3SPTA

Crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
474
structure length
474
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title Structure of Mycobacterium tuberculosis GlmU in complex with Acetyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 179
structure length 474
sequence length 474
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2011-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3sptA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sptA01
2E8BA 1VH1A 3N9WA 4CJ8A 5CMJA 5E3QA 3BSYA 4ISXA 3C8VA 1KRUA 3R3RA 2JCJA 4HO3A 4HG6A 2VS5A 3TDTA 1WT3A 3KIAA 4ZDQA 3HL3A 1QRFA 4D0TA 4GBPA 4ECMA 3ZGGA 2I5KA 1VZUA 1GA8A 1VPAA 3OH0A 3ZF8A 2PA4A 2YCMA 4R7PA 1HM8A 4Y6UA 2OEFA 5ADXU 1PZYB 2VS4A 5CQPA 3CKJA 2XWLA 1KGQA 5CQMX 1FXOA 3U0YA 4K6RA 4G3QA 2BO8A 4HO0A 1ZCUA 1NWGB 5C4BA 3I3AA 1TVYA 5L6VA 2FYDB 2QGIA 5AJPA 4FRDA 1LZJA 2DPWA 1G97A 2O1FA 3IXCA 3I0EA 3EH0A 2NXVA 4D48A 1PZTA 3I3XA 4FRLA 1LVWA 5IDTA 4B42A 4DDZA 4MFGA 3V0LA 5AJOA 3BFPA 3DHOA 4Y7UA 3VBKA 3R5BA 1O7OA 5FUHA 2RJ0A 1H4CA 1R7TA 1R82A 1FZWA 1QRGA 1H7TA 1ZI3A 4EA7A 3ZLKA 2IU9A 2RITA 3O3PA 4IRQA 4HO6A 1NKHB 3MQGA 1G8OA 4P00A 2GGOA 2AM3A 1ZDGA 3CKOA 4HO4A 2VSIA 3OC9A 4N6AA 4KNRA 5EJ1A 1ZI4A 3CGXA 1LL3A 1ZHJA 4FRMA 3SXGA 1MP3A 4B4MA 4M9CA 4L41C 3R5CA 1VH3A 1FWYA 4HZDA 1LZIA 2TDTA 1ZJ2A 3KWDA 4ARWA 3USRA 2IC7A 3I0JA 1MP5A 4DE7A 3U2VA 4CVHA 2Y4JA 1LL2A 3JUJA 3SXCA 4J09A 3ECTA 3RMWA 1MR7A 2WGZA 1KK6A 3FSBA 4KNXA 1XHBA 4FROA 5AFUU 3FSYA 1V82A 3JTJA 3FSXA 3U0XA 2XMEA 4IHGA 2V0LA 1OMXA 2ZU7A 4E6TA 2D7RA 4HO9A 4Y7FA 1QWJA 1XZ6A 5IFYA 3FSCA 1VICA 4XWIA 3OTZA 1VM8A 3JQYA 4AAWA 1S4PA 3FTTA 5DG3A 3SXDA 1TW5A 5FV9A 3OU9A 1WT1A 3JUKA 1ZJ3A 4E1KA 1W77A 3V91A 3SXEA 3T7OA 1R80A 3POLA 2XWMA 4HO2A 3OGZA 2FKOA 3FS8A 2X65A 4M2BA 1G2VA 4EA9A 1OCXA 4AC3A 3CKNA 4JISA 2AE7A 2Y4LA 5FTSA 4KC1A 1LZ0A 3MC4A 4KPXA 5U2KA 1QGSA 1NQIB 1GWWA 3SX5A 4EEMA 2E3DA 3V0MA 2V0HA 1E5KA 3I0GA 3D98A 1FGXA 1H7QA 5CQOA 1OMZA 2ZU9A 2PGVA 1VGTA 5FU0A 2WLGA 3Q1XA 4M28A 2FYBA 1QREA 1GQ9A 4EGGA 5JQQA 4M98A 1G1LA 1H7GA 3RMVA 3BXYA 1H5TB 5CMHA 3IGJA 1R7XA 3E25A 5C3AA 5IDSA 3U2TA 3SXBA 1LZ7A 2APCA 3DK5A 4MYOA 2Z86A 1H3MA 5CQNX 3EEVA 3TQDA 1EZIA 1H5SC 1FG5N 3EG4A 2RJ4A 5C1HA 3T7NA 1GX0A 1H7LA 4B4BA 1FOAA 1T3DA 2QH5A 2O1HA 3R2WA 1JYKA 3IOHA 3P1BA 4MZUA 1JVDA 2ZU8A 1ZI1A 2YQSA 5AJNA 4Y7GA 1WT0A 1XATA 2D7IA 3PNNA 5C48A 1V67A 5AFUV 1S80A 4EABA 1LL0A 2AM5A 4E79A 4YS8A 2WLDA 4NALA 3D8VA 4AA7A 5CMFX 1SSTA 3V0PA 3VBIA 1R7UA 1H5SB 4HO5A 3E26A 2YC3A 3VNPA 1ZJPA 1MR9A 1KWSA 4MNDA 4B2XA 5C3DA 4N6BA 3V8ZA 1ZJ1A 5HS2A 3DJ4A 1NF5B 4FQWA 2WVLA 3T7MA 1H5RA 2JF3A 1ZIZA 2Y7AA 3SRTA 2WLFA 4LW3A 5CMIA 5C4EA 4R36A 3ZLLA 4FCUA 4D0ZA 4G3SA 1H5SD 2P72A 1H7EA 1ZDFA 1LXAA 1FGGA 4IRPA 3I0LA 2YESA 2IUAA 1IIMA 3TWDA 1G9RA 4KPZA 3SX8A 1ZCVA 2QKXA 1S4OA 2I7BA 2VXLA 4FRBA 4Y6NA 3OH1A 2NPOA 1SS9A 2RIXA 2VSHA 1O7QA 4NANA 1R7YA 5FTVA 2X5SA 3V0QA 1W55A 3Q7UA 5EJZA 3BSWA 1H5TA 3F1YA 4CJCA 2UX8A 4EEAA 4HOCA 2BO4A 1NHEB 2P6WA 2JCOA 2FFVA 3V0OA 3R5DA 3R5AA 1VGZA 2YQJA 1H4EA 1HV9A 1G93A 2WVKA 3OAMA 1YP2A 3F1CA 1HM9A 5E3PA 2A8WA 3PMOA 5ADXV 1TDTA 4D11C 5C4CA 5C36A 4Y63A 3OH3A 4MYBA 2W0VA 3SXAA 2ICYA 4FRQA 4LW6A 2VFZA 4Y7TA 1YP3A 5C38A 4KT7A 3K8EA 1HJJA 2AESA 3OTMA 1H4DA 1VZTA 2PX7A 3RSBA 4EVWA 2WLCA 3LW6A 4B5BA 3TIOA 4FRHA 4H7OA 5C1LA 1G95A 4EEGA 4EE3A 1FR8A 3VBNA 4N69A 1H5SA 2OI7A 3U2WA 3SX7A 2WVMA 4BMAA 4FRAA 2V0IA 4ASJA 1NMMB 4AYJA 1VGUA 1ZCTA 3GOSA 3ST8A 4DCLA 3USQA 1MRLA 4FRPA 3KWCA 1JV3A 4KC2A 1IINA 4KXOA 3V0NA 2MZBA 3I0FA 1FO8A 3T57A 2BO7A 1J2ZA 4Y7VA 5F42A 1O0RA 1ON8A 1INIA 4BQHA 2AECA 2OI5A 2AQ9A 1V83A 3F1XA 1KHRA 3IOJA 2BO6A 3GVDA 1G3LA 3QVBA 3V90A 1YP4A 4DECA 4KC4A 4EEOA 1FR9A 1JYLA 1R7VA 1VGWA 2WAWA 4HCQA 2JF2A 2RJ8A 5CMGX 5FU8A 2X5ZA 2IU8A 2PGYA 3BRKX 3TK8A 3CKQA 5CQLX 1ON6A 2V0JA 1KRRA 4EE5A 1Z90A 1JVGA 1V3WA 2YC5A 3SX3A 1QG8A 2Y4KA 5C3BA 5C1GA 1H7HA 2AGDA 4HURA 3VBMA 1WSZA 3Q4SA 5C8RA 3BSSA 4HO8A 4UEGA 3EE5A 2Q4JA 1G0RA 1MC3A 4G3PA 3I0KA 2JCKA 4KRVA 1QRLA 5J49A 2FFUA 5DEPA 2RJ7A 2RIJA 1YROB 4Y62A 4E6UA 2RJ9A 1KGTA 5C49A 2QIVX 4AYLA 3HJJA 4FREA 1SSMA 4HZCA 4G87A 1TW1A 3CU0A 4NAIA 1ZI5A 3ZGFA 2JCLA 3DUVA 2VHEA 1QGQA 2FYAA 2AM4A 3R0SA 5C47A 1W57A 1S4NA 3OH4A 3U2UA 3I0CA 5DDTA 2XWNA 4B4GA 3PKQA 2A8UA 4M4KA 1OQMB 1FO9A 2WE9A 5BXCA 3VBJA 5E3RA 1ZJOA 3Q80A 1GQCA 1KK5A 