  2VSI A;  4B4M A;  4IRQ A;  1XHB A;  4KRV A;  5EJ1 A;  3CKQ A;  5CQN X;  2TDT A;  4E6U A;  1FGX A;  5C3B A;  4BMA A;  1FXO A;  1MP5 A;  5AFU V;  1ZDF A;  4D11 C;  3OH4 A;  4KNX A;  4FRM A;  4K6R A;  1QWJ A;  2VFZ A;  1G3L A;  1NKH B;  4M2A A;  2VXM A;  1R80 A;  3OH2 A;  4E1K A;  4M98 A;  4LW3 A;  5CMG X;  4MIX A;  5CMF X;  1INJ A;  3V4E A;  4EEO A;  3MC4 A;  4HO3 A;  2X5S A;  4EEM A;  4N69 A;  3IGJ A;  1H7F A;  1JV3 A;  1FO9 A;  1MP4 A;  1VGT A;  1YP3 A;  3V0P A;  2AQ9 A;  3OUP A;  3GVD A;  1VZT A;  3LW6 A;  2VSH A;  1G97 A;  1H5S A;  3V8Y A;  1H7H A;  3BRK X;  4HUR A;  4HZD A;  5AJN A;  1SS9 A;  4MYB A;  3D8V A;  3SRT A;  3R8Y A;  2AE7 A;  3I0K A;  1O23 B;  4CVH A;  1ON6 A;  1G23 A;  1VPA A;  2RJ1 A;  2O1F A;  1FWY A;  2QIV X;  1KGQ A;  4E79 A;  3O3P A;  4HO6 A;  1ZCT A;  3SPT A;  2P73 A;  1ZIZ A;  5C4D A;  1O7O A;  4LW6 A;  4KXO A;  4M4K A;  2A8W A;  2PGV A;  2V0H A;  1VGU A;  3I0E A;  4CJC A;  2QKX A;  5JQQ A;  2YC5 A;  1QRG A;  4KC2 A;  2VXL A;  3IOI A;  4Y6N A;  1KHR A;  1R7U A;  3ECT A;  4HO8 A;  1G8O A;  3EH0 A;  2JCO A;  1VIC A;  3OW5 A;  4AA7 A;  2YES A;  4Y6U A;  4B4B A;  4MFG A;  4FRP A;  1QRE A;  4M99 A;  3T57 A;  3VBL A;  1H7E A;  1PZY B;  3HL3 A;  4E75 A;  1QG8 A;  1G95 A;  3OC9 A;  5ADX U;  3JQY A;  1ZI4 A;  5D92 A;  1ZJO A;  4HOC A;  1OMX A;  3RMW A;  2Y4K A;  3TIS A;  2E8B A;  2YQJ A;  1JV1 A;  2I7B A;  2YQH A;  3OGZ A;  4FRB A;  3U2V A;  3NGW A;  3OH0 A;  1ZHJ A;  4G3Q A;  2V0J A;  1LZ7 A;  3V90 A;  2IU8 A;  2W0W A;  5D91 A;  5C4F A;  1FO8 A;  4Y7F A;  5F42 A;  3D5N A;  2GGO A;  4HO0 A;  4P00 A;  3KWE A;  4FRO A;  1S80 A;  2IU9 A;  1G9R A;  2YQC A;  3Q1X A;  5C1H A;  5FUH A;  4B5B A;  5FV9 A;  2WVK A;  1FG5 N;  3OH3 A;  3JUJ A;  5FU0 A;  1G93 A;  5DEM A;  1INI A;  1YRO B;  1KWS A;  3I0F A;  5C8R A;  1QRM A;  1R7T A;  2NXV A;  1H5T A;  4UEG A;  1Z90 A;  3GUE A;  4D48 A;  1H7G A;  3FSC A;  2FYD B;  3DHO A;  2P6W A;  3OAM A;  4ARW A;  5C4B A;  1KGT A;  1HJJ A;  2APC A;  2WVL A;  3BCV A;  3ZGF A;  1LZ0 A;  2VHE A;  5I1F A;  2Y6P A;  5EIY A;  2J0B A;  1S4O A;  1G2V A;  4FRH A;  3Q7U A;  3I3X A;  2W0V A;  2WLF A;  5E3R A;  4Y62 A;  1MC3 A;  3SX3 A;  1SSQ A;  2RIT A;  3I0L A;  4EEG A;  2VS4 A;  1ZDG A;  4Y7V A;  4B2X A;  1VGZ A;  1WT2 A;  3CKJ A;  3FWW A;  1VH1 A;  2JCL A;  3U2W A;  5C3D A;  2O1H A;  3K8D A;  3R2W A;  1TVY A;  3CJ8 A;  4L41 C;  1EYR A;  1JVG A;  2J0A A;  2IC7 A;  3I0G A;  3CKN A;  4JIS A;  2FYA A;  4KPX A;  3E25 A;  2RIY A;  5C3A A;  5CQO A;  4IHH A;  4DCL A;  1FRW A;  5DDV A;  1VGW A;  2IUA A;  3VBM A;  1LXA A;  1W55 A;  2WVM A;  5E3P A;  1R7V A;  2FY7 A;  4EE3 A;  4HO2 A;  1E5K A;  3RSB A;  5E3Q A;  4AAW A;  1GQ9 A;  1H7L A;  2RIX A;  3U2U A;  3VBP A;  4J18 A;  3R3I A;  1TW1 A;  4E6T A;  3I0C A;  3DUV A;  1K4V A;  2ZU8 A;  3TDT A;  3VBK A;  3ZF8 A;  2Y4L A;  5AJO A;  2RIZ A;  3BSS A;  1ON8 A;  3SXA A;  2BO7 A;  4KC4 A;  