3DK5A

Crystal structure of apo-glmu from mycobacterium tuberculosis
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
469
structure length
442
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFYGRIVMAIVEVNAGVYAFDIAALRSALSRLSSNNQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 141
structure length 442
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dk5A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dk5A01
5E3QA 2FYDB 3DHOA 1V83A 1FGXA 4B4BA 4Y7TA 2WLCA 1NHEB 2AESA 4NALA 1ZHJA 4ISXA 3SRTA 2XATA 4R7PA 3SXDA 3SXBA 4P02A 2JCOA 4KC2A 3V0PA 3V0OA 2QIAA 4HURA 1Z90A 1H4DA 1H7HA 4EQYA 1ZI3A 2QH5A 1MC3A 2WGZA 4HZCA 1QRGA 3VBJA 4AA7A 5E3PA 1WT2A 3V91A 5IFYA 2OEGA 2YC3A 3K8DA 3V0MA 4B2XA 4MZUA 3EEVA 3FWWA 1MP5A 1KK4A 2RJ1A 1FWYA 3R5DA 2AE7A 5FYEA 3KWDA 2P2OA 3T57A 4EE5A 3K8EA 1OQMB 3ZLLA 2VD4A 3PKQA 3R5BA 3KIAA 1ZJ3A 3OTMA 1KK5A 4EVWA 2JF3A 4N27A 3QVBA 2Y7AA 1H5SB 1ZJ0A 5C1GA 1S80A 2WLGA 3CU0A 1THJA 1G1LA 2X5ZA 4EA9A 3V4EA 4KQLA 3USRA 4N6AA 1XHBA 3I0LA 2P72A 1KWSA 4MYBA 5DEPA 3PMOA 1VZUA 4R37A 1H7QA 2X65A 3Q7UA 4N69A 5C49A 5EIYA 4NANA 2RJ9A 1ZDFA 1R82A 1JV1A 5BXCA 1JV3A 4G87A 3VBKA 2IUAA 1YROB 3OH4A 4MFGA 3VNPA 5FUHA 1XZ6A 5C8RA 2NPOA 1G0RA 1KRRA 1H5RB 2GGQA 3HSQA 3BFPA 3R1WA 2YC5A 3I0FA 3OUPA 4XWIA 1HJLA 3CJ8A 2Z86A 3FSCA 5ADXV 3IOHA 5C4EA 1MP3A 2WLFA 2A8WA 2BO7A 3Q80A 3VBLA 1HM8A 1VGZA 1ZI5A 3EE5A 4AYLA 2I5KA 1H5SA 5C1LA 4EA7A 4HZDA 1NF5B 1LZIA 1SS9A 1GQCA 4IHGA 4DECA 4UEGA 2VS4A 1H7FA 2RJ4A 4G3QA 2VXLA 1VGTA 1VH1A 4FCEA 4GBPA 1W77A 3OH2A 1QRLA 1G9RA 1ZJ1A 4HOCA 4EEAA 2AECA 3TWDA 1G2VA 4KRVA 5DDVA 3T7MA 4HO4A 3NZ2A 1FO8A 2FYBA 3SXGA 4FROA 3I0JA 2AM3A 5C3AA 3F1CA 2WE9A 4IRPA 4AYJA 3OAMA 2WLDA 1R81A 2D7IA 1KQAA 3I0GA 2V0IA 3BXYA 2Y4JA 3USQA 5IDSA 3NGWA 3O3PA 4KC1A 3CKVA 5C4CA 2Y4KA 2O1HA 1VGUA 4IHHA 3I0IX 3EG4A 4AC3A 4FRDA 3SX7A 1NWGB 3MC4A 5EJZA 1VZXA 3U2UA 2V0JA 1ZJ2A 4MYOA 4HG6A 3TV0A 2ZU9A 1JYLA 1VZTA 5AJPA 1SSTA 2TDTA 3U2TA 1G97A 1H5SD 3OGZA 1YP2A 3FSBA 4P00A 3BRKX 1KGQA 3V8YA 2BO8A 2XMHA 3DUVA 4E79A 2IC7A 1LZ0A 3U0YA 3R5AA 2VSHA 1LZJA 1K4VA 2O1FA 1HM9A 3HL3A 4EEOA 4ASYA 1FOAA 1QQ0A 5L6SA 2QGIA 5FU8A 2RITA 1WSZA 1FZWA 2FY7A 4J18A 4BMAA 4FRQA 2Z87A 2RJ5A 3V8ZA 2ICYA 3TZTA 1OMXA 1QGSA 4FRAA 3JUKA 1G3LA 2WLEA 1ON8A 1WT0A 1HJJA 5FTSA 2V0LA 2OEFA 2VXMA 3I0HA 3SX8A 3D98A 1G23A 3JQYA 2WAWA 2OI5A 3V90A 5C36A 2E3DA 1S4NA 2RIYA 4FREA 1S4OA 4D0ZA 3ZGFA 3I0CA 1E5KA 2X60A 2AM5A 1H7EA 4Y7GA 3V0LA 1H7TA 4B5BA 4D48A 4EE4A 3C8VA 4HO2A 4M99A 3CKQA 4KPXA 1YP4A 4K6RA 4D0TA 1ZIZA 2VSIA 3GOSA 1G8OA 3OH0A 3U2WA 4HO8A 1QREA 2BO4A 5AJNA 1NMMB 3BCVA 2WEEA 3IGJA 4EA8A 1EYRA 1H4CA 5L6VA 3I0EA 4FQWA 1ZCUA 4HO9A 5C4FA 3P47A 3R8YA 1R7VA 1ZI1A 2DPWA 2RJ0A 1GWWA 3BSYA 1PZYB 5AJOA 2CU2A 4CJ8A 3R2WA 3GVDA 3JUJA 5CQLX 1GA8A 1T3DA 3R3IA 4HO0A 1FO9A 1QWJA 4EABA 3Q1XA 1WT1A 1GWVA 5C3BA 4M2AA 2FKOA 2QKXA 3VBIA 4EEMA 1TW1A 2RIXA 1W55A 5JQQA 2MZBA 4B4MA 4G3PA 3SXCA 2ICXA 1ZJPA 5CMHA 5HS2A 1ZCTA 2VHEA 4Y6UA 1H7GA 4D11C 2PA4A 3FTTA 3SXEA 1INJA 1V82A 3VBPA 2PGVA 3JTJA 3U0XA 3OW5A 1KRVA 1R80A 3BSWA 4KNXA 5C1HA 4CVHA 1V84A 2A8UA 5CQMX 2PGYA 2RJ6A 5AFUU 5C47A 1O7QA 1ZJOA 5EJ1A 1QRMA 1TZFA 1VPAA 1H4EA 1QRFA 3KWEA 3PKPA 4M98A 2YQSA 4JD0A 5FV9A 3F1XA 3R3RA 1VGWA 3OC9A 2IU8A 4M28A 2WVMA 5CMJA 4R36A 3SXAA 1H5RA 2YQCA 4E1KA 1JVGA 1ZCVA 3T7NA 1EZIA 4L41C 4HO6A 3VBMA 2AQ9A 2IU9A 3V0NA 3TIOA 2JCJA 4Y7VA 3OTZA 2P6WA 3ZLKA 1O7OA 3OH1A 2WVLA 5F42A 4NAIA 1IIMA 3DK5A 2D7RA 1ZDGA 2FYAA 2V0HA 1IINA 3RMVA 4Y7UA 1YP3A 4EAAA 3TQDA 1QG8A 1FG5N 4KT7A 4H7OA 1LVWA 1H5TB 3E25A 5CQPA 3I3XA 4Y6NA 1R7TA 4B42A 5DG3A 2AH9A 2AGDA 1XHDA 4Y7FA 3HJJA 4M9CA 1QGQA 4ARWA 1VICA 2JCKA 1TDTA 4FCUA 3V0QA 2RJ7A 3I3AA 2XWNA 4ASJA 4HCQA 4DCLA 1LL2A 3SX5A 1KHRA 2V0KA 5J49A 2JF2A 3FOQA 4N6BA 2FFUA 2W0WA 3FSYA 3F1YA 1MR9A 5DEMA 2Y4LA 1KK6A 5C4BA 1VH3A 3OKRA 3ST8A 1LXAA 3ZF8A 3DJ4A 3R5CA 3D8VA 2AM4A 4M4KA 5DDTA 5E3RA 1V67A 3OU9A 2UX8A 2FFVA 4FRHA 1G93A 4FRBA 4EEGA 1WT3A 1V3WA 1XATA 1J2ZA 3RMWA 1HV9A 3LW6A 4ECMA 4EGGA 2RJ8A 4C2SA 1O23B 2RIJA 5C4DA 1WVCA 1NKHB 4KXOA 4B2WA 4KNRA 1R7YA 1H5TA 3KWCA 1OMZA 1H3MA 1H7LA 2JCLA 3OH3A 3T7OA 3TK8A 3VBNA 4MNDA 2X5SA 4AAWA 2NXVA 5I1FA 4CJBA 1LL0A 4DDZA 1ZI4A 4ZDQA 3Q4SA 2ZU8A 1FXOA 1VM8A 1O0RA 3N9WA 1R7XA 2I5EA 3RSBA 1TW5A 2XMEA 5CMGX 3ECTA 1JYKA 2D0JA 3ZGGA 4LW6A 4B3UA 2OI6A 1H5SC 1G95A 1JVDA 2FYCB 3CGXA 2E8BA 3I0KA 4E6TA 3SX3A 3CKOA 1GQ9A 3IOIA 4FRLA 5FTVA 5CQNX 3I0DA 2O1GA 2Q4JA 4Y62A 3U2VA 2ZU7A 1MR7A 2XWLA 1KGTA 1SSQA 1W57A 3CKJA 3E26A 4DE7A 1FXJA 4E75A 2VFZA 3EH0A 2Y4MA 3IOJA 3POLA 4JISA 5AFUV 3P1BA 3MQGA 2RIZA 1MP4A 5FU0A 4M2BA 2W0VA 3R0SA 2I7BA 4CJCA 1SSMA 3FSXA 2WVKA 5CMIA 1S4PA 5C38A 1TVYA 4KPZA 2XWMA 3TISA 4FRMA 4FRPA 2PX7A 3SPTA 4NAKA 3PNNA 3GUEA 4Y64A 2OI7A 4E6UA 1ZCYA 3D5NA 2APCA 5ADXU 1ON6A 5C3DA 5U2KA 3MQHA 2QIVX 5IDTA 1OCXA 1FR9A 4EE3A 2VS3A 4Y9XA 2GGOA 5CMFX 3IXCA 2YQHA 5CQOA 1I52A 4YS8A 4LW3A 1KRUA 1GX4A 1HM0A 2YESA 4D11A 1PZTA 1FR8A 1R7UA 4HO3A 5C48A 3BSSA 2P73A 4G3SA 4HO5A 3CKNA 1INIA 1LL3A 2YCMA 4HUSA 4J09A 2VS5A 4B4GA 1FRWA 1GX0A 2Y6PA 1NQIB 4Y63A 1FGGA 3FS8A 1LZ7A 2YQJA 4IRQA 4IHFA 1MRLA 3TDTA 3U2XA 2BO6A 4KC4A 4BQHA