5I1FA 3I0IX 2GGQA 4IHHA 5C4FA 1EYRA 4HUSA 4D11A 3TV0A 2X60A 3K8DA 4EA8A 3BCVA 4C2SA 5FYEA 2OEGA 1INJA 1K4VA 3R3IA 2RJ5A 2AH9A 2P2OA 1XHDA 1MP4A 4P02A 1V84A 2VS3A 4JD0A 3P47A 3CJ8A 4EAAA 1KK4A 2ICXA 4Y9XA 3MQHA 1O23B 3GUEA 1ZJ0A 1GX4A 2D0JA 2Z87A 3NGWA 5L6SA 1G23A 1FXJA 2YQHA 4NAKA 5EIYA 3SPTA 3TISA 3OUPA 2XMHA 3U2XA 4KQLA 1THJA 5DEMA 2Y6PA 3FWWA 4EQYA 2FY7A 1HM0A 4M2AA 3OKRA 5DDVA 3R1WA 1QQ0A 4B2WA 3TZTA 1KQAA 2P73A 4FCEA 4IHFA 3IOIA 2W0WA 3CKVA 1ZCYA 4ASYA 2I5EA 4N27A 1HJLA 2WLEA 1TZFA 2FYCB 1H7FA 2RJ6A 1WVCA 3I0HA 1QRMA 3OH2A 1SSQA 2O1GA 1KRVA 1FRWA 4EE4A 3V4EA 1VZXA 3I0DA 2V0KA 3KWEA 3PKPA 1H5RB 2YQCA 4M99A 1WT2A 3VBPA 4J18A 1GWVA 3V8YA 2RIZA 1I52A 2VXMA 3HSQA 4R37A 2OI6A 5C4DA 3OW5A 2RJ1A 2WEEA 4CJBA 3NZ2A 3FOQA 1R81A 2CU2A 2QIAA 4B3UA 2Y4MA 2XATA 3R8YA 3D5NA 2RIYA 3VBLA 1JV1A 4Y64A 2VD4A 4E75A
chains in the Genus database with same CATH superfamily
2E8BA 1VH1A 3N9WA 4CJ8A 5CMJA 5E3QA 3BSYA 4ISXA 3C8VA 1KRUA 3R3RA 2JCJA 4HO3A 4HG6A 2VS5A 3TDTA 1WT3A 3KIAA 4ZDQA 3HL3A 1QRFA 4D0TA 4GBPA 4ECMA 3ZGGA 2I5KA 1VZUA 1GA8A 1VPAA 3OH0A 3ZF8A 2PA4A 2YCMA 4R7PA 1HM8A 4Y6UA 2OEFA 5ADXU 1PZYB 2VS4A 5CQPA 3CKJA 2XWLA 1KGQA 5CQMX 1FXOA 3U0YA 4K6RA 4G3QA 2BO8A 4HO0A 1ZCUA 1NWGB 5C4BA 3I3AA 1TVYA 5L6VA 2FYDB 2QGIA 5AJPA 4FRDA 1LZJA 2DPWA 1G97A 2O1FA 3IXCA 3I0EA 3EH0A 2NXVA 4D48A 4FIXA 1PZTA 3I3XA 1EWWA 4FRLA 1LVWA 5IDTA 4B42A 4DDZA 4MFGA 3V0LA 5AJOA 3BFPA 3DHOA 4Y7UA 3VBKA 3R5BA 1O7OA 5FUHA 2RJ0A 1H4CA 1R7TA 1R82A 1FZWA 1QRGA 1H7TA 1ZI3A 4EA7A 3ZLKA 2IU9A 2RITA 3O3PA 4IRQA 4HO6A 1NKHB 3MQGA 1G8OA 4P00A 2GGOA 2AM3A 1ZDGA 3CKOA 3GQAA 4HO4A 2VSIA 3OC9A 4N6AA 4KNRA 5EJ1A 1ZI4A 3CGXA 1LL3A 1ZHJA 4FRMA 3SXGA 1MP3A 4B4MA 4MIXA 4M9CA 4L41C 3R5CA 1VH3A 1FWYA 4HZDA 3SUCA 1LZIA 2TDTA 1ZJ2A 3KWDA 4ARWA 3USRA 2IC7A 3I0JA 1MP5A 4DE7A 3U2VA 4CVHA 2Y4JA 1LL2A 3JUJA 3SXCA 4J09A 3ECTA 3RMWA 1MR7A 2WGZA 1KK6A 3FSBA 4KNXA 1XHBA 4FROA 5AFUU 3FSYA 1V82A 3JTJA 3FSXA 3U0XA 2XMEA 4IHGA 2V0LA 1OMXA 2ZU7A 4E6TA 2D7RA 4HO9A 4Y7FA 1QWJA 1XZ6A 5IFYA 3FSCA 1VICA 4XWIA 3OTZA 1VM8A 3JQYA 4AAWA 1S4PA 3FTTA 5DG3A 3SXDA 1TW5A 5FV9A 3OU9A 1WT1A 3JUKA 1ZJ3A 4E1KA 1W77A 3V91A 3SXEA 3T7OA 1R80A 3POLA 2XWMA 4HO2A 3OGZA 2FKOA 3FS8A 2X65A 4M2BA 1G2VA 4EA9A 1OCXA 4AC3A 3CKNA 4JISA 2AE7A 2Y4LA 5FTSA 4KC1A 1LZ0A 3MC4A 4KPXA 5U2KA 1QGSA 1NQIB 1GWWA 3SX5A 4EEMA 2E3DA 3V0MA 2V0HA 1E5KA 3I0GA 3D98A 1FGXA 1H7QA 5CQOA 1OMZA 2ZU9A 2PGVA 1VGTA 5FU0A 2WLGA 3Q1XA 4M28A 2FYBA 1QREA 1GQ9A 4EGGA 5JQQA 4M98A 1G1LA 1H7GA 3RMVA 3BXYA 1H5TB 5CMHA 3IGJA 1R7XA 3E25A 5C3AA 5IDSA 3U2TA 3SXBA 1LZ7A 2APCA 3DK5A 4MYOA 2Z86A 1H3MA 5CQNX 3EEVA 3TQDA 1EZIA 1H5SC 1FG5N 3EG4A 2RJ4A 5C1HA 3T7NA 1GX0A 1H7LA 4B4BA 3GQ9A 2J0AA 1FOAA 1T3DA 2QH5A 2O1HA 3R2WA 1JYKA 3IOHA 3GQ7A 3P1BA 4MZUA 1JVDA 2ZU8A 1ZI1A 2YQSA 3GQ8A 4Y7GA 1WT0A 5AJNA 1XATA 2D7IA 3PNNA 5C48A 1V67A 5AFUV 1S80A 4EABA 1LL0A 2AM5A 4E79A 4YS8A 2WLDA 4NALA 3D8VA 4AA7A 5CMFX 1SSTA 3V0PA 3VBIA 1R7UA 1H5SB 4HO5A 3E26A 2YC3A 3VNPA 1ZJPA 1MR9A 1KWSA 4MNDA 4B2XA 5C3DA 4N6BA 3V8ZA 1ZJ1A 5HS2A 3DJ4A 1NF5B 4FQWA 2WVLA 3T7MA 1H5RA 2JF3A 1ZIZA 2Y7AA 3SRTA 2WLFA 4LW3A 5CMIA 5C4EA 4R36A 3ZLLA 4FCUA 4D0ZA 4G3SA 1H5SD 2P72A 1H7EA 1ZDFA 1LXAA 1FGGA 4IRPA 3I0LA 2YESA 2IUAA 1IIMA 2VK9A 3TWDA 1G9RA 4KPZA 3SX8A 1ZCVA 2QKXA 1S4OA 2I7BA 2VXLA 4FRBA 4Y6NA 3OH1A 2NPOA 1SS9A 2RIXA 2VSHA 1O7QA 4NANA 1R7YA 5FTVA 2X5SA 3V0QA 1W55A 3Q7UA 5EJZA 3BSWA 1H5TA 3F1YA 4CJCA 5D91A 2UX8A 4EEAA 4HOCA 2BO4A 1NHEB 2P6WA 2JCOA 2FFVA 3V0OA 3R5DA 3R5AA 1VGZA 2YQJA 1H4EA 1HV9A 1G93A 2WVKA 3OAMA 1YP2A 3F1CA 1HM9A 5E3PA 2A8WA 3PMOA 5ADXV 1TDTA 4D11C 5C4CA 5C36A 4Y63A 3OH3A 4MYBA 2W0VA 4Q7CA 3SXAA 2ICYA 4FRQA 4LW6A 2VFZA 4Y7TA 1YP3A 5C38A 4KT7A 3K8EA 1HJJA 2AESA 3OTMA 1H4DA 1VZTA 2PX7A 3RSBA 4EVWA 2WLCA 3LW6A 4B5BA 3TIOA 4FRHA 4H7OA 5C1LA 1G95A 1N4IA 4EEGA 4EE3A 1FR8A 3VBNA 4N69A 1H5SA 2OI7A 3U2WA 3SX7A 2WVMA 4BMAA 4FRAA 2V0IA 4ASJA 1NMMB 4AYJA 1VGUA 1ZCTA 3GOSA 3ST8A 4DCLA 3USQA 1MRLA 4FRPA 3KWCA 1JV3A 4KC2A 1IINA 4KXOA 3V0NA 2MZBA 3I0FA 1FO8A 3T57A 2BO7A 1J2ZA 4Y7VA 5F42A 1O0RA 1ON8A 1INIA 4BQHA 2AECA 2OI5A 2AQ9A 1V83A 3F1XA 1KHRA 3IOJA 2BO6A 3GVDA 1G3LA 3QVBA 3V90A 1YP4A 4DECA 4KC4A 4EEOA 1FR9A 1JYLA 1R7VA 1VGWA 2WAWA 4HCQA 2JF2A 2RJ8A 5CMGX 5FU8A 2X5ZA 2IU8A 2PGYA 3BRKX 3TK8A 3CKQA 5CQLX 1ON6A 2V0JA 5D92A 1KRRA 4EE5A 1Z90A 1JVGA 1V3WA 