5DEMA

Structure of pseudomonas aeruginosa lpxa
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
257
structure length
257
Chain Sequence
SLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain pa7)
molecule tags Transferase
total genus 105
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5demA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5demA01
4EA7A 4HCQA 3ST8A 4IHGA 3NZ2A 3R5CA 4J18A 3KWDA 4HZCA 3R5BA 3R1WA 4KPXA 3PMOA 1XATA 4KNRA 4G3SA 5L6SA 4AC3A 3SPTA 1KK4A 4M98A 2V0KA 3DK5A 2IU8A 4M9CA 4E6UA 2OI5A 1MR7A 4J09A 1KK6A 1SSQA 3FS8A 4EAAA 1QRFA 5U2KA 3BXYA 4IHFA 3VNPA 1V67A 3VBIA 5E3RA 3DJ4A 3TDTA 2TDTA 3P1BA 2AQ9A 3GOSA 4EGGA 1YP3A 2GGQA 4AAWA 2I5KA 1J2ZA 1LXAA 1KRUA 4E79A 3T57A 2P2OA 1KRVA 1HM9A 3BSYA 4E1KA 3TWDA 3BSWA 2V0LA 3EH0A 3TK8A 2WLGA 5E3PA 1FXJA 1QRLA 5ADXU 5ADXV 3KWCA 4G87A 3TISA 2IUAA 4IHHA 3R5DA 3R8YA 3HSQA 4KNXA 1HM0A 2WLDA 4ISXA 1V3WA 3V4EA 2RIJA 4MZUA 2IC7A 1OCXA 3D8VA 3OUPA 3D98A 3EEVA 3P47A 2W0VA 4N69A 3FSYA 5AFUU 2IU9A 1QQ0A 4R37A 5DEPA 3F1XA 1FWYA 1MRLA 1KGTA 1G97A 3SRTA 4DCLA 2ICYA 1HM8A 4M28A 3OU9A 1QREA 3KWEA 2VHEA 4H7OA 2WLCA 5DG3A 4M99A 3C8VA 3HJJA 3FWWA 3FSCA 4MFGA 1TDTA 5E3QA 1Z90A 3VBNA 1T3DA 1KQAA 4K6RA 2QIAA 1THJA 2GGOA 2VD4A 3BRKX 4KPZA 2QKXA 3VBPA 3GVDA 3R5AA 4E75A 4N6AA 3CJ8A 3I3AA 3I3XA 4EA8A 2OEGA 2JF2A 4HURA 5L6VA 3VBKA 4AA7A 2OEFA 3OTMA 5AFUV 1G95A 1QRMA 3DHOA 3TV0A 4M2BA 2V0HA 1KRRA 3R0SA 3Q1XA 3IXCA 3R2WA 2Q4JA 4N27A 3FSBA 4E6TA 3VBJA 3FOQA 3MQHA 3VBLA 3JQYA 4KQLA 4R36A 2JF3A 2NPOA 1YP2A 1QRGA 3VBMA 1KHRA 2W0WA 2OI7A 2XATA 3FTTA 3OTZA 3BSSA 4EABA 4HUSA 3MC4A 1YP4A 4G3PA 4N6BA 3R3IA 3BFPA 4EQYA 1KK5A 4MYOA 2QIVX 3FSXA 1HV9A 5F42A 1XHDA 2WLEA 2WLFA 1KGQA 4FCEA 4G3QA 4R7PA 1SSTA 4EA9A 3ECTA 2FKOA 2V0JA 3MQGA 3OW5A 2V0IA 4HZDA 3R3RA 3GUEA 2OI6A 1S80A 4M2AA 1MR9A 2ICXA 5DEMA 1SSMA 3EG4A 3IGJA 3TIOA
chains in the Genus database with same CATH superfamily