chains in the Genus database with same CATH superfamily
5E3QA 2FYDB 3DHOA 1V83A 5D92A 1FGXA 4B4BA 4Y7TA 2WLCA 1NHEB 2AESA 4NALA 1ZHJA 4ISXA 3SRTA 2XATA 4R7PA 3SXDA 4MIXA 3SXBA 4P02A 2JCOA 4KC2A 3V0PA 3V0OA 2QIAA 4HURA 1H4DA 1Z90A 1H7HA 4EQYA 1ZI3A 2QH5A 1MC3A 2WGZA 4HZCA 1QRGA 3VBJA 4AA7A 5E3PA 1WT2A 3V91A 5IFYA 2OEGA 2YC3A 3K8DA 3V0MA 4B2XA 4MZUA 3EEVA 3FWWA 1MP5A 1KK4A 2RJ1A 1FWYA 3R5DA 2AE7A 5FYEA 3KWDA 3SUCA 2P2OA 3T57A 4EE5A 3K8EA 1OQMB 3ZLLA 2VD4A 3PKQA 3R5BA 3KIAA 1ZJ3A 3OTMA 1KK5A 4EVWA 2JF3A 4N27A 3QVBA 2Y7AA 1H5SB 1ZJ0A 5C1GA 1S80A 2WLGA 3CU0A 1THJA 1G1LA 2X5ZA 4FIXA 4EA9A 3V4EA 4KQLA 3USRA 4N6AA 1XHBA 3I0LA 2P72A 1KWSA 4MYBA 1L0SA 5DEPA 3PMOA 1VZUA 4R37A 1H7QA 2X65A 3Q7UA 4N69A 5C49A 5EIYA 4NANA 2RJ9A 1ZDFA 1R82A 1JV1A 5BXCA 1JV3A 4G87A 3VBKA 2IUAA 1YROB 3OH4A 4MFGA 3VNPA 5FUHA 1XZ6A 5C8RA 2NPOA 1G0RA 1KRRA 1H5RB 2GGQA 3HSQA 3BFPA 3R1WA 2YC5A 3I0FA 3OUPA 4XWIA 1HJLA 3CJ8A 2Z86A 3FSCA 5ADXV 3IOHA 5C4EA 1MP3A 2WLFA 2A8WA 2BO7A 4O6NA 3Q80A 3VBLA 1HM8A 1VGZA 1ZI5A 3EE5A 4AYLA 2I5KA 1H5SA 5C1LA 4EA7A 4HZDA 1NF5B 1LZIA 1M8NA 1SS9A 1GQCA 4IHGA 4DECA 4UEGA 2VS4A 1H7FA 2RJ4A 4G3QA 2VXLA 1VGTA 1VH1A 4FCEA 4GBPA 1W77A 3OH2A 1QRLA 1G9RA 1ZJ1A 4HOCA 4EEAA 2AECA 3TWDA 1G2VA 4KRVA 5DDVA 3T7MA 4HO4A 3NZ2A 1FO8A 2FYBA 3SXGA 4FROA 3I0JA 2AM3A 5C3AA 3F1CA 2WE9A 4IRPA 4AYJA 3OAMA 2WLDA 1R81A 2D7IA 1KQAA 3I0GA 2V0IA 3BXYA 2Y4JA 3USQA 5IDSA 2VK9A 3NGWA 3O3PA 4KC1A 3CKVA 5C4CA 2Y4KA 2O1HA 1VGUA 4IHHA 3I0IX 3EG4A 4AC3A 4FRDA 3SX7A 1NWGB 3MC4A 5EJZA 1VZXA 3U2UA 2V0JA 1ZJ2A 4MYOA 4HG6A 1EWWA 3TV0A 2ZU9A 1JYLA 1VZTA 5AJPA 1SSTA 2TDTA 3U2TA 1G97A 1H5SD 3OGZA 1YP2A 3FSBA 4P00A 3BRKX 1KGQA 3V8YA 2BO8A 2XMHA 3DUVA 4E79A 2IC7A 1LZ0A 3U0YA 3R5AA 2VSHA 1LZJA 1K4VA 2O1FA 1HM9A 3HL3A 4EEOA 4ASYA 1FOAA 1QQ0A 2C0NA 5L6SA 2QGIA 5FU8A 2RITA 1WSZA 1FZWA 2FY7A 4J18A 4BMAA 4FRQA 2Z87A 2RJ5A 3V8ZA 3GQ7A 2ICYA 3TZTA 1OMXA 1QGSA 4FRAA 4Q7CA 3JUKA 1G3LA 2WLEA 1ON8A 1WT0A 1HJJA 5FTSA 2V0LA 2OEFA 2VXMA 3I0HA 3SX8A 3D98A 1G23A 3JQYA 2WAWA 2OI5A 3V90A 5C36A 2E3DA 1S4NA 2RIYA 4FREA 1S4OA 4D0ZA 3ZGFA 3I0CA 1E5KA 2X60A 2AM5A 1H7EA 4Y7GA 3V0LA 1H7TA 4B5BA 4D48A 4EE4A 3C8VA 4HO2A 4M99A 3CKQA 4KPXA 1YP4A 4K6RA 2J0BA 4D0TA 1ZIZA 2J0AA 2VSIA 3GOSA 1G8OA 3OH0A 3U2WA 4HO8A 1QREA 2BO4A 5AJNA 1NMMB 3BCVA 2WEEA 3IGJA 4EA8A 1EYRA 1H4CA 5L6VA 3I0EA 4FQWA 1ZCUA 4HO9A 5C4FA 3P47A 3R8YA 1R7VA 1ZI1A 2DPWA 2RJ0A 1GWWA 3BSYA 1PZYB 5AJOA 2CU2A 4CJ8A 3R2WA 3GVDA 3JUJA 5CQLX 1GA8A 1T3DA 3R3IA 4HO0A 1FO9A 1QWJA 4EABA 3Q1XA 1WT1A 1GWVA 5C3BA 4M2AA 2FKOA 2QKXA 3VBIA 4EEMA 1TW1A 2RIXA 1W55A 5JQQA 2MZBA 4B4MA 1N4IA 4G3PA 4O6MA 3SXCA 2ICXA 1ZJPA 5CMHA 5HS2A 1ZCTA 2VHEA 4Y6UA 1H7GA 4D11C 2PA4A 3FTTA 3SXEA 1Z2FA 1INJA 1V82A 3VBPA 2PGVA 3JTJA 3U0XA 3OW5A 1KRVA 1R80A 3BSWA 4KNXA 5C1HA 4CVHA 1V84A 2A8UA 5CQMX 2PGYA 2RJ6A 5AFUU 5C47A 1O7QA 1ZJOA 5EJ1A 1QRMA 1TZFA 1VPAA 1H4EA 1QRFA 3KWEA 3PKPA 4M98A 2YQSA 4JD0A 5FV9A 3F1XA 3R3RA 1VGWA 3OC9A 2IU8A 4M28A 2WVMA 5CMJA 4R36A 3SXAA 1H5RA 2YQCA 4E1KA 1JVGA 1ZCVA 3T7NA 1EZIA 4L41C 4HO6A 3VBMA 2AQ9A 2IU9A 3V0NA 3TIOA 2JCJA 4Y7VA 3OTZA 2P6WA 3ZLKA 1O7OA 3OH1A 2WVLA 5F42A 4NAIA 1IIMA 3DK5A 2D7RA 1ZDGA 2FYAA 2V0HA 3GQ8A 1IINA 3RMVA 4Y7UA 1YP3A 4EAAA 3TQDA 1QG8A 1FG5N 4KT7A 4H7OA 1LVWA 1H5TB 3E25A 5CQPA 3I3XA 4Y6NA 1R7TA 4B42A 5DG3A 2AH9A 2AGDA 1XHDA 4Y7FA 3HJJA 4M9CA 1QGQA 4ARWA 1VICA 2JCKA 1TDTA 4FCUA 3V0QA 2RJ7A 3I3AA 2XWNA 4ASJA 4HCQA 4DCLA 1LL2A 3SX5A 1KHRA 2V0KA 5J49A 2JF2A 3FOQA 4N6BA 2FFUA 2W0WA 3FSYA 3F1YA 1MR9A 5DEMA 2Y4LA 1KK6A 5C4BA 1VH3A 3OKRA 3ST8A 1LXAA 3ZF8A 3DJ4A 3R5CA 3D8VA 2AM4A 4M4KA 5DDTA 5E3RA 1V67A 3OU9A 2UX8A 2FFVA 4FRHA 1G93A 4FRBA 4EEGA 3GQ9A 1WT3A 1V3WA 1XATA 1J2ZA 3RMWA 1HV9A 3LW6A 4ECMA 4EGGA 2RJ8A 4C2SA 1O23B 2RIJA 5C4DA 1WVCA 1NKHB 4KXOA 4B2WA 4KNRA 1R7YA 1H5TA 3KWCA 1OMZA 1H3MA 1H7LA 2JCLA 3OH3A 3T7OA 3TK8A 3VBNA 4MNDA 2X5SA 4AAWA 2NXVA 5I1FA 4CJBA 1LL0A 4DDZA 1ZI4A 4ZDQA 3Q4SA 2ZU8A 1FXOA 1VM8A 1O0RA 3N9WA 1R7XA 2I5EA 