2YC5A 3SX3A 1QG8A 2Y4KA 5C3BA 5C1GA 1H7HA 2AGDA 4HURA 3VBMA 4O6MA 1WSZA 3Q4SA 5C8RA 4O6NA 3BSSA 4HO8A 4UEGA 3EE5A 2Q4JA 1G0RA 1MC3A 4G3PA 3I0KA 2JCKA 4KRVA 1QRLA 1M8NA 2FFUA 5DEPA 2RJ7A 5J49A 2RIJA 1YROB 4Y62A 4E6UA 2RJ9A 1KGTA 5C49A 2QIVX 4AYLA 3HJJA 1Z2FA 4FREA 1SSMA 4HZCA 4G87A 1TW1A 3CU0A 4NAIA 1ZI5A 3ZGFA 2JCLA 3DUVA 2VHEA 1QGQA 2FYAA 2AM4A 3R0SA 5C47A 1W57A 3OH4A 1S4NA 3U2UA 3I0CA 5DDTA 2XWNA 4B4GA 3PKQA 2A8UA 4M4KA 1OQMB 1FO9A 2WE9A 5BXCA 3VBJA 5E3RA 1ZJOA 3Q80A 1GQCA 1KK5A 5I1FA 3I0IX 2GGQA 4IHHA 5C4FA 1EYRA 4HUSA 4D11A 3TV0A 2X60A 3K8DA 4EA8A 3BCVA 4C2SA 5FYEA 2OEGA 1INJA 1K4VA 3R3IA 2RJ5A 2AH9A 2P2OA 1XHDA 1MP4A 4P02A 1V84A 2VS3A 4JD0A 3P47A 3CJ8A 4EAAA 1KK4A 2ICXA 4Y9XA 3MQHA 1O23B 3GUEA 1ZJ0A 1GX4A 2D0JA 2Z87A 3NGWA 5L6SA 1G23A 1FXJA 2YQHA 4NAKA 5EIYA 3SPTA 3TISA 3OUPA 2XMHA 3U2XA 2J0BA 4KQLA 1THJA 5DEMA 2Y6PA 3FWWA 4EQYA 2FY7A 1HM0A 4M2AA 3OKRA 5DDVA 3R1WA 1QQ0A 4B2WA 3TZTA 1KQAA 1L0SA 4FCEA 2P73A 4IHFA 3IOIA 2W0WA 4FIYA 3CKVA 1ZCYA 2C0NA 2I5EA 4N27A 4ASYA 1HJLA 2WLEA 1TZFA 2FYCB 1H7FA 2RJ6A 1WVCA 3I0HA 1QRMA 3OH2A 1SSQA 2O1GA 1KRVA 1FRWA 4EE4A 3V4EA 1VZXA 3I0DA 2V0KA 3KWEA 3PKPA 1H5RB 2YQCA 4M99A 1WT2A 3VBPA 4J18A 1GWVA 3V8YA 2RIZA 1I52A 2VXMA 3HSQA 4R37A 2OI6A 5C4DA 3OW5A 2RJ1A 2WEEA 4CJBA 3NZ2A 3FOQA 1R81A 2CU2A 2QIAA 4B3UA 2Y4MA 2XATA 3R8YA 3D5NA 2RIYA 3VBLA 1JV1A 4Y64A 2VD4A 4E75A
chains in the Genus database with same CATH topology
2E8BA 1VH1A 3N9WA 4CJ8A 5CMJA 5E3QA 3BSYA 4ISXA 3C8VA 1KRUA 3R3RA 2JCJA 4HO3A 4HG6A 2VS5A 3TDTA 1WT3A 3KIAA 4ZDQA 3HL3A 1QRFA 4D0TA 4GBPA 4ECMA 3ZGGA 2I5KA 1VZUA 1GA8A 1VPAA 3OH0A 3ZF8A 2PA4A 2YCMA 4R7PA 1HM8A 4Y6UA 2OEFA 5ADXU 1PZYB 2VS4A 5CQPA 3CKJA 2XWLA 1KGQA 5CQMX 1FXOA 3U0YA 4K6RA 4G3QA 2BO8A 4HO0A 1ZCUA 1NWGB 5C4BA 3I3AA 1TVYA 5L6VA 2FYDB 2QGIA 5AJPA 4FRDA 1LZJA 2DPWA 1G97A 2O1FA 3IXCA 3I0EA 3EH0A 2NXVA 4D48A 4FIXA 1PZTA 3I3XA 4FRLA 1LVWA 5IDTA 4B42A 4DDZA 4MFGA 3V0LA 5AJOA 3BFPA 3DHOA 4Y7UA 3VBKA 3R5BA 1O7OA 5FUHA 2RJ0A 1H4CA 1R7TA 1R82A 1FZWA 1QRGA 1H7TA 1ZI3A 4EA7A 3ZLKA 2IU9A 2RITA 3O3PA 4IRQA 4HO6A 1NKHB 3MQGA 1G8OA 4P00A 2GGOA 2AM3A 1ZDGA 3CKOA 4HO4A 2VSIA 3OC9A 4N6AA 4KNRA 5EJ1A 1ZI4A 3CGXA 1LL3A 1ZHJA 4FRMA 3SXGA 1MP3A 4B4MA 4MIXA 4M9CA 4L41C 3R5CA 1VH3A 1FWYA 4HZDA 1LZIA 2TDTA 1ZJ2A 3KWDA 4ARWA 3USRA 2IC7A 3I0JA 1MP5A 4DE7A 3U2VA 4CVHA 2Y4JA 1LL2A 3JUJA 3SXCA 4J09A 3ECTA 3RMWA 1MR7A 2WGZA 1KK6A 3FSBA 4KNXA 1XHBA 4FROA 5AFUU 3FSYA 1V82A 3JTJA 3FSXA 3U0XA 2XMEA 4IHGA 2V0LA 1OMXA 2ZU7A 4E6TA 2D7RA 4HO9A 4Y7FA 1QWJA 1XZ6A 5IFYA 3FSCA 1VICA 4XWIA 3OTZA 1VM8A 3JQYA 4AAWA 1S4PA 3FTTA 5DG3A 3SXDA 1TW5A 5FV9A 3OU9A 1WT1A 3JUKA 1ZJ3A 4E1KA 1W77A 3V91A 3SXEA 3T7OA 1R80A 3POLA 2XWMA 4HO2A 3OGZA 2FKOA 3FS8A 2X65A 4M2BA 1G2VA 4EA9A 1OCXA 4AC3A 3CKNA 4JISA 2AE7A 2Y4LA 5FTSA 4KC1A 1LZ0A 3MC4A 4KPXA 5U2KA 1QGSA 1NQIB 1GWWA 3SX5A 4EEMA 2E3DA 3V0MA 2V0HA 1E5KA 3I0GA 3D98A 1FGXA 1H7QA 5CQOA 1OMZA 2ZU9A 2PGVA 1VGTA 5FU0A 2WLGA 3Q1XA 4M28A 2FYBA 1QREA 1GQ9A 4EGGA 5JQQA 4M98A 1G1LA 1H7GA 3RMVA 3BXYA 1H5TB 5CMHA 3IGJA 1R7XA 3E25A 5C3AA 5IDSA 3U2TA 3SXBA 1LZ7A 2APCA 3DK5A 4MYOA 2Z86A 1H3MA 5CQNX 3EEVA 3TQDA 1EZIA 1H5SC 1FG5N 3EG4A 2RJ4A 5C1HA 3T7NA 1GX0A 1H7LA 4B4BA 2J0AA 1FOAA 1T3DA 2QH5A 2O1HA 3R2WA 1JYKA 3IOHA 3P1BA 4MZUA 1JVDA 2ZU8A 1ZI1A 2YQSA 5AJNA 4Y7GA 1WT0A 1XATA 2D7IA 3PNNA 5C48A 1V67A 5AFUV 1S80A 4EABA 1LL0A 2AM5A 4E79A 4YS8A 2WLDA 4NALA 3D8VA 4AA7A 5CMFX 1SSTA 3V0PA 3VBIA 1R7UA 1H5SB 4HO5A 3E26A 2YC3A 3VNPA 1ZJPA 1MR9A 1KWSA 4MNDA 4B2XA 5C3DA 4N6BA 3V8ZA 1ZJ1A 5HS2A 3DJ4A 1NF5B 4FQWA 2WVLA 3T7MA 1H5RA 2JF3A 1ZIZA 2Y7AA 3SRTA 2WLFA 4LW3A 5CMIA 5C4EA 4R36A 3ZLLA 4FCUA 4D0ZA 4G3SA 1H5SD 2P72A 1H7EA 1ZDFA 1LXAA 1FGGA 4IRPA 3I0LA 2YESA 2IUAA 1IIMA 2VK9A 3TWDA 1G9RA 4KPZA 3SX8A 1ZCVA 2QKXA 1S4OA 2I7BA 2VXLA 4FRBA 4Y6NA 3OH1A 2NPOA 1SS9A 2RIXA 2VSHA 1O7QA 4NANA 1R7YA 5FTVA 2X5SA 3V0QA 1W55A 3Q7UA 5EJZA 3BSWA 1H5TA 3F1YA 4CJCA 5D91A 2UX8A 4EEAA 4HOCA 2BO4A 1NHEB 2P6WA 2JCOA 2FFVA 3V0OA 3R5DA 3R5AA 1VGZA 2YQJA 1H4EA 1HV9A 1G93A 2WVKA 3OAMA 1YP2A 3F1CA 1HM9A 5E3PA 2A8WA 3PMOA 5ADXV 1TDTA 4D11C 5C4CA 5C36A 4Y63A 3OH3A 4MYBA 2W0VA 4Q7CA 3SXAA 2ICYA 4FRQA 4LW6A 2VFZA 4Y7TA 1YP3A 5C38A 4KT7A 3K8EA 1HJJA 2AESA 3OTMA 1H4DA 1VZTA 2PX7A 3RSBA 4EVWA 2WLCA 3LW6A 4B5BA 3TIOA 4FRHA 4H7OA 5C1LA 1G95A 4EEGA 4EE3A 1FR8A 3VBNA 4N69A 