4EA7A 3OGZA 4HCQA 3ST8A 4IHGA 3NZ2A 3R5CA 4J18A 3KWDA 4HZCA 3R5BA 3R1WA 4KPXA 3PMOA 1Z2FA 1XATA 4KNRA 4G3SA 3OH3A 5L6SA 4AC3A 3SPTA 1KK4A 4M98A 2V0KA 3DK5A 2IU8A 4M9CA 4E6UA 2OI5A 1MR7A 3OH1A 4J09A 1KK6A 1SSQA 3FS8A 4EAAA 1QRFA 5U2KA 3BXYA 4IHFA 3VNPA 1V67A 3VBIA 5E3RA 3DJ4A 3SUCA 3TDTA 2TDTA 3P1BA 2AQ9A 3GOSA 4EGGA 1YP3A 2GGQA 4AAWA 2I5KA 1J2ZA 1LXAA 1KRUA 4E79A 3T57A 2P2OA 1KRVA 1HM9A 3BSYA 4E1KA 3TWDA 3BSWA 2V0LA 3EH0A 3TK8A 2WLGA 5E3PA 1FXJA 1QRLA 5ADXU 5ADXV 3KWCA 4G87A 3TISA 2IUAA 4IHHA 3R5DA 3R8YA 3HSQA 4KNXA 1HM0A 2WLDA 4ISXA 1V3WA 3V4EA 2RIJA 4MZUA 1EWWA 3OH0A 2IC7A 1L0SA 1OCXA 3D8VA 3OUPA 3D98A 3EEVA 3P47A 2W0VA 4N69A 3GQAA 3FSYA 5AFUU 2IU9A 1QQ0A 4R37A 5DEPA 3F1XA 1FWYA 1MRLA 1KGTA 1G97A 3SRTA 4DCLA 2ICYA 1HM8A 4M28A 3OU9A 1QREA 3KWEA 2VHEA 4H7OA 2WLCA 5DG3A 4M99A 3GQ9A 3C8VA 3HJJA 3FWWA 3FSCA 4MFGA 1TDTA 5E3QA 1Z90A 3VBNA 1T3DA 1KQAA 4K6RA 2QIAA 1THJA 2GGOA 2VD4A 3BRKX 4KPZA 2QKXA 3VBPA 3GVDA 3R5AA 4E75A 4N6AA 3CJ8A 3I3AA 3I3XA 4EA8A 2OEGA 2JF2A 4HURA 5L6VA 3OH4A 3VBKA 4AA7A 2OEFA 3OTMA 5AFUV 1G95A 1QRMA 3DHOA 3TV0A 4M2BA 2V0HA 1KRRA 3R0SA 3Q1XA 3GQ8A 3IXCA 3R2WA 2Q4JA 1N4IA 4N27A 3FSBA 4E6TA 3VBJA 3FOQA 3MQHA 3VBLA 3JQYA 4KQLA 4R36A 2JF3A 2NPOA 1M8NA 1YP2A 1QRGA 3VBMA 1KHRA 2W0WA 2OI7A 2XATA 3FTTA 3OH2A 3BSSA 3OTZA 4HUSA 4EABA 3MC4A 1YP4A 4G3PA 4N6BA 3R3IA 3BFPA 4EQYA 1KK5A 4MYOA 2QIVX 3FSXA 1HV9A 5F42A 1XHDA 2WLEA 2WLFA 1KGQA 4FCEA 4G3QA 4R7PA 1SSTA 4EA9A 3ECTA 2FKOA 2V0JA 3MQGA 3OW5A 2V0IA 4HZDA 3R3RA 3GUEA 2OI6A 1S80A 4M2AA 1MR9A 2ICXA 5DEMA 3GQ7A 1SSMA 3EG4A 3IGJA 3TIOA
chains in the Genus database with same CATH topology
4EA7A 4HCQA 3ST8A 4IHGA 3NZ2A 3R5CA 4J18A 3KWDA 4HZCA 3R5BA 3R1WA 4KPXA 3PMOA 1XATA 4KNRA 4G3SA 5L6SA 4AC3A 3SPTA 1KK4A 4M98A 2V0KA 3DK5A 2IU8A 4M9CA 4E6UA 2OI5A 1MR7A 4J09A 1KK6A 1SSQA 3FS8A 4EAAA 1QRFA 5U2KA 3BXYA 4IHFA 3VNPA 1V67A 3VBIA 5E3RA 3DJ4A 3TDTA 2TDTA 3P1BA 2AQ9A 3GOSA 4EGGA 1YP3A 2GGQA 4AAWA 2I5KA 1J2ZA 1LXAA 1KRUA 4E79A 3T57A 2P2OA 1KRVA 1HM9A 3BSYA 4E1KA 3TWDA 3BSWA 2V0LA 3EH0A 3TK8A 2WLGA 5E3PA 1FXJA 1QRLA 5ADXU 5ADXV 3KWCA 