3RSBA 1TW5A 2XMEA 5CMGX 3ECTA 1JYKA 2D0JA 4FIYA 3ZGGA 4LW6A 4B3UA 2OI6A 1H5SC 1G95A 1JVDA 2FYCB 3CGXA 2E8BA 3I0KA 4E6TA 3SX3A 3CKOA 1GQ9A 3IOIA 4FRLA 5FTVA 5CQNX 3I0DA 2O1GA 2Q4JA 4Y62A 3U2VA 2ZU7A 1MR7A 2XWLA 1KGTA 1SSQA 1W57A 3CKJA 3E26A 4DE7A 1FXJA 4E75A 2VFZA 3EH0A 2Y4MA 3IOJA 3POLA 4JISA 5AFUV 3P1BA 3MQGA 2RIZA 1MP4A 5FU0A 4M2BA 2W0VA 3R0SA 2I7BA 4CJCA 1SSMA 3FSXA 2WVKA 5CMIA 1S4PA 5C38A 1TVYA 4KPZA 2XWMA 3TISA 4FRMA 4FRPA 2PX7A 3SPTA 4NAKA 3PNNA 3GUEA 4Y64A 2OI7A 4E6UA 1ZCYA 3D5NA 2APCA 5ADXU 1ON6A 5C3DA 5U2KA 3MQHA 2QIVX 5IDTA 1OCXA 1FR9A 4EE3A 2VS3A 4Y9XA 5D91A 2GGOA 5CMFX 3IXCA 2YQHA 5CQOA 1I52A 4YS8A 4LW3A 1KRUA 1GX4A 1HM0A 2YESA 4D11A 1PZTA 1FR8A 1R7UA 4HO3A 5C48A 3BSSA 2P73A 4G3SA 4HO5A 3CKNA 1INIA 1LL3A 2YCMA 4HUSA 4J09A 2VS5A 4B4GA 1FRWA 1GX0A 2Y6PA 3GQAA 1NQIB 4Y63A 1FGGA 3FS8A 1LZ7A 2YQJA 4IRQA 4IHFA 1MRLA 3TDTA 3U2XA 2BO6A 4KC4A 4BQHA
chains in the Genus database with same CATH topology
5E3QA 2FYDB 3DHOA 1V83A 5D92A 1FGXA 4B4BA 4Y7TA 2WLCA 1NHEB 2AESA 4NALA 1ZHJA 4ISXA 3SRTA 2XATA 4R7PA 3SXDA 4MIXA 3SXBA 4P02A 2JCOA 4KC2A 3V0PA 3V0OA 2QIAA 4HURA 1Z90A 1H4DA 1H7HA 4EQYA 1ZI3A 2QH5A 1MC3A 2WGZA 4HZCA 1QRGA 3VBJA 4AA7A 5E3PA 1WT2A 3V91A 5IFYA 2OEGA 2YC3A 3K8DA 3V0MA 4B2XA 4MZUA 3EEVA 3FWWA 1MP5A 1KK4A 2RJ1A 1FWYA 3R5DA 2AE7A 5FYEA 3KWDA 2P2OA 3T57A 4EE5A 3K8EA 1OQMB 3ZLLA 2VD4A 3PKQA 3R5BA 3KIAA 1ZJ3A 3OTMA 1KK5A 4EVWA 2JF3A 4N27A 3QVBA 2Y7AA 1H5SB 1ZJ0A 5C1GA 1S80A 2WLGA 3CU0A 1THJA 1G1LA 2X5ZA 4FIXA 4EA9A 3V4EA 4KQLA 3USRA 4N6AA 1XHBA 3I0LA 2P72A 1KWSA 4MYBA 5DEPA 3PMOA 1VZUA 4R37A 1H7QA 2X65A 3Q7UA 4N69A 5C49A 5EIYA 4NANA 2RJ9A 1ZDFA 1R82A 1JV1A 5BXCA 1JV3A 4G87A 3VBKA 2IUAA 1YROB 3OH4A 4MFGA 3VNPA 5FUHA 1XZ6A 5C8RA 2NPOA 1G0RA 1KRRA 1H5RB 2GGQA 3HSQA 3BFPA 3R1WA 2YC5A 3I0FA 3OUPA 4XWIA 1HJLA 3CJ8A 2Z86A 3FSCA 5ADXV 3IOHA 5C4EA 1MP3A 2WLFA 2A8WA 2BO7A 4O6NA 3Q80A 3VBLA 1HM8A 1VGZA 1ZI5A 3EE5A 4AYLA 2I5KA 1H5SA 5C1LA 4EA7A 4HZDA 1NF5B 1LZIA 1SS9A 1GQCA 4IHGA 4DECA 4UEGA 2VS4A 1H7FA 2RJ4A 4G3QA 2VXLA 1VGTA 1VH1A 4FCEA 4GBPA 1W77A 3OH2A 1QRLA 1G9RA 1ZJ1A 4HOCA 4EEAA 2AECA 3TWDA 1G2VA 4KRVA 5DDVA 3T7MA 4HO4A 3NZ2A 1FO8A 2FYBA 3SXGA 4FROA 3I0JA 2AM3A 5C3AA 3F1CA 2WE9A 4IRPA 4AYJA 3OAMA 2WLDA 1R81A 2D7IA 1KQAA 3I0GA 2V0IA 3BXYA 2Y4JA 3USQA 5IDSA 2VK9A 3NGWA 3O3PA 4KC1A 3CKVA 5C4CA 2Y4KA 2O1HA 1VGUA 4IHHA 3I0IX 3EG4A 4AC3A 4FRDA 3SX7A 1NWGB 3MC4A 5EJZA 1VZXA 3U2UA 2V0JA 1ZJ2A 4MYOA 4HG6A 3TV0A 2ZU9A 1JYLA 1VZTA 5AJPA 1SSTA 2TDTA 3U2TA 1G97A 1H5SD 3OGZA 1YP2A 3FSBA 4P00A 3BRKX 1KGQA 3V8YA 2BO8A 2XMHA 3DUVA 4E79A 2IC7A 1LZ0A 3U0YA 3R5AA 2VSHA 1LZJA 1K4VA 2O1FA 1HM9A 3HL3A 4EEOA 4ASYA 1FOAA 1QQ0A 2C0NA 5L6SA 2QGIA 5FU8A 2RITA 1WSZA 1FZWA 2FY7A 4J18A 4BMAA 4FRQA 2Z87A 2RJ5A 3V8ZA 2ICYA 3TZTA 1OMXA 1QGSA 4FRAA 4Q7CA 3JUKA 1G3LA 2WLEA 1ON8A 1WT0A 1HJJA 5FTSA 2V0LA 2OEFA 2VXMA 3I0HA 3SX8A 3D98A 1G23A 3JQYA 2WAWA 2OI5A 3V90A 5C36A 2E3DA 1S4NA 2RIYA 4FREA 1S4OA 4D0ZA 3ZGFA 3I0CA 1E5KA 2X60A 2AM5A 1H7EA 4Y7GA 3V0LA 1H7TA 4B5BA 4D48A 4EE4A 3C8VA 4HO2A 4M99A 3CKQA 4KPXA 1YP4A 4K6RA 2J0BA 4D0TA 1ZIZA 2J0AA 2VSIA 3GOSA 1G8OA 3OH0A 3U2WA 4HO8A 1QREA 2BO4A 5AJNA 1NMMB 3BCVA 2WEEA 3IGJA 4EA8A 1EYRA 1H4CA 5L6VA 3I0EA 4FQWA 1ZCUA 4HO9A 5C4FA 3P47A 3R8YA 1R7VA 1ZI1A 2DPWA 2RJ0A 1GWWA 3BSYA 1PZYB 5AJOA 2CU2A 4CJ8A 3R2WA 3GVDA 3JUJA 5CQLX 1GA8A 1T3DA 3R3IA 4HO0A 1FO9A 1QWJA 4EABA 3Q1XA 1WT1A 1GWVA 5C3BA 4M2AA 2FKOA 2QKXA 3VBIA 4EEMA 1TW1A 2RIXA 1W55A 5JQQA 2MZBA 4B4MA 4G3PA 4O6MA 3SXCA 2ICXA 1ZJPA 5CMHA 5HS2A 1ZCTA 2VHEA 4Y6UA 1H7GA 4D11C 2PA4A 3FTTA 3SXEA 1INJA 1V82A 3VBPA 2PGVA 3JTJA 3U0XA 3OW5A 1KRVA 1R80A 3BSWA 4KNXA 5C1HA 4CVHA 1V84A 2A8UA 5CQMX 2PGYA 2RJ6A 5AFUU 5C47A 1O7QA 1ZJOA 5EJ1A 1QRMA 1TZFA 1VPAA 1H4EA 1QRFA 3KWEA 3PKPA 4M98A 2YQSA 4JD0A 5FV9A 3F1XA 3R3RA 1VGWA 3OC9A 2IU8A 4M28A 2WVMA 5CMJA 4R36A 3SXAA 1H5RA 2YQCA 4E1KA 1JVGA 1ZCVA 3T7NA 1EZIA 4L41C 4HO6A 3VBMA 2AQ9A 2IU9A 3V0NA 3TIOA 2JCJA 4Y7VA 3OTZA 2P6WA 3ZLKA 1O7OA 3OH1A 2WVLA 5F42A 4NAIA 1IIMA 3DK5A 2D7RA 1ZDGA 2FYAA 2V0HA 1IINA 3RMVA 4Y7UA 1YP3A 4EAAA 3TQDA 1QG8A 1FG5N 4KT7A 4H7OA 1LVWA 1H5TB 3E25A 5CQPA 3I3XA 4Y6NA 1R7TA 4B42A 5DG3A 2AH9A 2AGDA 1XHDA 4Y7FA 3HJJA 4M9CA 1QGQA 4ARWA 1VICA 2JCKA 1TDTA 4FCUA 3V0QA 2RJ7A 3I3AA 2XWNA 4ASJA 4HCQA 4DCLA 1LL2A 3SX5A 1KHRA 2V0KA 5J49A 2JF2A 3FOQA 4N6BA 2FFUA 2W0WA 3FSYA 3F1YA 1MR9A 5DEMA 2Y4LA 1KK6A 5C4BA 1VH3A 3OKRA 3ST8A 1LXAA 3ZF8A 3DJ4A 3R5CA 3D8VA 2AM4A 4M4KA 5DDTA 5E3RA 1V67A 3OU9A 2UX8A 2FFVA 4FRHA 1G93A 4FRBA 4EEGA 1WT3A 1V3WA 1XATA 1J2ZA 3RMWA 1HV9A 