1H5SA 2OI7A 3U2WA 3SX7A 2WVMA 4BMAA 4FRAA 2V0IA 4ASJA 1NMMB 4AYJA 1VGUA 1ZCTA 3GOSA 3ST8A 4DCLA 3USQA 1MRLA 4FRPA 3KWCA 1JV3A 4KC2A 1IINA 4KXOA 3V0NA 2MZBA 3I0FA 1FO8A 3T57A 2BO7A 1J2ZA 4Y7VA 5F42A 1O0RA 1ON8A 1INIA 4BQHA 2AECA 2OI5A 2AQ9A 1V83A 3F1XA 1KHRA 3IOJA 2BO6A 3GVDA 1G3LA 3QVBA 3V90A 1YP4A 4DECA 4KC4A 4EEOA 1FR9A 1JYLA 1R7VA 1VGWA 2WAWA 4HCQA 2JF2A 2RJ8A 5CMGX 5FU8A 2X5ZA 2IU8A 2PGYA 3BRKX 3TK8A 3CKQA 5CQLX 1ON6A 2V0JA 5D92A 1KRRA 4EE5A 1Z90A 1JVGA 1V3WA 2YC5A 3SX3A 1QG8A 2Y4KA 5C3BA 5C1GA 1H7HA 2AGDA 4HURA 3VBMA 4O6MA 1WSZA 3Q4SA 5C8RA 4O6NA 3BSSA 4HO8A 4UEGA 3EE5A 2Q4JA 1G0RA 1MC3A 4G3PA 3I0KA 2JCKA 4KRVA 1QRLA 5J49A 2FFUA 5DEPA 2RJ7A 2RIJA 1YROB 4Y62A 4E6UA 2RJ9A 1KGTA 5C49A 2QIVX 4AYLA 3HJJA 4FREA 1SSMA 4HZCA 4G87A 1TW1A 3CU0A 4NAIA 1ZI5A 3ZGFA 2JCLA 3DUVA 2VHEA 1QGQA 2FYAA 2AM4A 3R0SA 5C47A 1W57A 1S4NA 3OH4A 3U2UA 3I0CA 5DDTA 2XWNA 4B4GA 3PKQA 2A8UA 4M4KA 1OQMB 1FO9A 2WE9A 5BXCA 3VBJA 5E3RA 1ZJOA 3Q80A 1GQCA 1KK5A 5I1FA 3I0IX 2GGQA 4IHHA 5C4FA 1EYRA 4HUSA 4D11A 3TV0A 2X60A 3K8DA 4EA8A 3BCVA 4C2SA 5FYEA 2OEGA 1INJA 1K4VA 3R3IA 2RJ5A 2AH9A 2P2OA 1XHDA 1MP4A 4P02A 1V84A 2VS3A 4JD0A 3P47A 3CJ8A 4EAAA 1KK4A 2ICXA 4Y9XA 3MQHA 1O23B 3GUEA 1ZJ0A 1GX4A 2D0JA 2Z87A 3NGWA 5L6SA 1G23A 1FXJA 2YQHA 4NAKA 5EIYA 3SPTA 3TISA 3OUPA 2XMHA 3U2XA 2J0BA 4KQLA 1THJA 5DEMA 2Y6PA 3FWWA 4EQYA 2FY7A 1HM0A 4M2AA 3OKRA 5DDVA 3R1WA 1QQ0A 4B2WA 3TZTA 1KQAA 2P73A 4FCEA 4IHFA 3IOIA 2W0WA 4FIYA 3CKVA 1ZCYA 2C0NA 2I5EA 4N27A 4ASYA 1HJLA 2WLEA 1TZFA 2FYCB 1H7FA 2RJ6A 1WVCA 3I0HA 1QRMA 3OH2A 1SSQA 2O1GA 1KRVA 1FRWA 4EE4A 3V4EA 1VZXA 3I0DA 2V0KA 3KWEA 3PKPA 1H5RB 2YQCA 4M99A 1WT2A 3VBPA 4J18A 1GWVA 3V8YA 2RIZA 1I52A 2VXMA 3HSQA 4R37A 2OI6A 5C4DA 3OW5A 2RJ1A 2WEEA 4CJBA 3NZ2A 3FOQA 1R81A 2CU2A 2QIAA 4B3UA 2Y4MA 2XATA 3R8YA 3D5NA 2RIYA 3VBLA 1JV1A 4Y64A 2VD4A 4E75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8B A;  1VH1 A;  3N9W A;  4CJ8 A;  5CMJ A;  5E3Q A;  3BSY A;  4ISX A;  3C8V A;  1KRU A;  3R3R A;  2JCJ A;  4HO3 A;  4HG6 A;  2VS5 A;  3TDT A;  1WT3 A;  3KIA A;  4ZDQ A;  3HL3 A;  1QRF A;  4D0T A;  4GBP A;  4ECM A;  3ZGG A;  2I5K A;  1VZU A;  1GA8 A;  1VPA A;  3OH0 A;  3ZF8 A;  2PA4 A;  2YCM A;  4R7P A;  1HM8 A;  4Y6U A;  2OEF A;  5ADX U;  1PZY B;  2VS4 A;  5CQP A;  3CKJ A;  2XWL A;  1KGQ A;  5CQM X;  1FXO A;  3U0Y A;  4K6R A;  4G3Q A;  2BO8 A;  4HO0 A;  1ZCU A;  1NWG B;  5C4B A;  3I3A A;  1TVY A;  5L6V A;  2FYD B;  2QGI A;  5AJP A;  4FRD A;  1LZJ A;  2DPW A;  1G97 A;  2O1F A;  3IXC A;  3I0E A;  3EH0 A;  2NXV A;  4D48 A;  1PZT A;  3I3X A;  4FRL A;  1LVW A;  5IDT A;  4B42 A;  4DDZ A;  4MFG A;  3V0L A;  5AJO A;  3BFP A;  3DHO A;  4Y7U A;  3VBK A;  3R5B A;  1O7O A;  5FUH A;  2RJ0 A;  1H4C A;  1R7T A;  1R82 A;  1FZW A;  1QRG A;  1H7T A;  1ZI3 A;  4EA7 A;  3ZLK A;  2IU9 A;  2RIT A;  3O3P A;  4IRQ A;  4HO6 A;  1NKH B;  3MQG A;  1G8O A;  4P00 A;  2GGO A;  2AM3 A;  1ZDG A;  3CKO A;  4HO4 A;  2VSI A;  3OC9 A;  4N6A A;  4KNR A;  5EJ1 A;  1ZI4 A;  3CGX A;  1LL3 A;  1ZHJ A;  4FRM A;  3SXG A;  1MP3 A;  4B4M A;  4M9C A;  4L41 C;  3R5C A;  1VH3 A;  1FWY A;  4HZD A;  1LZI A;  2TDT A;  1ZJ2 A;  3KWD A;  4ARW A;  3USR A;  2IC7 A;  3I0J A;  1MP5 A;  4DE7 A;  3U2V A;  4CVH A;  2Y4J A;  1LL2 A;  3JUJ A;  3SXC A;  4J09 A;  3ECT A;  3RMW A;  1MR7 A;  2WGZ A;  1KK6 A;  3FSB A;  4KNX A;  1XHB A;  4FRO A;  5AFU U;  3FSY A;  1V82 A;  3JTJ A;  3FSX A;  3U0X A;  2XME A;  4IHG A;  2V0L A;  1OMX A;  2ZU7 A;  4E6T A;  2D7R A;  4HO9 A;  4Y7F A;  1QWJ A;  1XZ6 A;  5IFY A;  3FSC A;  1VIC A;  4XWI A;  3OTZ A;  1VM8 A;  3JQY A;  4AAW A;  1S4P A;  3FTT A;  5DG3 A;  3SXD A;  1TW5 A;  5FV9 A;  3OU9 A;  1WT1 A;  3JUK A;  1ZJ3 A;  4E1K A;  1W77 A;  3V91 A;  3SXE A;  3T7O A;  1R80 A;  3POL A;  2XWM A;  4HO2 A;  3OGZ A;  2FKO A;  3FS8 A;  2X65 A;  4M2B A;  1G2V A;  4EA9 A;  1OCX A;  4AC3 A;  3CKN A;  4JIS A;  2AE7 A;  2Y4L A;  5FTS A;  4KC1 A;  1LZ0 A;  3MC4 A;  4KPX A;  5U2K A;  1QGS A;  1NQI B;  1GWW A;  3SX5 A;  4EEM A;  2E3D A;  3V0M A;  2V0H A;  1E5K A;  3I0G A;  3D98 A;  1FGX A;  1H7Q A;  5CQO A;  1OMZ A;  2ZU9 A;  2PGV A;  1VGT A;  5FU0 A;  2WLG A;  3Q1X A;  4M28 A;  2FYB A;  1QRE A;  1GQ9 A;  4EGG A;  5JQQ A;  4M98 A;  1G1L A;  1H7G A;  3RMV A;  3BXY A;  1H5T B;  5CMH A;  3IGJ A;  1R7X A;  3E25 A;  5C3A A;  