4G87A 3TISA 2IUAA 4IHHA 3R5DA 3R8YA 3HSQA 4KNXA 1HM0A 2WLDA 4ISXA 1V3WA 3V4EA 2RIJA 4MZUA 2IC7A 1OCXA 3D8VA 3OUPA 3D98A 3EEVA 3P47A 2W0VA 4N69A 3FSYA 5AFUU 2IU9A 1QQ0A 4R37A 5DEPA 3F1XA 1FWYA 1MRLA 1KGTA 1G97A 3SRTA 4DCLA 2ICYA 1HM8A 4M28A 3OU9A 1QREA 3KWEA 2VHEA 4H7OA 2WLCA 5DG3A 4M99A 3C8VA 3HJJA 3FWWA 3FSCA 4MFGA 1TDTA 5E3QA 1Z90A 3VBNA 1T3DA 1KQAA 4K6RA 2QIAA 1THJA 2GGOA 2VD4A 3BRKX 4KPZA 2QKXA 3VBPA 3GVDA 3R5AA 4E75A 4N6AA 3CJ8A 3I3AA 3I3XA 4EA8A 2OEGA 2JF2A 4HURA 5L6VA 3VBKA 4AA7A 2OEFA 3OTMA 5AFUV 1G95A 1QRMA 3DHOA 3TV0A 4M2BA 2V0HA 1KRRA 3R0SA 3Q1XA 3IXCA 3R2WA 2Q4JA 4N27A 3FSBA 4E6TA 3VBJA 3FOQA 3MQHA 3VBLA 3JQYA 4KQLA 4R36A 2JF3A 2NPOA 1YP2A 1QRGA 3VBMA 1KHRA 2W0WA 2OI7A 2XATA 3FTTA 3OTZA 3BSSA 4EABA 4HUSA 3MC4A 1YP4A 4G3PA 4N6BA 3R3IA 3BFPA 4EQYA 1KK5A 4MYOA 2QIVX 3FSXA 1HV9A 5F42A 1XHDA 2WLEA 2WLFA 1KGQA 4FCEA 4G3QA 4R7PA 1SSTA 4EA9A 3ECTA 2FKOA 2V0JA 3MQGA 3OW5A 2V0IA 4HZDA 3R3RA 3GUEA 2OI6A 1S80A 4M2AA 1MR9A 2ICXA 5DEMA 1SSMA 3EG4A 3IGJA 3TIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA7 A;  4HCQ A;  3ST8 A;  4IHG A;  3NZ2 A;  3R5C A;  4J18 A;  3KWD A;  4HZC A;  3R5B A;  3R1W A;  4KPX A;  3PMO A;  1XAT A;  4KNR A;  4G3S A;  5L6S A;  4AC3 A;  3SPT A;  1KK4 A;  4M98 A;  2V0K A;  3DK5 A;  2IU8 A;  4M9C A;  4E6U A;  2OI5 A;  1MR7 A;  4J09 A;  1KK6 A;  1SSQ A;  3FS8 A;  4EAA A;  1QRF A;  5U2K A;  3BXY A;  4IHF A;  3VNP A;  1V67 A;  3VBI A;  5E3R A;  3DJ4 A;  3TDT A;  2TDT A;  3P1B A;  2AQ9 A;  3GOS A;  4EGG A;  1YP3 A;  2GGQ A;  4AAW A;  2I5K A;  1J2Z A;  1LXA A;  1KRU A;  4E79 A;  3T57 A;  2P2O A;  1KRV A;  1HM9 A;  3BSY A;  4E1K A;  3TWD A;  3BSW A;  2V0L A;  3EH0 A;  3TK8 A;  2WLG A;  5E3P A;  1FXJ A;  1QRL A;  5ADX U;  5ADX V;  3KWC A;  4G87 A;  3TIS A;  2IUA A;  4IHH A;  3R5D A;  3R8Y A;  3HSQ A;  4KNX A;  1HM0 A;  2WLD A;  4ISX A;  1V3W A;  3V4E A;  2RIJ A;  4MZU A;  2IC7 A;  1OCX A;  3D8V A;  3OUP A;  3D98 A;  3EEV A;  3P47 A;  2W0V A;  4N69 A;  3FSY A;  5AFU U;  2IU9 