4FRA A;  3V0M A;  3IOJ A;  4HUS A;  4FQW A;  4NAL A;  4N6B A;  3CKV A;  4ECM A;  4ISX A;  4IHF A;  1IIM A;  3T7N A;  1FR8 A;  3HSQ A;  2UX8 A;  1LZJ A;  4O6N A;  4Y7G A;  5CQP A;  4B3U A;  1LVW A;  1MP3 A;  4NAN A;  3ZGG A;  2OI5 A;  3TK8 A;  2AGD A;  2YQS A;  1H7Q A;  2FFU A;  3POL A;  1YP4 A;  3PKQ A;  1LL3 A;  2PGY A;  1KK5 A;  1KK6 A;  5ADX V;  2AM3 A;  1WT0 A;  1WVC A;  4Y64 A;  5C47 A;  4KT7 A;  1YP2 A;  3U2X A;  2D7I A;  1ZCU A;  1KQA A;  4R7P A;  3BFP A;  2VS3 A;  2WLD A;  2AEC A;  4H7O A;  1R7X A;  3P1B A;  3PNN A;  3R5A A;  5U2K A;  1SST A;  3FSY A;  1ZCY A;  3CKO A;  4R36 A;  4EA8 A;  1HM8 A;  2XME A;  1QRF A;  1O0R A;  2OI6 A;  3R5D A;  2RJ9 A;  4NAI A;  3V91 A;  3USQ A;  4MND A;  2Y4M A;  4BQH A;  2AH9 A;  2Y4J A;  2WLG A;  1JYL A;  3TZT A;  2D0J A;  1XZ6 A;  2YC3 A;  1V3W A;  1GQC A;  3SX5 A;  3FOQ A;  4JD0 A;  3BSW A;  4EAB A;  1G0R A;  2QIA A;  4P02 A;  2ZU9 A;  5DDT A;  3SXD A;  3R3R A;  1WT3 A;  1VZU A;  3I0D A;  5C36 A;  2D7R A;  1TDT A;  4C2S A;  3VNP A;  1W57 A;  2O1G A;  4M9C A;  1ZJ0 A;  3K8E A;  3V0N A;  3ZLK A;  4ASY A;  2C0N A;  2WE9 A;  2Z86 A;  4XWI A;  3IXC A;  1FR9 A;  1FXJ A;  1H4E A;  1VM8 A;  2OI7 A;  2Q4J A;  4HO4 A;  1S4N A;  3PKP A;  4HO5 A;  4GBP A;  5IDT A;  4IHG A;  3NZ2 A;  1GA8 A;  2PA4 A;  2YCM A;  3KWC A;  1H4D A;  2JCK A;  3SX8 A;  2VK9 A;  5FTV A;  3TQD A;  5BXC A;  1GWV A;  1MR7 A;  1H5S C;  2QGI A;  3V0O A;  2GGQ A;  2XWN A;  1R81 A;  1XHD A;  2BO8 A;  2WLC A;  3JTJ A;  1HV9 A;  4EE4 A;  1KRR A;  1JYK A;  1ZCV A;  3IOH A;  3N9W A;  1OCX A;  4AC3 A;  2ZU7 A;  4AYL A;  3JUK A;  3FSB A;  1ZI5 A;  3DK5 A;  1WSZ A;  1H4C A;  4YS8 A;  5EJZ A;  1ZJP A;  1FGG A;  2RJ8 A;  4O6M A;  1KK4 A;  5FU8 A;  3ZLL A;  3ST8 A;  1PZT A;  5DG3 A;  4FRE A;  4Y63 A;  1HM9 A;  4CJ8 A;  4HG6 A;  1ZI3 A;  2JF2 A;  2E3D A;  1MR9 A;  5C4C A;  4FIY A;  3SXC A;  5CMJ A;  5CQL X;  2DPW A;  1H3M A;  5CQM X;  5C49 A;  2ICX A;  1KRV A;  3I0H A;  5L6S A;  2AES A;  1VH3 A;  4KQL A;  2V0L A;  3RMV A;  2Y7A A;  2V0I A;  1R82 A;  4G87 A;  2OEF A;  4FCE A;  2PX7 A;  3R1W A;  3EEV A;  2OEG A;  4ASJ A;  1W77 A;  4EGG A;  1OMZ A;  2VD4 A;  3EE5 A;  1LZI A;  4MYO A;  3I0J A;  3GOS A;  2P72 A;  3OH1 A;  2XWL A;  4EE5 A;  4CJB A;  3HJJ A;  4EAA A;  1ZJ3 A;  2Z87 A;  4Q7C A;  3FS8 A;  4HCQ A;  5IDS A;  4HZC A;  2BO6 A;  4D0T A;  3R5B A;  3T7O A;  3D98 A;  2JCJ A;  2V0K A;  5C38 A;  1TW5 A;  1HM0 A;  4B42 A;  4FRL A;  1THJ A;  3QVB A;  1HJL A;  1H5S D;  1G1L A;  3VBN A;  3USR A;  3TWD A;  2VS5 A;  3BSY A;  1T3D A;  1LL2 A;  4FCU A;  5CMI A;  3MQG A;  5C4E A;  4AYJ A;  1FZW A;  1FOA A;  1MRL A;  5C1G A;  4DEC A;  3OKR A;  2FFV A;  3OU9 A;  3F1C A;  1NHE B;  1O7Q A;  3TV0 A;  1ZJ2 A;  1WT1 A;  3SXG A;  1VZX A;  1LL0 A;  3PMO A;  2A8U A;  4D0Z A;  1H7T A;  2XWM A;  3U0X A;  1OQM B;  5AFU U;  4DE7 A;  4DDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...