5IDS A;  3U2T A;  3SXB A;  1LZ7 A;  2APC A;  3DK5 A;  4MYO A;  2Z86 A;  1H3M A;  5CQN X;  3EEV A;  3TQD A;  1EZI A;  1H5S C;  1FG5 N;  3EG4 A;  2RJ4 A;  5C1H A;  3T7N A;  1GX0 A;  1H7L A;  4B4B A;  1FOA A;  1T3D A;  2QH5 A;  2O1H A;  3R2W A;  1JYK A;  3IOH A;  3P1B A;  4MZU A;  1JVD A;  2ZU8 A;  1ZI1 A;  2YQS A;  5AJN A;  4Y7G A;  1WT0 A;  1XAT A;  2D7I A;  3PNN A;  5C48 A;  1V67 A;  5AFU V;  1S80 A;  4EAB A;  1LL0 A;  2AM5 A;  4E79 A;  4YS8 A;  2WLD A;  4NAL A;  3D8V A;  4AA7 A;  5CMF X;  1SST A;  3V0P A;  3VBI A;  1R7U A;  1H5S B;  4HO5 A;  3E26 A;  2YC3 A;  3VNP A;  1ZJP A;  1MR9 A;  1KWS A;  4MND A;  4B2X A;  5C3D A;  4N6B A;  3V8Z A;  1ZJ1 A;  5HS2 A;  3DJ4 A;  1NF5 B;  4FQW A;  2WVL A;  3T7M A;  1H5R A;  2JF3 A;  1ZIZ A;  2Y7A A;  3SRT A;  2WLF A;  4LW3 A;  5CMI A;  5C4E A;  4R36 A;  3ZLL A;  4FCU A;  4D0Z A;  4G3S A;  1H5S D;  2P72 A;  1H7E A;  1ZDF A;  1LXA A;  1FGG A;  4IRP A;  3I0L A;  2YES A;  2IUA A;  1IIM A;  3TWD A;  1G9R A;  4KPZ A;  3SX8 A;  1ZCV A;  2QKX A;  1S4O A;  2I7B A;  2VXL A;  4FRB A;  4Y6N A;  3OH1 A;  2NPO A;  1SS9 A;  2RIX A;  2VSH A;  1O7Q A;  4NAN A;  1R7Y A;  5FTV A;  2X5S A;  3V0Q A;  1W55 A;  3Q7U A;  5EJZ A;  3BSW A;  1H5T A;  3F1Y A;  4CJC A;  2UX8 A;  4EEA A;  4HOC A;  2BO4 A;  1NHE B;  2P6W A;  2JCO A;  2FFV A;  3V0O A;  3R5D A;  3R5A A;  1VGZ A;  2YQJ A;  1H4E A;  1HV9 A;  1G93 A;  2WVK A;  3OAM A;  1YP2 A;  3F1C A;  1HM9 A;  5E3P A;  2A8W A;  3PMO A;  5ADX V;  1TDT A;  4D11 C;  5C4C A;  5C36 A;  4Y63 A;  3OH3 A;  4MYB A;  2W0V A;  3SXA A;  2ICY A;  4FRQ A;  4LW6 A;  2VFZ A;  4Y7T A;  1YP3 A;  5C38 A;  4KT7 A;  3K8E A;  1HJJ A;  2AES A;  3OTM A;  1H4D A;  1VZT A;  2PX7 A;  3RSB A;  4EVW A;  2WLC A;  3LW6 A;  4B5B A;  3TIO A;  4FRH A;  4H7O A;  5C1L A;  1G95 A;  4EEG A;  4EE3 A;  1FR8 A;  3VBN A;  4N69 A;  1H5S A;  2OI7 A;  3U2W A;  3SX7 A;  2WVM A;  4BMA A;  4FRA A;  2V0I A;  4ASJ A;  1NMM B;  4AYJ A;  1VGU A;  1ZCT A;  3GOS A;  3ST8 A;  4DCL A;  3USQ A;  1MRL A;  4FRP A;  3KWC A;  1JV3 A;  4KC2 A;  1IIN A;  4KXO A;  3V0N A;  2MZB A;  3I0F A;  1FO8 A;  3T57 A;  2BO7 A;  1J2Z A;  4Y7V A;  5F42 A;  1O0R A;  1ON8 A;  1INI A;  4BQH A;  2AEC A;  2OI5 A;  2AQ9 A;  1V83 A;  3F1X A;  1KHR A;  3IOJ A;  2BO6 A;  3GVD A;  1G3L A;  3QVB A;  3V90 A;  1YP4 A;  4DEC A;  4KC4 A;  4EEO A;  1FR9 A;  1JYL A;  1R7V A;  1VGW A;  2WAW A;  4HCQ A;  2JF2 A;  2RJ8 A;  5CMG X;  5FU8 A;  2X5Z A;  2IU8 A;  2PGY A;  3BRK X;  3TK8 A;  3CKQ A;  5CQL X;  1ON6 A;  2V0J A;  1KRR A;  4EE5 A;  1Z90 A;  1JVG A;  1V3W A;  2YC5 A;  3SX3 A;  1QG8 A;  2Y4K A;  5C3B A;  5C1G A;  1H7H A;  2AGD A;  4HUR A;  3VBM A;  1WSZ A;  3Q4S A;  5C8R A;  3BSS A;  4HO8 A;  4UEG A;  3EE5 A;  2Q4J A;  1G0R A;  1MC3 A;  4G3P A;  3I0K A;  2JCK A;  4KRV A;  1QRL A;  5J49 A;  2FFU A;  5DEP A;  2RJ7 A;  2RIJ A;  1YRO B;  4Y62 A;  4E6U A;  2RJ9 A;  1KGT A;  5C49 A;  2QIV X;  4AYL A;  3HJJ A;  4FRE A;  1SSM A;  4HZC A;  4G87 A;  1TW1 A;  3CU0 A;  4NAI A;  1ZI5 A;  3ZGF A;  2JCL A;  3DUV A;  2VHE A;  1QGQ A;  2FYA A;  2AM4 A;  3R0S A;  5C47 A;  1W57 A;  1S4N A;  3OH4 A;  3U2U A;  3I0C A;  5DDT A;  2XWN A;  4B4G A;  3PKQ A;  2A8U A;  4M4K A;  1OQM B;  1FO9 A;  2WE9 A;  5BXC A;  3VBJ A;  5E3R A;  1ZJO A;  3Q80 A;  1GQC A;  1KK5 A;  5I1F A;  3I0I X;  2GGQ A;  4IHH A;  5C4F A;  1EYR A;  4HUS A;  4D11 A;  3TV0 A;  2X60 A;  3K8D A;  4EA8 A;  3BCV A;  4C2S A;  5FYE A;  2OEG A;  1INJ A;  1K4V A;  3R3I A;  2RJ5 A;  2AH9 A;  2P2O A;  1XHD A;  1MP4 A;  4P02 A;  1V84 A;  2VS3 A;  4JD0 A;  3P47 A;  3CJ8 A;  4EAA A;  1KK4 A;  2ICX A;  4Y9X A;  3MQH A;  1O23 B;  3GUE A;  1ZJ0 A;  1GX4 A;  2D0J A;  2Z87 A;  3NGW A;  5L6S A;  1G23 A;  1FXJ A;  2YQH A;  4NAK A;  5EIY A;  3SPT A;  3TIS A;  3OUP A;  2XMH A;  3U2X A;  4KQL A;  1THJ A;  5DEM A;  2Y6P A;  3FWW A;  4EQY A;  2FY7 A;  1HM0 A;  4M2A A;  3OKR A;  5DDV A;  3R1W A;  1QQ0 A;  4B2W A;  3TZT A;  1KQA A;  2P73 A;  4FCE A;  4IHF A;  3IOI A;  2W0W A;  3CKV A;  1ZCY A;  4ASY A;  2I5E A;  4N27 A;  1HJL A;  2WLE A;  1TZF A;  2FYC B;  1H7F A;  2RJ6 A;  1WVC A;  3I0H A;  1QRM A;  3OH2 A;  1SSQ A;  2O1G A;  1KRV A;  1FRW A;  4EE4 A;  3V4E A;  1VZX A;  3I0D A;  2V0K A;  3KWE A;  3PKP A;  1H5R B;  2YQC A;  4M99 A;  1WT2 A;  3VBP A;  4J18 A;  1GWV A;  3V8Y A;  2RIZ A;  1I52 A;  2VXM A;  3HSQ A;  4R37 A;  2OI6 A;  5C4D A;  3OW5 A;  2RJ1 A;  2WEE A;  4CJB A;  3NZ2 A;  3FOQ A;  1R81 A;  2CU2 A;  2QIA A;  4B3U A;  2Y4M A;  2XAT A;  3R8Y A;  3D5N A;  2RIY A;  3VBL A;  1JV1 A;  4Y64 A;  2VD4 A;  4E75 A; 