A;  1QQ0 A;  4R37 A;  5DEP A;  3F1X A;  1FWY A;  1MRL A;  1KGT A;  1G97 A;  3SRT A;  4DCL A;  2ICY A;  1HM8 A;  4M28 A;  3OU9 A;  1QRE A;  3KWE A;  2VHE A;  4H7O A;  2WLC A;  5DG3 A;  4M99 A;  3C8V A;  3HJJ A;  3FWW A;  3FSC A;  4MFG A;  1TDT A;  5E3Q A;  1Z90 A;  3VBN A;  1T3D A;  1KQA A;  4K6R A;  2QIA A;  1THJ A;  2GGO A;  2VD4 A;  3BRK X;  4KPZ A;  2QKX A;  3VBP A;  3GVD A;  3R5A A;  4E75 A;  4N6A A;  3CJ8 A;  3I3A A;  3I3X A;  4EA8 A;  2OEG A;  2JF2 A;  4HUR A;  5L6V A;  3VBK A;  4AA7 A;  2OEF A;  3OTM A;  5AFU V;  1G95 A;  1QRM A;  3DHO A;  3TV0 A;  4M2B A;  2V0H A;  1KRR A;  3R0S A;  3Q1X A;  3IXC A;  3R2W A;  2Q4J A;  4N27 A;  3FSB A;  4E6T A;  3VBJ A;  3FOQ A;  3MQH A;  3VBL A;  3JQY A;  4KQL A;  4R36 A;  2JF3 A;  2NPO A;  1YP2 A;  1QRG A;  3VBM A;  1KHR A;  2W0W A;  2OI7 A;  2XAT A;  3FTT A;  3OTZ A;  3BSS A;  4EAB A;  4HUS A;  3MC4 A;  1YP4 A;  4G3P A;  4N6B A;  3R3I A;  3BFP A;  4EQY A;  1KK5 A;  4MYO A;  2QIV X;  3FSX A;  1HV9 A;  5F42 A;  1XHD A;  2WLE A;  2WLF A;  1KGQ A;  4FCE A;  4G3Q A;  4R7P A;  1SST A;  4EA9 A;  3ECT A;  2FKO A;  2V0J A;  3MQG A;  3OW5 A;  2V0I A;  4HZD A;  3R3R A;  3GUE A;  2OI6 A;  1S80 A;  4M2A A;  1MR9 A;  2ICX A;  5DEM A;  1SSM A;  3EG4 A;  3IGJ A;  3TIO A; 
#chains in the Genus database with same CATH topology
 4EA7 A;  3OGZ A;  4HCQ A;  3ST8 A;  4IHG A;  3NZ2 A;  3R5C A;  4J18 A;  3KWD A;  4HZC A;  3R5B A;  3R1W A;  4KPX A;  3PMO A;  1Z2F A;  1XAT A;  4KNR A;  4G3S A;  3OH3 A;  5L6S A;  4AC3 A;  3SPT A;  1KK4 A;  4M98 A;  2V0K A;  3DK5 A;  2IU8 A;  4M9C A;  4E6U A;  2OI5 A;  1MR7 A;  3OH1 A;  4J09 A;  1KK6 A;  1SSQ A;  3FS8 A;  4EAA A;  1QRF A;  5U2K A;  3BXY A;  4IHF A;  3VNP A;  1V67 A;  3VBI A;  5E3R A;  3DJ4 A;  3SUC A;  3TDT A;  2TDT A;  3P1B A;  2AQ9 A;  3GOS A;  4EGG A;  1YP3 A;  2GGQ A;  4AAW A;  2I5K A;  1J2Z A;  1LXA A;  1KRU A;  4E79 A;  3T57 A;  2P2O A;  1KRV A;  1HM9 A;  3BSY A;  4E1K A;  3TWD A;  3BSW A;  2V0L A;  3EH0 A;  3TK8 A;  