3LW6A 4ECMA 4EGGA 2RJ8A 4C2SA 1O23B 2RIJA 5C4DA 1WVCA 1NKHB 4KXOA 4B2WA 4KNRA 1R7YA 1H5TA 3KWCA 1OMZA 1H3MA 1H7LA 2JCLA 3OH3A 3T7OA 3TK8A 3VBNA 4MNDA 2X5SA 4AAWA 2NXVA 5I1FA 4CJBA 1LL0A 4DDZA 1ZI4A 4ZDQA 3Q4SA 2ZU8A 1FXOA 1VM8A 1O0RA 3N9WA 1R7XA 2I5EA 3RSBA 1TW5A 2XMEA 5CMGX 3ECTA 1JYKA 2D0JA 4FIYA 3ZGGA 4LW6A 4B3UA 2OI6A 1H5SC 1G95A 1JVDA 2FYCB 3CGXA 2E8BA 3I0KA 4E6TA 3SX3A 3CKOA 1GQ9A 3IOIA 4FRLA 5FTVA 5CQNX 3I0DA 2O1GA 2Q4JA 4Y62A 3U2VA 2ZU7A 1MR7A 2XWLA 1KGTA 1SSQA 1W57A 3CKJA 3E26A 4DE7A 1FXJA 4E75A 2VFZA 3EH0A 2Y4MA 3IOJA 3POLA 4JISA 5AFUV 3P1BA 3MQGA 2RIZA 1MP4A 5FU0A 4M2BA 2W0VA 3R0SA 2I7BA 4CJCA 1SSMA 3FSXA 2WVKA 5CMIA 1S4PA 5C38A 1TVYA 4KPZA 2XWMA 3TISA 4FRMA 4FRPA 2PX7A 3SPTA 4NAKA 3PNNA 3GUEA 4Y64A 2OI7A 4E6UA 1ZCYA 3D5NA 2APCA 5ADXU 1ON6A 5C3DA 5U2KA 3MQHA 2QIVX 5IDTA 1OCXA 1FR9A 4EE3A 2VS3A 4Y9XA 5D91A 2GGOA 5CMFX 3IXCA 2YQHA 5CQOA 1I52A 4YS8A 4LW3A 1KRUA 1GX4A 1HM0A 2YESA 4D11A 1PZTA 1FR8A 1R7UA 4HO3A 5C48A 3BSSA 2P73A 4G3SA 4HO5A 3CKNA 1INIA 1LL3A 2YCMA 4HUSA 4J09A 2VS5A 4B4GA 1FRWA 1GX0A 2Y6PA 1NQIB 4Y63A 1FGGA 3FS8A 1LZ7A 2YQJA 4IRQA 4IHFA 1MRLA 3TDTA 3U2XA 2BO6A 4KC4A 4BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3Q A;  2FYD B;  3DHO A;  1V83 A;  1FGX A;  4B4B A;  4Y7T A;  2WLC A;  1NHE B;  2AES A;  4NAL A;  1ZHJ A;  4ISX A;  3SRT A;  2XAT A;  4R7P A;  3SXD A;  3SXB A;  4P02 A;  2JCO A;  4KC2 A;  3V0P A;  3V0O A;  2QIA A;  4HUR A;  1Z90 A;  1H4D A;  1H7H A;  4EQY A;  1ZI3 A;  2QH5 A;  1MC3 A;  2WGZ A;  4HZC A;  1QRG A;  3VBJ A;  4AA7 A;  5E3P A;  1WT2 A;  3V91 A;  5IFY A;  2OEG A;  2YC3 A;  3K8D A;  3V0M A;  4B2X A;  4MZU A;  3EEV A;  3FWW A;  1MP5 A;  1KK4 A;  2RJ1 A;  1FWY A;  3R5D A;  2AE7 A;  5FYE A;  3KWD A;  2P2O A;  3T57 A;  4EE5 A;  3K8E A;  1OQM B;  3ZLL A;  2VD4 A;  3PKQ A;  3R5B A;  3KIA A;  1ZJ3 A;  3OTM A;  1KK5 A;  4EVW A;  2JF3 A;  4N27 A;  3QVB A;  2Y7A A;  1H5S B;  1ZJ0 A;  5C1G A;  1S80 A;  2WLG A;  3CU0 A;  1THJ A;  1G1L A;  2X5Z A;  4EA9 A;  3V4E A;  4KQL A;  3USR A;  4N6A A;  1XHB A;  3I0L A;  2P72 A;  1KWS A;  4MYB A;  5DEP A;  3PMO A;  1VZU A;  4R37 A;  1H7Q A;  2X65 A;  3Q7U A;  4N69 A;  5C49 A;  5EIY A;  4NAN A;  2RJ9 A;  1ZDF A;  1R82 A;  1JV1 A;  5BXC A;  1JV3 A;  4G87 A;  3VBK A;  2IUA A;  1YRO B;  3OH4 A;  4MFG A;  3VNP A;  5FUH A;  1XZ6 A;  5C8R A;  2NPO A;  1G0R A;  1KRR A;  1H5R B;  2GGQ A;  3HSQ A;  3BFP A;  3R1W A;  2YC5 A;  3I0F A;  3OUP A;  4XWI A;  1HJL A;  3CJ8 A;  2Z86 A;  3FSC A;  5ADX V;  3IOH A;  5C4E A;  1MP3 A;  2WLF A;  2A8W A;  2BO7 A;  3Q80 A;  3VBL A;  1HM8 A;  1VGZ A;  1ZI5 A;  3EE5 A;  4AYL A;  2I5K A;  1H5S A;  5C1L A;  4EA7 A;  4HZD A;  1NF5 B;  1LZI A;  1SS9 A;  1GQC A;  4IHG A;  4DEC A;  4UEG A;  2VS4 A;  1H7F A;  2RJ4 A;  4G3Q A;  2VXL A;  1VGT A;  1VH1 A;  4FCE A;  4GBP A;  1W77 A;  3OH2 A;  1QRL A;  1G9R A;  1ZJ1 A;  4HOC A;  4EEA A;  2AEC A;  3TWD A;  1G2V A;  4KRV A;  5DDV A;  3T7M A;  4HO4 A;  3NZ2 A;  1FO8 A;  2FYB A;  3SXG A;  4FRO A;  3I0J A;  2AM3 A;  5C3A A;  3F1C A;  2WE9 A;  4IRP A;  4AYJ A;  3OAM A;  2WLD A;  1R81 A;  2D7I A;  1KQA A;  3I0G A;  2V0I A;  3BXY A;  2Y4J A;  3USQ A;  5IDS A;  3NGW A;  3O3P A;  4KC1 A;  3CKV A;  5C4C A;  2Y4K A;  2O1H A;  1VGU A;  4IHH A;  3I0I X;  3EG4 A;  4AC3 A;  4FRD A;  3SX7 A;  1NWG B;  3MC4 A;  5EJZ A;  1VZX A;  3U2U A;  2V0J A;  1ZJ2 A;  4MYO A;  4HG6 A;  3TV0 A;  2ZU9 A;  1JYL A;  1VZT A;  5AJP A;  1SST A;  2TDT A;  3U2T A;  1G97 A;  1H5S D;  3OGZ A;  1YP2 A;  3FSB A;  4P00 A;  3BRK X;  1KGQ A;  3V8Y A;  2BO8 A;  2XMH A;  3DUV A;  4E79 A;  2IC7 A;  1LZ0 A;  3U0Y A;  3R5A A;  2VSH A;  1LZJ A;  1K4V A;  2O1F A;  1HM9 A;  3HL3 A;  4EEO A;  4ASY A;  1FOA A;  1QQ0 A;  5L6S A;  2QGI A;  5FU8 A;  2RIT A;  1WSZ A;  1FZW A;  2FY7 A;  4J18 A;  4BMA A;  4FRQ A;  2Z87 A;  2RJ5 A;  3V8Z A;  2ICY A;  3TZT A;  1OMX A;  1QGS A;  4FRA A;  3JUK A;  1G3L A;  2WLE A;  1ON8 A;  1WT0 A;  1HJJ A;  5FTS A;  2V0L A;  2OEF A;  2VXM A;  3I0H A;  3SX8 A;  3D98 A;  1G23 A;  3JQY A;  2WAW A;  2OI5 A;  3V90 A;  5C36 A;  2E3D A;  1S4N A;  2RIY A;  4FRE A;  1S4O A;  4D0Z A;  3ZGF A;  3I0C A;  1E5K A;  2X60 A;  2AM5 A;  1H7E A;  4Y7G A;  3V0L A;  1H7T A;  4B5B A;  4D48 A;  4EE4 A;  3C8V A;  4HO2 A;  4M99 A;  3CKQ A;  4KPX A;  1YP4 A;  4K6R A;  4D0T A;  1ZIZ A;  2VSI A;  3GOS A;  1G8O A;  3OH0 A;  3U2W A;  4HO8 A;  1QRE A;  2BO4 A;  5AJN A;  1NMM B;  3BCV A;  2WEE A;  3IGJ A;  4EA8 A;  1EYR A;  1H4C A;  5L6V A;  3I0E A;  4FQW A;  1ZCU A;  4HO9 A;  5C4F A;  