#chains in the Genus database with same CATH topology
 2E8B A;  1VH1 A;  3N9W A;  4CJ8 A;  5CMJ A;  5E3Q A;  3BSY A;  4ISX A;  3C8V A;  1KRU A;  3R3R A;  2JCJ A;  4HO3 A;  4HG6 A;  2VS5 A;  3TDT A;  1WT3 A;  3KIA A;  4ZDQ A;  3HL3 A;  1QRF A;  4D0T A;  4GBP A;  4ECM A;  3ZGG A;  2I5K A;  1VZU A;  1GA8 A;  1VPA A;  3OH0 A;  3ZF8 A;  2PA4 A;  2YCM A;  4R7P A;  1HM8 A;  4Y6U A;  2OEF A;  5ADX U;  1PZY B;  2VS4 A;  5CQP A;  3CKJ A;  2XWL A;  1KGQ A;  5CQM X;  1FXO A;  3U0Y A;  4K6R A;  4G3Q A;  2BO8 A;  4HO0 A;  1ZCU A;  1NWG B;  5C4B A;  3I3A A;  1TVY A;  5L6V A;  2FYD B;  2QGI A;  5AJP A;  4FRD A;  1LZJ A;  2DPW A;  1G97 A;  2O1F A;  3IXC A;  3I0E A;  3EH0 A;  2NXV A;  4D48 A;  4FIX A;  1PZT A;  3I3X A;  1EWW A;  4FRL A;  1LVW A;  5IDT A;  4B42 A;  4DDZ A;  4MFG A;  3V0L A;  5AJO A;  3BFP A;  3DHO A;  4Y7U A;  3VBK A;  3R5B A;  1O7O A;  5FUH A;  2RJ0 A;  1H4C A;  1R7T A;  1R82 A;  1FZW A;  1QRG A;  1H7T A;  1ZI3 A;  4EA7 A;  3ZLK A;  2IU9 A;  2RIT A;  3O3P A;  4IRQ A;  4HO6 A;  1NKH B;  3MQG A;  1G8O A;  4P00 A;  2GGO A;  2AM3 A;  1ZDG A;  3CKO A;  3GQA A;  4HO4 A;  2VSI A;  3OC9 A;  4N6A A;  4KNR A;  5EJ1 A;  1ZI4 A;  3CGX A;  1LL3 A;  1ZHJ A;  4FRM A;  3SXG A;  1MP3 A;  4B4M A;  4MIX A;  4M9C A;  4L41 C;  3R5C A;  1VH3 A;  1FWY A;  4HZD A;  3SUC A;  1LZI A;  2TDT A;  1ZJ2 A;  3KWD A;  4ARW A;  3USR A;  2IC7 A;  3I0J A;  1MP5 A;  4DE7 A;  3U2V A;  4CVH A;  2Y4J A;  1LL2 A;  3JUJ A;  3SXC A;  4J09 A;  3ECT A;  3RMW A;  1MR7 A;  2WGZ A;  1KK6 A;  3FSB A;  4KNX A;  1XHB A;  4FRO A;  5AFU U;  3FSY A;  1V82 A;  3JTJ A;  3FSX A;  3U0X A;  2XME A;  4IHG A;  2V0L A;  1OMX A;  2ZU7 A;  4E6T A;  2D7R A;  4HO9 A;  4Y7F A;  1QWJ A;  1XZ6 A;  5IFY A;  3FSC A;  1VIC A;  4XWI A;  3OTZ A;  1VM8 A;  3JQY A;  4AAW A;  1S4P A;  3FTT A;  5DG3 A;  3SXD A;  1TW5 A;  5FV9 A;  3OU9 A;  1WT1 A;  3JUK A;  1ZJ3 A;  4E1K A;  1W77 A;  3V91 A;  3SXE A;  3T7O A;  1R80 A;  3POL A;  2XWM A;  4HO2 A;  3OGZ A;  2FKO A;  3FS8 A;  2X65 A;  4M2B A;  1G2V A;  4EA9 A;  1OCX A;  4AC3 A;  3CKN A;  4JIS A;  2AE7 A;  2Y4L A;  5FTS A;  4KC1 A;  1LZ0 A;  3MC4 A;  4KPX A;  5U2K A;  1QGS A;  1NQI B;  1GWW A;  3SX5 A;  4EEM A;  2E3D A;  3V0M A;  2V0H A;  1E5K A;  3I0G A;  3D98 A;  1FGX A;  1H7Q A;  5CQO A;  1OMZ A;  2ZU9 A;  2PGV A;  1VGT A;  5FU0 A;  2WLG A;  3Q1X A;  4M28 A;  2FYB A;  1QRE A;  1GQ9 A;  4EGG A;  5JQQ A;  4M98 A;  1G1L A;  1H7G A;  3RMV A;  3BXY A;  1H5T B;  5CMH A;  3IGJ A;  1R7X A;  3E25 A;  5C3A A;  5IDS A;  3U2T A;  3SXB A;  1LZ7 A;  2APC A;  3DK5 A;  4MYO A;  2Z86 A;  1H3M A;  5CQN X;  3EEV A;  3TQD A;  1EZI A;  1H5S C;  1FG5 N;  3EG4 A;  2RJ4 A;  5C1H A;  3T7N A;  1GX0 A;  1H7L A;  4B4B A;  3GQ9 A;  2J0A A;  1FOA A;  1T3D A;  2QH5 A;  2O1H A;  3R2W A;  1JYK A;  3IOH A;  3GQ7 A;  3P1B A;  4MZU A;  1JVD A;  2ZU8 A;  1ZI1 A;  2YQS A;  3GQ8 A;  4Y7G A;  1WT0 A;  5AJN A;  1XAT A;  2D7I A;  3PNN A;  5C48 A;  1V67 A;  5AFU V;  1S80 A;  4EAB A;  1LL0 A;  2AM5 A;  4E79 A;  4YS8 A;  2WLD A;  4NAL A;  3D8V A;  4AA7 A;  5CMF X;  1SST A;  3V0P A;  3VBI A;  1R7U A;  1H5S B;  4HO5 A;  3E26 A;  2YC3 A;  3VNP A;  1ZJP A;  1MR9 A;  1KWS A;  4MND A;  4B2X A;  5C3D A;  4N6B A;  3V8Z A;  1ZJ1 A;  5HS2 A;  3DJ4 A;  1NF5 B;  4FQW A;  2WVL A;  3T7M A;  1H5R A;  2JF3 A;  1ZIZ A;  2Y7A A;  3SRT A;  2WLF A;  4LW3 A;  5CMI A;  5C4E A;  4R36 A;  3ZLL A;  4FCU A;  4D0Z A;  4G3S A;  1H5S D;  2P72 A;  1H7E A;  1ZDF A;  1LXA A;  1FGG A;  4IRP A;  3I0L A;  2YES A;  2IUA A;  1IIM A;  2VK9 A;  3TWD A;  1G9R A;  4KPZ A;  3SX8 A;  1ZCV A;  2QKX A;  1S4O A;  2I7B A;  2VXL A;  4FRB A;  4Y6N A;  3OH1 A;  2NPO A;  1SS9 A;  2RIX A;  2VSH A;  1O7Q A;  4NAN A;  1R7Y A;  5FTV A;  2X5S A;  3V0Q A;  1W55 A;  3Q7U A;  5EJZ A;  3BSW A;  1H5T A;  3F1Y A;  4CJC A;  5D91 A;  2UX8 A;  4EEA A;  4HOC A;  2BO4 A;  1NHE B;  2P6W A;  2JCO A;  2FFV A;  3V0O A;  3R5D A;  3R5A A;  1VGZ A;  2YQJ A;  1H4E A;  1HV9 A;  1G93 A;  2WVK A;  3OAM A;  1YP2 A;  3F1C A;  1HM9 A;  5E3P A;  2A8W A;  3PMO A;  5ADX V;  1TDT A;  