2WLG A;  5E3P A;  1FXJ A;  1QRL A;  5ADX U;  5ADX V;  3KWC A;  4G87 A;  3TIS A;  2IUA A;  4IHH A;  3R5D A;  3R8Y A;  3HSQ A;  4KNX A;  1HM0 A;  2WLD A;  4ISX A;  1V3W A;  3V4E A;  2RIJ A;  4MZU A;  1EWW A;  3OH0 A;  2IC7 A;  1L0S A;  1OCX A;  3D8V A;  3OUP A;  3D98 A;  3EEV A;  3P47 A;  2W0V A;  4N69 A;  3GQA A;  3FSY A;  5AFU U;  2IU9 A;  1QQ0 A;  4R37 A;  5DEP A;  3F1X A;  1FWY A;  1MRL A;  1KGT A;  1G97 A;  3SRT A;  4DCL A;  2ICY A;  1HM8 A;  4M28 A;  3OU9 A;  1QRE A;  3KWE A;  2VHE A;  4H7O A;  2WLC A;  5DG3 A;  4M99 A;  3GQ9 A;  3C8V A;  3HJJ A;  3FWW A;  3FSC A;  4MFG A;  1TDT A;  5E3Q A;  1Z90 A;  3VBN A;  1T3D A;  1KQA A;  4K6R A;  2QIA A;  1THJ A;  2GGO A;  2VD4 A;  3BRK X;  4KPZ A;  2QKX A;  3VBP A;  3GVD A;  3R5A A;  4E75 A;  4N6A A;  3CJ8 A;  3I3A A;  3I3X A;  4EA8 A;  2OEG A;  2JF2 A;  4HUR A;  5L6V A;  3OH4 A;  3VBK A;  4AA7 A;  2OEF A;  3OTM A;  5AFU V;  1G95 A;  1QRM A;  3DHO A;  3TV0 A;  4M2B A;  2V0H A;  1KRR A;  3R0S A;  3Q1X A;  3GQ8 A;  3IXC A;  3R2W A;  2Q4J A;  1N4I A;  4N27 A;  3FSB A;  4E6T A;  3VBJ A;  3FOQ A;  3MQH A;  3VBL A;  3JQY A;  4KQL A;  4R36 A;  2JF3 A;  2NPO A;  1M8N A;  1YP2 A;  1QRG A;  3VBM A;  1KHR A;  2W0W A;  2OI7 A;  2XAT A;  3FTT A;  3OH2 A;  3BSS A;  3OTZ A;  4HUS A;  4EAB A;  3MC4 A;  1YP4 A;  4G3P A;  4N6B A;  3R3I A;  3BFP A;  4EQY A;  1KK5 A;  4MYO A;  2QIV X;  3FSX A;  1HV9 A;  5F42 A;  1XHD A;  2WLE A;  2WLF A;  1KGQ A;  4FCE A;  4G3Q A;  4R7P A;  1SST A;  4EA9 A;  3ECT A;  2FKO A;  2V0J A;  3MQG A;  3OW5 A;  2V0I A;  4HZD A;  3R3R A;  3GUE A;  2OI6 A;  1S80 A;  4M2A A;  1MR9 A;  2ICX A;  5DEM A;  3GQ7 A;  1SSM A;  3EG4 A;  3IGJ A;  3TIO A; 
#chains in the Genus database with same CATH homology