3P47 A;  3R8Y A;  1R7V A;  1ZI1 A;  2DPW A;  2RJ0 A;  1GWW A;  3BSY A;  1PZY B;  5AJO A;  2CU2 A;  4CJ8 A;  3R2W A;  3GVD A;  3JUJ A;  5CQL X;  1GA8 A;  1T3D A;  3R3I A;  4HO0 A;  1FO9 A;  1QWJ A;  4EAB A;  3Q1X A;  1WT1 A;  1GWV A;  5C3B A;  4M2A A;  2FKO A;  2QKX A;  3VBI A;  4EEM A;  1TW1 A;  2RIX A;  1W55 A;  5JQQ A;  2MZB A;  4B4M A;  4G3P A;  3SXC A;  2ICX A;  1ZJP A;  5CMH A;  5HS2 A;  1ZCT A;  2VHE A;  4Y6U A;  1H7G A;  4D11 C;  2PA4 A;  3FTT A;  3SXE A;  1INJ A;  1V82 A;  3VBP A;  2PGV A;  3JTJ A;  3U0X A;  3OW5 A;  1KRV A;  1R80 A;  3BSW A;  4KNX A;  5C1H A;  4CVH A;  1V84 A;  2A8U A;  5CQM X;  2PGY A;  2RJ6 A;  5AFU U;  5C47 A;  1O7Q A;  1ZJO A;  5EJ1 A;  1QRM A;  1TZF A;  1VPA A;  1H4E A;  1QRF A;  3KWE A;  3PKP A;  4M98 A;  2YQS A;  4JD0 A;  5FV9 A;  3F1X A;  3R3R A;  1VGW A;  3OC9 A;  2IU8 A;  4M28 A;  2WVM A;  5CMJ A;  4R36 A;  3SXA A;  1H5R A;  2YQC A;  4E1K A;  1JVG A;  1ZCV A;  3T7N A;  1EZI A;  4L41 C;  4HO6 A;  3VBM A;  2AQ9 A;  2IU9 A;  3V0N A;  3TIO A;  2JCJ A;  4Y7V A;  3OTZ A;  2P6W A;  3ZLK A;  1O7O A;  3OH1 A;  2WVL A;  5F42 A;  4NAI A;  1IIM A;  3DK5 A;  2D7R A;  1ZDG A;  2FYA A;  2V0H A;  1IIN A;  3RMV A;  4Y7U A;  1YP3 A;  4EAA A;  3TQD A;  1QG8 A;  1FG5 N;  4KT7 A;  4H7O A;  1LVW A;  1H5T B;  3E25 A;  5CQP A;  3I3X A;  4Y6N A;  1R7T A;  4B42 A;  5DG3 A;  2AH9 A;  2AGD A;  1XHD A;  4Y7F A;  3HJJ A;  4M9C A;  1QGQ A;  4ARW A;  1VIC A;  2JCK A;  1TDT A;  4FCU A;  3V0Q A;  2RJ7 A;  3I3A A;  2XWN A;  4ASJ A;  4HCQ A;  4DCL A;  1LL2 A;  3SX5 A;  1KHR A;  2V0K A;  5J49 A;  2JF2 A;  3FOQ A;  4N6B A;  2FFU A;  2W0W A;  3FSY A;  3F1Y A;  1MR9 A;  5DEM A;  2Y4L A;  1KK6 A;  5C4B A;  1VH3 A;  3OKR A;  3ST8 A;  1LXA A;  3ZF8 A;  3DJ4 A;  3R5C A;  3D8V A;  2AM4 A;  4M4K A;  5DDT A;  5E3R A;  1V67 A;  3OU9 A;  2UX8 A;  2FFV A;  4FRH A;  1G93 A;  4FRB A;  4EEG A;  1WT3 A;  1V3W A;  1XAT A;  1J2Z A;  3RMW A;  1HV9 A;  3LW6 A;  4ECM A;  4EGG A;  2RJ8 A;  4C2S A;  1O23 B;  2RIJ A;  5C4D A;  1WVC A;  1NKH B;  4KXO A;  4B2W A;  4KNR A;  1R7Y A;  1H5T A;  3KWC A;  1OMZ A;  1H3M A;  1H7L A;  2JCL A;  3OH3 A;  3T7O A;  3TK8 A;  3VBN A;  4MND A;  2X5S A;  4AAW A;  2NXV A;  5I1F A;  4CJB A;  1LL0 A;  4DDZ A;  1ZI4 A;  4ZDQ A;  3Q4S A;  2ZU8 A;  1FXO A;  1VM8 A;  1O0R A;  3N9W A;  1R7X A;  2I5E A;  3RSB A;  1TW5 A;  2XME A;  5CMG X;  3ECT A;  1JYK A;  2D0J A;  3ZGG A;  4LW6 A;  4B3U A;  2OI6 A;  1H5S C;  1G95 A;  1JVD A;  2FYC B;  3CGX A;  2E8B A;  3I0K A;  4E6T A;  3SX3 A;  3CKO A;  1GQ9 A;  3IOI A;  4FRL A;  5FTV A;  5CQN X;  3I0D A;  2O1G A;  2Q4J A;  4Y62 A;  3U2V A;  2ZU7 A;  1MR7 A;  2XWL A;  1KGT A;  1SSQ A;  1W57 A;  3CKJ A;  3E26 A;  4DE7 A;  1FXJ A;  4E75 A;  2VFZ A;  3EH0 A;  2Y4M A;  3IOJ A;  3POL A;  4JIS A;  5AFU V;  3P1B A;  3MQG A;  2RIZ A;  1MP4 A;  5FU0 A;  4M2B A;  2W0V A;  3R0S A;  2I7B A;  4CJC A;  1SSM A;  3FSX A;  2WVK A;  5CMI A;  1S4P A;  5C38 A;  1TVY A;  4KPZ A;  2XWM A;  3TIS A;  4FRM A;  4FRP A;  2PX7 A;  3SPT A;  4NAK A;  3PNN A;  3GUE A;  4Y64 A;  2OI7 A;  4E6U A;  1ZCY A;  3D5N A;  2APC A;  5ADX U;  1ON6 A;  5C3D A;  5U2K A;  3MQH A;  2QIV X;  5IDT A;  1OCX A;  1FR9 A;  4EE3 A;  2VS3 A;  4Y9X A;  2GGO A;  5CMF X;  3IXC A;  2YQH A;  5CQO A;  1I52 A;  4YS8 A;  4LW3 A;  1KRU A;  1GX4 A;  1HM0 A;  2YES A;  4D11 A;  1PZT A;  1FR8 A;  1R7U A;  4HO3 A;  5C48 A;  3BSS A;  2P73 A;  4G3S A;  4HO5 A;  3CKN A;  1INI A;  1LL3 A;  2YCM A;  4HUS A;  4J09 A;  2VS5 A;  4B4G A;  1FRW A;  1GX0 A;  2Y6P A;  1NQI B;  4Y63 A;  1FGG A;  3FS8 A;  1LZ7 A;  2YQJ A;  4IRQ A;  4IHF A;  1MRL A;  3TDT A;  3U2X A;  2BO6 A;  4KC4 A;  4BQH A; 
#chains in the Genus database with same CATH topology
 5E3Q A;  2FYD B;  3DHO A;  1V83 A;  5D92 A;  1FGX A;  4B4B A;  4Y7T A;  2WLC A;  1NHE B;  2AES A;  4NAL A;  1ZHJ A;  4ISX A;  3SRT A;  2XAT A;  4R7P A;  3SXD A;  4MIX A;  3SXB A;  4P02 A;  2JCO A;  4KC2 A;  3V0P A;  3V0O A;  2QIA A;  4HUR A;  1H4D A;  1Z90 A;  1H7H A;  4EQY A;  1ZI3 A;  2QH5 A;  1MC3 A;  2WGZ A;  4HZC A;  1QRG A;  3VBJ A;  4AA7 A;  5E3P A;  1WT2 A;  3V91 A;  5IFY A;  2OEG A;  2YC3 A;  3K8D A;  3V0M A;  4B2X A;  4MZU A;  3EEV A;  3FWW A;  1MP5 A;  1KK4 A;  2RJ1 A;  1FWY A;  3R5D A;  2AE7 A;  5FYE A;  3KWD A;  3SUC A;  2P2O A;  3T57 A;  4EE5 A;  3K8E A;  1OQM B;  3ZLL A;  2VD4 A;  3PKQ A;  3R5B A;  3KIA A;  1ZJ3 A;  3OTM A;  1KK5 A;  4EVW A;  2JF3 A;  4N27 A;  3QVB A;  2Y7A A;  1H5S B;  1ZJ0 A;  5C1G A;  1S80 A;  2WLG A;  3CU0 A;  1THJ A;  1G1L A;  