4D11 C;  5C4C A;  5C36 A;  4Y63 A;  3OH3 A;  4MYB A;  2W0V A;  4Q7C A;  3SXA A;  2ICY A;  4FRQ A;  4LW6 A;  2VFZ A;  4Y7T A;  1YP3 A;  5C38 A;  4KT7 A;  3K8E A;  1HJJ A;  2AES A;  3OTM A;  1H4D A;  1VZT A;  2PX7 A;  3RSB A;  4EVW A;  2WLC A;  3LW6 A;  4B5B A;  3TIO A;  4FRH A;  4H7O A;  5C1L A;  1G95 A;  1N4I A;  4EEG A;  4EE3 A;  1FR8 A;  3VBN A;  4N69 A;  1H5S A;  2OI7 A;  3U2W A;  3SX7 A;  2WVM A;  4BMA A;  4FRA A;  2V0I A;  4ASJ A;  1NMM B;  4AYJ A;  1VGU A;  1ZCT A;  3GOS A;  3ST8 A;  4DCL A;  3USQ A;  1MRL A;  4FRP A;  3KWC A;  1JV3 A;  4KC2 A;  1IIN A;  4KXO A;  3V0N A;  2MZB A;  3I0F A;  1FO8 A;  3T57 A;  2BO7 A;  1J2Z A;  4Y7V A;  5F42 A;  1O0R A;  1ON8 A;  1INI A;  4BQH A;  2AEC A;  2OI5 A;  2AQ9 A;  1V83 A;  3F1X A;  1KHR A;  3IOJ A;  2BO6 A;  3GVD A;  1G3L A;  3QVB A;  3V90 A;  1YP4 A;  4DEC A;  4KC4 A;  4EEO A;  1FR9 A;  1JYL A;  1R7V A;  1VGW A;  2WAW A;  4HCQ A;  2JF2 A;  2RJ8 A;  5CMG X;  5FU8 A;  2X5Z A;  2IU8 A;  2PGY A;  3BRK X;  3TK8 A;  3CKQ A;  5CQL X;  1ON6 A;  2V0J A;  5D92 A;  1KRR A;  4EE5 A;  1Z90 A;  1JVG A;  1V3W A;  2YC5 A;  3SX3 A;  1QG8 A;  2Y4K A;  5C3B A;  5C1G A;  1H7H A;  2AGD A;  4HUR A;  3VBM A;  4O6M A;  1WSZ A;  3Q4S A;  5C8R A;  4O6N A;  3BSS A;  4HO8 A;  4UEG A;  3EE5 A;  2Q4J A;  1G0R A;  1MC3 A;  4G3P A;  3I0K A;  2JCK A;  4KRV A;  1QRL A;  1M8N A;  2FFU A;  5DEP A;  2RJ7 A;  5J49 A;  2RIJ A;  1YRO B;  4Y62 A;  4E6U A;  2RJ9 A;  1KGT A;  5C49 A;  2QIV X;  4AYL A;  3HJJ A;  1Z2F A;  4FRE A;  1SSM A;  4HZC A;  4G87 A;  1TW1 A;  3CU0 A;  4NAI A;  1ZI5 A;  3ZGF A;  2JCL A;  3DUV A;  2VHE A;  1QGQ A;  2FYA A;  2AM4 A;  3R0S A;  5C47 A;  1W57 A;  3OH4 A;  1S4N A;  3U2U A;  3I0C A;  5DDT A;  2XWN A;  4B4G A;  3PKQ A;  2A8U A;  4M4K A;  1OQM B;  1FO9 A;  2WE9 A;  5BXC A;  3VBJ A;  5E3R A;  1ZJO A;  3Q80 A;  1GQC A;  1KK5 A;  5I1F A;  3I0I X;  2GGQ A;  4IHH A;  5C4F A;  1EYR A;  4HUS A;  4D11 A;  3TV0 A;  2X60 A;  3K8D A;  4EA8 A;  3BCV A;  4C2S A;  5FYE A;  2OEG A;  1INJ A;  1K4V A;  3R3I A;  2RJ5 A;  2AH9 A;  2P2O A;  1XHD A;  1MP4 A;  4P02 A;  1V84 A;  2VS3 A;  4JD0 A;  3P47 A;  3CJ8 A;  4EAA A;  1KK4 A;  2ICX A;  4Y9X A;  3MQH A;  1O23 B;  3GUE A;  1ZJ0 A;  1GX4 A;  2D0J A;  2Z87 A;  3NGW A;  5L6S A;  1G23 A;  1FXJ A;  2YQH A;  4NAK A;  5EIY A;  3SPT A;  3TIS A;  3OUP A;  2XMH A;  3U2X A;  2J0B A;  4KQL A;  1THJ A;  5DEM A;  2Y6P A;  3FWW A;  4EQY A;  2FY7 A;  1HM0 A;  4M2A A;  3OKR A;  5DDV A;  3R1W A;  1QQ0 A;  4B2W A;  3TZT A;  1KQA A;  1L0S A;  4FCE A;  2P73 A;  4IHF A;  3IOI A;  2W0W A;  4FIY A;  3CKV A;  1ZCY A;  2C0N A;  2I5E A;  4N27 A;  4ASY A;  1HJL A;  2WLE A;  1TZF A;  2FYC B;  1H7F A;  2RJ6 A;  1WVC A;  3I0H A;  1QRM A;  3OH2 A;  1SSQ A;  2O1G A;  1KRV A;  1FRW A;  4EE4 A;  3V4E A;  1VZX A;  3I0D A;  2V0K A;  3KWE A;  3PKP A;  1H5R B;  2YQC A;  4M99 A;  1WT2 A;  3VBP A;  4J18 A;  1GWV A;  3V8Y A;  2RIZ A;  1I52 A;  2VXM A;  3HSQ A;  4R37 A;  2OI6 A;  5C4D A;  3OW5 A;  2RJ1 A;  2WEE A;  4CJB A;  3NZ2 A;  3FOQ A;  1R81 A;  2CU2 A;  2QIA A;  4B3U A;  2Y4M A;  2XAT A;  3R8Y A;  3D5N A;  2RIY A;  3VBL A;  1JV1 A;  4Y64 A;  2VD4 A;  4E75 A; 
#chains in the Genus database with same CATH homology
 2E8B A;  1VH1 A;  3N9W A;  4CJ8 A;  5CMJ A;  5E3Q A;  3BSY A;  4ISX A;  3C8V A;  1KRU A;  3R3R A;  2JCJ A;  4HO3 A;  4HG6 A;  2VS5 A;  3TDT A;  1WT3 A;  3KIA A;  4ZDQ A;  3HL3 A;  1QRF A;  4D0T A;  4GBP A;  4ECM A;  3ZGG A;  2I5K A;  1VZU A;  1GA8 A;  1VPA A;  3OH0 A;  3ZF8 A;  2PA4 A;  2YCM A;  4R7P A;  1HM8 A;  4Y6U A;  2OEF A;  5ADX U;  1PZY B;  2VS4 A;  5CQP A;  3CKJ A;  2XWL A;  1KGQ A;  5CQM X;  1FXO A;  3U0Y A;  4K6R A;  4G3Q A;  2BO8 A;  4HO0 A;  1ZCU A;  1NWG B;  5C4B A;  3I3A A;  1TVY A;  5L6V A;  2FYD B;  2QGI A;  5AJP A;  4FRD A;  1LZJ A;  2DPW A;  1G97 A;  2O1F A;  3IXC A;  3I0E A;  3EH0 A;  2NXV A;  4D48 A;  4FIX A;  1PZT A;  3I3X A;  4FRL A;  1LVW A;  5IDT A;  4B42 A;  4DDZ A;  4MFG A;  3V0L A;  5AJO A;  3BFP A;  3DHO A;  4Y7U A;  3VBK A;  3R5B A;  1O7O A;  5FUH A;  2RJ0 A;  1H4C A;  1R7T A;  1R82 A;  1FZW A;  1QRG A;  1H7T A;  1ZI3 A;  4EA7 A;  3ZLK A;  2IU9 A;  2RIT A;  3O3P A;  4IRQ A;  4HO6 A;  1NKH B;  3MQG A;  1G8O A;  4P00 A;  2GGO A;  2AM3 A;  1ZDG A;  3CKO A;  4HO4 A;  2VSI A;  3OC9 A;  4N6A A;  