 4EA7 A;  4HCQ A;  3ST8 A;  4IHG A;  3NZ2 A;  3R5C A;  4J18 A;  3KWD A;  4HZC A;  3R5B A;  3R1W A;  4KPX A;  3PMO A;  1XAT A;  4KNR A;  4G3S A;  5L6S A;  4AC3 A;  3SPT A;  1KK4 A;  4M98 A;  2V0K A;  3DK5 A;  2IU8 A;  4M9C A;  4E6U A;  2OI5 A;  1MR7 A;  4J09 A;  1KK6 A;  1SSQ A;  3FS8 A;  4EAA A;  1QRF A;  5U2K A;  3BXY A;  4IHF A;  3VNP A;  1V67 A;  3VBI A;  5E3R A;  3DJ4 A;  3TDT A;  2TDT A;  3P1B A;  2AQ9 A;  3GOS A;  4EGG A;  1YP3 A;  2GGQ A;  4AAW A;  2I5K A;  1J2Z A;  1LXA A;  1KRU A;  4E79 A;  3T57 A;  2P2O A;  1KRV A;  1HM9 A;  3BSY A;  4E1K A;  3TWD A;  3BSW A;  2V0L A;  3EH0 A;  3TK8 A;  2WLG A;  5E3P A;  1FXJ A;  1QRL A;  5ADX U;  5ADX V;  3KWC A;  4G87 A;  3TIS A;  2IUA A;  4IHH A;  3R5D A;  3R8Y A;  3HSQ A;  4KNX A;  1HM0 A;  2WLD A;  4ISX A;  1V3W A;  3V4E A;  2RIJ A;  4MZU A;  2IC7 A;  1OCX A;  3D8V A;  3OUP A;  3D98 A;  3EEV A;  3P47 A;  2W0V A;  4N69 A;  3FSY A;  5AFU U;  2IU9 A;  1QQ0 A;  4R37 A;  5DEP A;  3F1X A;  1FWY A;  1MRL A;  1KGT A;  1G97 A;  3SRT A;  4DCL A;  2ICY A;  1HM8 A;  4M28 A;  3OU9 A;  1QRE A;  3KWE A;  2VHE A;  4H7O A;  2WLC A;  5DG3 A;  4M99 A;  3C8V A;  3HJJ A;  3FWW A;  3FSC A;  4MFG A;  1TDT A;  5E3Q A;  1Z90 A;  3VBN A;  1T3D A;  1KQA A;  4K6R A;  2QIA A;  1THJ A;  2GGO A;  2VD4 A;  3BRK X;  4KPZ A;  2QKX A;  3VBP A;  3GVD A;  3R5A A;  4E75 A;  4N6A A;  3CJ8 A;  3I3A A;  3I3X A;  4EA8 A;  2OEG A;  2JF2 A;  4HUR A;  5L6V A;  3VBK A;  4AA7 A;  2OEF A;  3OTM A;  5AFU V;  1G95 A;  1QRM A;  3DHO A;  3TV0 A;  4M2B A;  2V0H A;  1KRR A;  3R0S A;  3Q1X A;  3IXC A;  3R2W A;  2Q4J A;  4N27 A;  3FSB A;  4E6T A;  3VBJ A;  3FOQ A;  3MQH A;  3VBL A;  3JQY A;  4KQL A;  4R36 A;  2JF3 A;  2NPO A;  1YP2 A;  1QRG A;  3VBM A;  1KHR A;  2W0W A;  2OI7 A;  2XAT A;  3FTT A;  3OTZ A;  3BSS A;  4EAB A;  4HUS A;  3MC4 A;  1YP4 A;  4G3P A;  4N6B A;  3R3I A;  3BFP A;  4EQY A;  1KK5 A;  4MYO A;  2QIV X;  3FSX A;  1HV9 A;  5F42 A;  1XHD A;  2WLE A;  2WLF A;  1KGQ A;  4FCE A;  4G3Q A;  4R7P A;  1SST A;  4EA9 A;  3ECT A;  2FKO A;  2V0J A;  3MQG A;  3OW5 A;  2V0I A;  4HZD A;  3R3R A;  3GUE A;  2OI6 A;  1S80 A;  4M2A A;  1MR9 A;  2ICX A;  5DEM A;  1SSM A;  3EG4 A;  3IGJ A;  3TIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...