2X5Z A;  4FIX A;  4EA9 A;  3V4E A;  4KQL A;  3USR A;  4N6A A;  1XHB A;  3I0L A;  2P72 A;  1KWS A;  4MYB A;  1L0S A;  5DEP A;  3PMO A;  1VZU A;  4R37 A;  1H7Q A;  2X65 A;  3Q7U A;  4N69 A;  5C49 A;  5EIY A;  4NAN A;  2RJ9 A;  1ZDF A;  1R82 A;  1JV1 A;  5BXC A;  1JV3 A;  4G87 A;  3VBK A;  2IUA A;  1YRO B;  3OH4 A;  4MFG A;  3VNP A;  5FUH A;  1XZ6 A;  5C8R A;  2NPO A;  1G0R A;  1KRR A;  1H5R B;  2GGQ A;  3HSQ A;  3BFP A;  3R1W A;  2YC5 A;  3I0F A;  3OUP A;  4XWI A;  1HJL A;  3CJ8 A;  2Z86 A;  3FSC A;  5ADX V;  3IOH A;  5C4E A;  1MP3 A;  2WLF A;  2A8W A;  2BO7 A;  4O6N A;  3Q80 A;  3VBL A;  1HM8 A;  1VGZ A;  1ZI5 A;  3EE5 A;  4AYL A;  2I5K A;  1H5S A;  5C1L A;  4EA7 A;  4HZD A;  1NF5 B;  1LZI A;  1M8N A;  1SS9 A;  1GQC A;  4IHG A;  4DEC A;  4UEG A;  2VS4 A;  1H7F A;  2RJ4 A;  4G3Q A;  2VXL A;  1VGT A;  1VH1 A;  4FCE A;  4GBP A;  1W77 A;  3OH2 A;  1QRL A;  1G9R A;  1ZJ1 A;  4HOC A;  4EEA A;  2AEC A;  3TWD A;  1G2V A;  4KRV A;  5DDV A;  3T7M A;  4HO4 A;  3NZ2 A;  1FO8 A;  2FYB A;  3SXG A;  4FRO A;  3I0J A;  2AM3 A;  5C3A A;  3F1C A;  2WE9 A;  4IRP A;  4AYJ A;  3OAM A;  2WLD A;  1R81 A;  2D7I A;  1KQA A;  3I0G A;  2V0I A;  3BXY A;  2Y4J A;  3USQ A;  5IDS A;  2VK9 A;  3NGW A;  3O3P A;  4KC1 A;  3CKV A;  5C4C A;  2Y4K A;  2O1H A;  1VGU A;  4IHH A;  3I0I X;  3EG4 A;  4AC3 A;  4FRD A;  3SX7 A;  1NWG B;  3MC4 A;  5EJZ A;  1VZX A;  3U2U A;  2V0J A;  1ZJ2 A;  4MYO A;  4HG6 A;  1EWW A;  3TV0 A;  2ZU9 A;  1JYL A;  1VZT A;  5AJP A;  1SST A;  2TDT A;  3U2T A;  1G97 A;  1H5S D;  3OGZ A;  1YP2 A;  3FSB A;  4P00 A;  3BRK X;  1KGQ A;  3V8Y A;  2BO8 A;  2XMH A;  3DUV A;  4E79 A;  2IC7 A;  1LZ0 A;  3U0Y A;  3R5A A;  2VSH A;  1LZJ A;  1K4V A;  2O1F A;  1HM9 A;  3HL3 A;  4EEO A;  4ASY A;  1FOA A;  1QQ0 A;  2C0N A;  5L6S A;  2QGI A;  5FU8 A;  2RIT A;  1WSZ A;  1FZW A;  2FY7 A;  4J18 A;  4BMA A;  4FRQ A;  2Z87 A;  2RJ5 A;  3V8Z A;  3GQ7 A;  2ICY A;  3TZT A;  1OMX A;  1QGS A;  4FRA A;  4Q7C A;  3JUK A;  1G3L A;  2WLE A;  1ON8 A;  1WT0 A;  1HJJ A;  5FTS A;  2V0L A;  2OEF A;  2VXM A;  3I0H A;  3SX8 A;  3D98 A;  1G23 A;  3JQY A;  2WAW A;  2OI5 A;  3V90 A;  5C36 A;  2E3D A;  1S4N A;  2RIY A;  4FRE A;  1S4O A;  4D0Z A;  3ZGF A;  3I0C A;  1E5K A;  2X60 A;  2AM5 A;  1H7E A;  4Y7G A;  3V0L A;  1H7T A;  4B5B A;  4D48 A;  4EE4 A;  3C8V A;  4HO2 A;  4M99 A;  3CKQ A;  4KPX A;  1YP4 A;  4K6R A;  2J0B A;  4D0T A;  1ZIZ A;  2J0A A;  2VSI A;  3GOS A;  1G8O A;  3OH0 A;  3U2W A;  4HO8 A;  1QRE A;  2BO4 A;  5AJN A;  1NMM B;  3BCV A;  2WEE A;  3IGJ A;  4EA8 A;  1EYR A;  1H4C A;  5L6V A;  3I0E A;  4FQW A;  1ZCU A;  4HO9 A;  5C4F A;  3P47 A;  3R8Y A;  1R7V A;  1ZI1 A;  2DPW A;  2RJ0 A;  1GWW A;  3BSY A;  1PZY B;  5AJO A;  2CU2 A;  4CJ8 A;  3R2W A;  3GVD A;  3JUJ A;  5CQL X;  1GA8 A;  1T3D A;  3R3I A;  4HO0 A;  1FO9 A;  1QWJ A;  4EAB A;  3Q1X A;  1WT1 A;  1GWV A;  5C3B A;  4M2A A;  2FKO A;  2QKX A;  3VBI A;  4EEM A;  1TW1 A;  2RIX A;  1W55 A;  5JQQ A;  2MZB A;  4B4M A;  1N4I A;  4G3P A;  4O6M A;  3SXC A;  2ICX A;  1ZJP A;  5CMH A;  5HS2 A;  1ZCT A;  2VHE A;  4Y6U A;  1H7G A;  4D11 C;  2PA4 A;  3FTT A;  3SXE A;  1Z2F A;  1INJ A;  1V82 A;  3VBP A;  2PGV A;  3JTJ A;  3U0X A;  3OW5 A;  1KRV A;  1R80 A;  3BSW A;  4KNX A;  5C1H A;  4CVH A;  1V84 A;  2A8U A;  5CQM X;  2PGY A;  2RJ6 A;  5AFU U;  5C47 A;  1O7Q A;  1ZJO A;  5EJ1 A;  1QRM A;  1TZF A;  1VPA A;  1H4E A;  1QRF A;  3KWE A;  3PKP A;  4M98 A;  2YQS A;  4JD0 A;  5FV9 A;  3F1X A;  3R3R A;  1VGW A;  3OC9 A;  2IU8 A;  4M28 A;  2WVM A;  5CMJ A;  4R36 A;  3SXA A;  1H5R A;  2YQC A;  4E1K A;  1JVG A;  1ZCV A;  3T7N A;  1EZI A;  4L41 C;  4HO6 A;  3VBM A;  2AQ9 A;  2IU9 A;  3V0N A;  3TIO A;  2JCJ A;  4Y7V A;  3OTZ A;  2P6W A;  3ZLK A;  1O7O A;  3OH1 A;  2WVL A;  5F42 A;  4NAI A;  1IIM A;  3DK5 A;  2D7R A;  1ZDG A;  2FYA A;  2V0H A;  3GQ8 A;  1IIN A;  3RMV A;  4Y7U A;  1YP3 A;  4EAA A;  3TQD A;  1QG8 A;  1FG5 N;  4KT7 A;  4H7O A;  1LVW A;  1H5T B;  3E25 A;  5CQP A;  3I3X A;  4Y6N A;  1R7T A;  4B42 A;  5DG3 A;  2AH9 A;  2AGD A;  1XHD A;  4Y7F A;  3HJJ A;  4M9C A;  1QGQ A;  4ARW A;  1VIC A;  2JCK A;  1TDT A;  4FCU A;  3V0Q A;  2RJ7 A;  3I3A A;  2XWN A;  4ASJ A;  4HCQ A;  4DCL A;  1LL2 A;  3SX5 A;  1KHR A;  2V0K A;  5J49 A;  2JF2 A;  3FOQ A;  4N6B A;  2FFU A;  2W0W A;  3FSY A;  3F1Y A;  1MR9 A;  5DEM A;  2Y4L A;  1KK6 A;  5C4B A;  1VH3 A;  3OKR A;  3ST8 A;  1LXA A;  3ZF8 A;  3DJ4 A;  3R5C A;  3D8V A;  2AM4 A;  4M4K A;  5DDT A;  5E3R A;  1V67 A;  3OU9 A;  2UX8 A;  2FFV A;  4FRH A;  1G93 A;  4FRB A;  4EEG A;  3GQ9 A;  1WT3 A;  1V3W A;  1XAT A;  1J2Z A;  3RMW A;  1HV9 A;  3LW6 A;  4ECM A;  4EGG A;  2RJ8 A;  4C2S A;  1O23 B;  2RIJ A;  5C4D A;  1WVC A;  1NKH B;  4KXO A;  4B2W A;  4KNR A;  1R7Y A;  1H5T A;  3KWC A;  1OMZ A;  1H3M A;  1H7L A;  2JCL A;  3OH3 A;  3T7O A;  3TK8 A;  3VBN A;  4MND A;  2X5S A;  4AAW A;  2NXV A;  5I1F A;  4CJB A;  1LL0 A;  4DDZ A;  1ZI4 A;  4ZDQ A;  3Q4S A;  2ZU8 A;  1FXO A;  1VM8 A;  1O0R A;  3N9W A;  1R7X A;  2I5E A;  3RSB A;  1TW5 A;  2XME A;  5CMG X;  3ECT A;  1JYK A;  2D0J A;  4FIY A;  3ZGG A;  4LW6 A;  4B3U A;  2OI6 A;  1H5S C;  1G95 A;  1JVD A;  2FYC B;  3CGX A;  2E8B A;  3I0K A;  4E6T A;  3SX3 A;  3CKO A;  1GQ9 A;  3IOI A;  4FRL A;  5FTV A;  5CQN X;  3I0D A;  2O1G A;  2Q4J A;  4Y62 A;  3U2V A;  2ZU7 A;  1MR7 A;  2XWL A;  1KGT A;  1SSQ A;  1W57 A;  3CKJ A;  3E26 A;  4DE7 A;  1FXJ A;  4E75 A;  2VFZ A;  3EH0 A;  2Y4M A;  3IOJ A;  3POL A;  4JIS A;  5AFU V;  3P1B A;  3MQG A;  2RIZ A;  1MP4 A;  5FU0 A;  4M2B A;  2W0V A;  3R0S A;  2I7B A;  4CJC A;  1SSM A;  3FSX A;  2WVK A;  5CMI A;  1S4P A;  5C38 A;  1TVY A;  4KPZ A;  2XWM A;  3TIS A;  4FRM A;  4FRP A;  2PX7 A;  3SPT A;  4NAK A;  3PNN A;  3GUE A;  4Y64 A;  2OI7 A;  4E6U A;  1ZCY A;  3D5N A;  2APC A;  5ADX U;  1ON6 A;  5C3D A;  5U2K A;  3MQH A;  2QIV X;  5IDT A;  1OCX A;  1FR9 A;  4EE3 A;  2VS3 A;  4Y9X A;  5D91 A;  2GGO A;  5CMF X;  3IXC A;  2YQH A;  5CQO A;  1I52 A;  4YS8 A;  4LW3 A;  1KRU A;  1GX4 A;  1HM0 A;  2YES A;  4D11 A;  1PZT A;  1FR8 A;  1R7U A;  4HO3 A;  5C48 A;  3BSS A;  2P73 A;  4G3S A;  4HO5 A;  3CKN A;  1INI A;  1LL3 A;  2YCM A;  4HUS A;  4J09 A;  2VS5 A;  4B4G A;  1FRW A;  1GX0 A;  2Y6P A;  3GQA A;  1NQI B;  4Y63 A;  1FGG A;  3FS8 A;  1LZ7 A;  2YQJ A;  4IRQ A;  4IHF A;  1MRL A;  3TDT A;  3U2X A;  2BO6 A;  4KC4 A;  4BQH A; 
#chains in the Genus database with same CATH homology
 5E3Q A;  2FYD B;  3DHO A;  1V83 A;  5D92 A;  1FGX A;  4B4B A;  4Y7T A;  2WLC A;  1NHE B;  2AES A;  4NAL A;  1ZHJ A;  4ISX A;  3SRT A;  2XAT A;  4R7P A;  3SXD A;  4MIX A;  3SXB A;  4P02 A;  2JCO A;  4KC2 A;  3V0P A;  3V0O A;  2QIA A;  4HUR A;  1Z90 A;  1H4D A;  1H7H A;  4EQY A;  1ZI3 A;  2QH5 A;  1MC3 A;  2WGZ A;  4HZC A;  1QRG A;  3VBJ A;  4AA7 A;  5E3P A;  1WT2 A;  3V91 A;  5IFY A;  2OEG A;  2YC3 A;  3K8D A;  3V0M A;  4B2X A;  4MZU A;  3EEV A;  3FWW A;  1MP5 A;  1KK4 A;  2RJ1 A;  1FWY A;  3R5D A;  2AE7 A;  5FYE A;  3KWD A;  2P2O A;  3T57 A;  4EE5 A;  3K8E A;  1OQM B;  3ZLL A;  2VD4 A;  3PKQ A;  3R5B A;  3KIA A;  1ZJ3 A;  3OTM A;  1KK5 A;  4EVW A;  2JF3 A;  4N27 A;  3QVB A;  2Y7A A;  1H5S B;  1ZJ0 A;  5C1G A;  1S80 A;  2WLG A;  3CU0 A;  1THJ A;  1G1L A;  2X5Z A;  4FIX A;  4EA9 A;  3V4E A;  4KQL A;  3USR A;  4N6A A;  1XHB A;  3I0L A;  2P72 A;  1KWS A;  4MYB A;  5DEP A;  3PMO A;  1VZU A;  4R37 A;  1H7Q A;  2X65 A;  3Q7U A;  4N69 A;  5C49 A;  5EIY A;  4NAN A;  2RJ9 A;  1ZDF A;  1R82 A;  1JV1 A;  5BXC A;  1JV3 A;  4G87 A;  3VBK A;  2IUA A;  1YRO B;  3OH4 A;  4MFG A;  3VNP A;  5FUH A;  1XZ6 A;  5C8R A;  2NPO A;  1G0R A;  1KRR A;  1H5R B;  2GGQ A;  3HSQ A;  3BFP A;  3R1W A;  2YC5 A;  3I0F A;  3OUP A;  4XWI A;  1HJL A;  3CJ8 A;  2Z86 A;  3FSC A;  5ADX V;  3IOH A;  5C4E A;  1MP3 A;  2WLF A;  2A8W A;  2BO7 A;  4O6N A;  3Q80 A;  3VBL A;  1HM8 A;  1VGZ A;  1ZI5 A;  3EE5 A;  4AYL A;  2I5K A;  1H5S A;  5C1L A;  4EA7 A;  4HZD A;  1NF5 B;  1LZI A;  1SS9 A;  1GQC A;  4IHG A;  4DEC A;  4UEG A;  2VS4 A;  1H7F A;  2RJ4 A;  4G3Q A;  2VXL A;  1VGT A;  1VH1 A;  4FCE A;  4GBP A;  1W77 A;  3OH2 A;  1QRL A;  1G9R A;  1ZJ1 A;  4HOC A;  4EEA A;  2AEC A;  3TWD A;  1G2V A;  4KRV A;  5DDV A;  3T7M A;  4HO4 A;  3NZ2 A;  1FO8 A;  2FYB A;  3SXG A;  4FRO A;  3I0J A;  2AM3 A;  5C3A A;  3F1C A;  2WE9 A;  4IRP A;  4AYJ A;  3OAM A;  2WLD A;  1R81 A;  2D7I A;  1KQA A;  3I0G A;  2V0I A;  3BXY A;  2Y4J A;  3USQ A;  5IDS A;  2VK9 A;  3NGW A;  3O3P A;  4KC1 A;  3CKV A;  5C4C A;  2Y4K A;  2O1H A;  1VGU A;  4IHH A;  3I0I X;  3EG4 A;  4AC3 A;  4FRD A;  3SX7 A;  1NWG B;  3MC4 A;  5EJZ A;  1VZX A;  3U2U A;  2V0J A;  1ZJ2 A;  4MYO A;  4HG6 A;  3TV0 A;  2ZU9 A;  1JYL A;  1VZT A;  5AJP A;  1SST A;  2TDT A;  3U2T A;  1G97 A;  1H5S D;  3OGZ A;  1YP2 A;  3FSB A;  4P00 A;  3BRK X;  1KGQ A;  3V8Y A;  2BO8 A;  2XMH A;  3DUV A;  4E79 A;  2IC7 A;  1LZ0 A;  3U0Y A;  3R5A A;  2VSH A;  1LZJ A;  1K4V A;  2O1F A;  1HM9 A;  3HL3 A;  4EEO A;  4ASY A;  1FOA A;  1QQ0 A;  2C0N A;  5L6S A;  2QGI A;  5FU8 A;  2RIT A;  1WSZ A;  1FZW A;  2FY7 A;  4J18 A;  4BMA A;  4FRQ A;  2Z87 A;  2RJ5 A;  3V8Z A;  2ICY A;  3TZT A;  1OMX A;  1QGS A;  4FRA A;  4Q7C A;  3JUK A;  1G3L A;  2WLE A;  1ON8 A;  1WT0 A;  1HJJ A;  5FTS A;  2V0L A;  2OEF A;  2VXM A;  3I0H A;  3SX8 A;  3D98 A;  1G23 A;  3JQY A;  2WAW A;  2OI5 A;  3V90 A;  5C36 A;  2E3D A;  1S4N A;  2RIY A;  4FRE A;  1S4O A;  4D0Z A;  3ZGF A;  3I0C A;  1E5K A;  2X60 A;  2AM5 A;  1H7E A;  4Y7G A;  3V0L A;  1H7T A;  4B5B A;  4D48 A;  4EE4 A;  3C8V A;  4HO2 A;  4M99 A;  3CKQ A;  4KPX A;  1YP4 A;  4K6R A;  2J0B A;  4D0T A;  1ZIZ A;  2J0A A;  2VSI A;  3GOS A;  1G8O A;  3OH0 A;  3U2W A;  4HO8 A;  1QRE A;  2BO4 A;  5AJN A;  1NMM B;  3BCV A;  2WEE A;  3IGJ A;  4EA8 A;  1EYR A;  1H4C A;  5L6V A;  3I0E A;  4FQW A;  1ZCU A;  4HO9 A;  5C4F A;  3P47 A;  3R8Y A;  1R7V A;  1ZI1 A;  2DPW A;  2RJ0 A;  1GWW A;  3BSY A;  1PZY B;  5AJO A;  2CU2 A;  4CJ8 A;  3R2W A;  3GVD A;  3JUJ A;  5CQL X;  1GA8 A;  1T3D A;  3R3I A;  4HO0 A;  1FO9 A;  1QWJ A;  4EAB A;  3Q1X A;  1WT1 A;  1GWV A;  5C3B A;  4M2A A;  2FKO A;  2QKX A;  3VBI A;  4EEM A;  1TW1 A;  2RIX A;  1W55 A;  5JQQ A;  2MZB A;  4B4M A;  4G3P A;  4O6M A;  3SXC A;  2ICX A;  1ZJP A;  5CMH A;  5HS2 A;  1ZCT A;  2VHE A;  4Y6U A;  1H7G A;  4D11 C;  2PA4 A;  3FTT A;  3SXE A;  1INJ A;  1V82 A;  3VBP A;  2PGV A;  3JTJ A;  3U0X A;  3OW5 A;  1KRV A;  1R80 A;  3BSW A;  4KNX A;  5C1H A;  4CVH A;  1V84 A;  2A8U A;  5CQM X;  2PGY A;  2RJ6 A;  5AFU U;  5C47 A;  1O7Q A;  1ZJO A;  5EJ1 A;  1QRM A;  1TZF A;  1VPA A;  1H4E A;  1QRF A;  3KWE A;  3PKP A;  4M98 A;  2YQS A;  4JD0 A;  5FV9 A;  3F1X A;  3R3R A;  1VGW A;  3OC9 A;  2IU8 A;  4M28 A;  2WVM A;  5CMJ A;  4R36 A;  3SXA A;  1H5R A;  2YQC A;  4E1K A;  1JVG A;  1ZCV A;  3T7N A;  1EZI A;  4L41 C;  4HO6 A;  3VBM A;  2AQ9 A;  2IU9 A;  3V0N A;  3TIO A;  2JCJ A;  4Y7V A;  3OTZ A;  2P6W A;  3ZLK A;  1O7O A;  3OH1 A;  2WVL A;  5F42 A;  4NAI A;  1IIM A;  3DK5 A;  2D7R A;  1ZDG A;  2FYA A;  2V0H A;  1IIN A;  3RMV A;  4Y7U A;  1YP3 A;  4EAA A;  3TQD A;  1QG8 A;  1FG5 N;  4KT7 A;  4H7O A;  1LVW A;  1H5T B;  3E25 A;  5CQP A;  3I3X A;  4Y6N A;  1R7T A;  4B42 A;  5DG3 A;  2AH9 A;  2AGD A;  1XHD A;  4Y7F A;  3HJJ A;  4M9C A;  1QGQ A;  4ARW A;  1VIC A;  2JCK A;  1TDT A;  4FCU A;  3V0Q A;  2RJ7 A;  3I3A A;  2XWN A;  4ASJ A;  4HCQ A;  4DCL A;  1LL2 A;  3SX5 A;  1KHR A;  2V0K A;  5J49 A;  2JF2 A;  3FOQ A;  4N6B A;  2FFU A;  2W0W A;  3FSY A;  3F1Y A;  1MR9 A;  5DEM A;  2Y4L A;  1KK6 A;  5C4B A;  1VH3 A;  3OKR A;  3ST8 A;  1LXA A;  3ZF8 A;  3DJ4 A;  3R5C A;  3D8V A;  2AM4 A;  4M4K A;  5DDT A;  5E3R A;  1V67 A;  3OU9 A;  2UX8 A;  2FFV A;  4FRH A;  1G93 A;  4FRB A;  4EEG A;  1WT3 A;  1V3W A;  1XAT A;  1J2Z A;  3RMW A;  1HV9 A;  3LW6 A;  4ECM A;  4EGG A;  2RJ8 A;  4C2S A;  1O23 B;  2RIJ A;  5C4D A;  1WVC A;  1NKH B;  4KXO A;  4B2W A;  4KNR A;  1R7Y A;  1H5T A;  3KWC A;  1OMZ A;  1H3M A;  1H7L A;  2JCL A;  3OH3 A;  3T7O A;  3TK8 A;  3VBN A;  4MND A;  2X5S A;  4AAW A;  2NXV A;  5I1F A;  4CJB A;  1LL0 A;  4DDZ A;  1ZI4 A;  4ZDQ A;  3Q4S A;  2ZU8 A;  1FXO A;  1VM8 A;  1O0R A;  3N9W A;  1R7X A;  2I5E A;  3RSB A;  1TW5 A;  2XME A;  5CMG X;  3ECT A;  1JYK A;  2D0J A;  4FIY A;  3ZGG A;  4LW6 A;  4B3U A;  2OI6 A;  1H5S C;  1G95 A;  1JVD A;  2FYC B;  3CGX A;  2E8B A;  3I0K A;  4E6T A;  3SX3 A;  3CKO A;  1GQ9 A;  3IOI A;  4FRL A;  5FTV A;  5CQN X;  3I0D A;  2O1G A;  2Q4J A;  4Y62 A;  3U2V A;  2ZU7 A;  1MR7 A;  2XWL A;  1KGT A;  1SSQ A;  1W57 A;  3CKJ A;  3E26 A;  4DE7 A;  1FXJ A;  4E75 A;  2VFZ A;  3EH0 A;  2Y4M A;  3IOJ A;  3POL A;  4JIS A;  5AFU V;  3P1B A;  3MQG A;  2RIZ A;  1MP4 A;  5FU0 A;  4M2B A;  2W0V A;  3R0S A;  2I7B A;  4CJC A;  1SSM A;  3FSX A;  2WVK A;  5CMI A;  1S4P A;  5C38 A;  1TVY A;  4KPZ A;  2XWM A;  3TIS A;  4FRM A;  4FRP A;  2PX7 A;  3SPT A;  4NAK A;  3PNN A;  3GUE A;  4Y64 A;  2OI7 A;  4E6U A;  1ZCY A;  3D5N A;  2APC A;  5ADX U;  1ON6 A;  5C3D A;  5U2K A;  3MQH A;  2QIV X;  5IDT A;  1OCX A;  1FR9 A;  4EE3 A;  2VS3 A;  4Y9X A;  5D91 A;  2GGO A;  5CMF X;  3IXC A;  2YQH A;  5CQO A;  1I52 A;  4YS8 A;  4LW3 A;  1KRU A;  1GX4 A;  1HM0 A;  2YES A;  4D11 A;  1PZT A;  1FR8 A;  1R7U A;  4HO3 A;  5C48 A;  3BSS A;  2P73 A;  4G3S A;  4HO5 A;  3CKN A;  1INI A;  1LL3 A;  2YCM A;  4HUS A;  4J09 A;  2VS5 A;  4B4G A;  1FRW A;  1GX0 A;  2Y6P A;  1NQI B;  4Y63 A;  1FGG A;  3FS8 A;  1LZ7 A;  2YQJ A;  4IRQ A;  4IHF A;  1MRL A;  3TDT A;  3U2X A;  2BO6 A;  4KC4 A;  4BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...