4KNR A;  5EJ1 A;  1ZI4 A;  3CGX A;  1LL3 A;  1ZHJ A;  4FRM A;  3SXG A;  1MP3 A;  4B4M A;  4MIX A;  4M9C A;  4L41 C;  3R5C A;  1VH3 A;  1FWY A;  4HZD A;  1LZI A;  2TDT A;  1ZJ2 A;  3KWD A;  4ARW A;  3USR A;  2IC7 A;  3I0J A;  1MP5 A;  4DE7 A;  3U2V A;  4CVH A;  2Y4J A;  1LL2 A;  3JUJ A;  3SXC A;  4J09 A;  3ECT A;  3RMW A;  1MR7 A;  2WGZ A;  1KK6 A;  3FSB A;  4KNX A;  1XHB A;  4FRO A;  5AFU U;  3FSY A;  1V82 A;  3JTJ A;  3FSX A;  3U0X A;  2XME A;  4IHG A;  2V0L A;  1OMX A;  2ZU7 A;  4E6T A;  2D7R A;  4HO9 A;  4Y7F A;  1QWJ A;  1XZ6 A;  5IFY A;  3FSC A;  1VIC A;  4XWI A;  3OTZ A;  1VM8 A;  3JQY A;  4AAW A;  1S4P A;  3FTT A;  5DG3 A;  3SXD A;  1TW5 A;  5FV9 A;  3OU9 A;  1WT1 A;  3JUK A;  1ZJ3 A;  4E1K A;  1W77 A;  3V91 A;  3SXE A;  3T7O A;  1R80 A;  3POL A;  2XWM A;  4HO2 A;  3OGZ A;  2FKO A;  3FS8 A;  2X65 A;  4M2B A;  1G2V A;  4EA9 A;  1OCX A;  4AC3 A;  3CKN A;  4JIS A;  2AE7 A;  2Y4L A;  5FTS A;  4KC1 A;  1LZ0 A;  3MC4 A;  4KPX A;  5U2K A;  1QGS A;  1NQI B;  1GWW A;  3SX5 A;  4EEM A;  2E3D A;  3V0M A;  2V0H A;  1E5K A;  3I0G A;  3D98 A;  1FGX A;  1H7Q A;  5CQO A;  1OMZ A;  2ZU9 A;  2PGV A;  1VGT A;  5FU0 A;  2WLG A;  3Q1X A;  4M28 A;  2FYB A;  1QRE A;  1GQ9 A;  4EGG A;  5JQQ A;  4M98 A;  1G1L A;  1H7G A;  3RMV A;  3BXY A;  1H5T B;  5CMH A;  3IGJ A;  1R7X A;  3E25 A;  5C3A A;  5IDS A;  3U2T A;  3SXB A;  1LZ7 A;  2APC A;  3DK5 A;  4MYO A;  2Z86 A;  1H3M A;  5CQN X;  3EEV A;  3TQD A;  1EZI A;  1H5S C;  1FG5 N;  3EG4 A;  2RJ4 A;  5C1H A;  3T7N A;  1GX0 A;  1H7L A;  4B4B A;  2J0A A;  1FOA A;  1T3D A;  2QH5 A;  2O1H A;  3R2W A;  1JYK A;  3IOH A;  3P1B A;  4MZU A;  1JVD A;  2ZU8 A;  1ZI1 A;  2YQS A;  5AJN A;  4Y7G A;  1WT0 A;  1XAT A;  2D7I A;  3PNN A;  5C48 A;  1V67 A;  5AFU V;  1S80 A;  4EAB A;  1LL0 A;  2AM5 A;  4E79 A;  4YS8 A;  2WLD A;  4NAL A;  3D8V A;  4AA7 A;  5CMF X;  1SST A;  3V0P A;  3VBI A;  1R7U A;  1H5S B;  4HO5 A;  3E26 A;  2YC3 A;  3VNP A;  1ZJP A;  1MR9 A;  1KWS A;  4MND A;  4B2X A;  5C3D A;  4N6B A;  3V8Z A;  1ZJ1 A;  5HS2 A;  3DJ4 A;  1NF5 B;  4FQW A;  2WVL A;  3T7M A;  1H5R A;  2JF3 A;  1ZIZ A;  2Y7A A;  3SRT A;  2WLF A;  4LW3 A;  5CMI A;  5C4E A;  4R36 A;  3ZLL A;  4FCU A;  4D0Z A;  4G3S A;  1H5S D;  2P72 A;  1H7E A;  1ZDF A;  1LXA A;  1FGG A;  4IRP A;  3I0L A;  2YES A;  2IUA A;  1IIM A;  2VK9 A;  3TWD A;  1G9R A;  4KPZ A;  3SX8 A;  1ZCV A;  2QKX A;  1S4O A;  2I7B A;  2VXL A;  4FRB A;  4Y6N A;  3OH1 A;  2NPO A;  1SS9 A;  2RIX A;  2VSH A;  1O7Q A;  4NAN A;  1R7Y A;  5FTV A;  2X5S A;  3V0Q A;  1W55 A;  3Q7U A;  5EJZ A;  3BSW A;  1H5T A;  3F1Y A;  4CJC A;  5D91 A;  2UX8 A;  4EEA A;  4HOC A;  2BO4 A;  1NHE B;  2P6W A;  2JCO A;  2FFV A;  3V0O A;  3R5D A;  3R5A A;  1VGZ A;  2YQJ A;  1H4E A;  1HV9 A;  1G93 A;  2WVK A;  3OAM A;  1YP2 A;  3F1C A;  1HM9 A;  5E3P A;  2A8W A;  3PMO A;  5ADX V;  1TDT A;  4D11 C;  5C4C A;  5C36 A;  4Y63 A;  3OH3 A;  4MYB A;  2W0V A;  4Q7C A;  3SXA A;  2ICY A;  4FRQ A;  4LW6 A;  2VFZ A;  4Y7T A;  1YP3 A;  5C38 A;  4KT7 A;  3K8E A;  1HJJ A;  2AES A;  3OTM A;  1H4D A;  1VZT A;  2PX7 A;  3RSB A;  4EVW A;  2WLC A;  3LW6 A;  4B5B A;  3TIO A;  4FRH A;  4H7O A;  5C1L A;  1G95 A;  4EEG A;  4EE3 A;  1FR8 A;  3VBN A;  4N69 A;  1H5S A;  2OI7 A;  3U2W A;  3SX7 A;  2WVM A;  4BMA A;  4FRA A;  2V0I A;  4ASJ A;  1NMM B;  4AYJ A;  1VGU A;  1ZCT A;  3GOS A;  3ST8 A;  4DCL A;  3USQ A;  1MRL A;  4FRP A;  3KWC A;  1JV3 A;  4KC2 A;  1IIN A;  4KXO A;  3V0N A;  2MZB A;  3I0F A;  1FO8 A;  3T57 A;  2BO7 A;  1J2Z A;  4Y7V A;  5F42 A;  1O0R A;  1ON8 A;  1INI A;  4BQH A;  2AEC A;  2OI5 A;  2AQ9 A;  1V83 A;  3F1X A;  1KHR A;  3IOJ A;  2BO6 A;  3GVD A;  1G3L A;  3QVB A;  3V90 A;  1YP4 A;  4DEC A;  4KC4 A;  4EEO A;  1FR9 A;  1JYL A;  1R7V A;  1VGW A;  2WAW A;  4HCQ A;  2JF2 A;  2RJ8 A;  5CMG X;  5FU8 A;  2X5Z A;  2IU8 A;  2PGY A;  3BRK X;  3TK8 A;  3CKQ A;  5CQL X;  1ON6 A;  2V0J A;  5D92 A;  1KRR A;  4EE5 A;  1Z90 A;  1JVG A;  1V3W A;  2YC5 A;  3SX3 A;  1QG8 A;  2Y4K A;  5C3B A;  5C1G A;  1H7H A;  2AGD A;  4HUR A;  3VBM A;  4O6M A;  1WSZ A;  3Q4S A;  5C8R A;  4O6N A;  3BSS A;  4HO8 A;  4UEG A;  3EE5 A;  2Q4J A;  1G0R A;  1MC3 A;  4G3P A;  3I0K A;  2JCK A;  4KRV A;  1QRL A;  5J49 A;  2FFU A;  5DEP A;  2RJ7 A;  2RIJ A;  1YRO B;  4Y62 A;  4E6U A;  2RJ9 A;  1KGT A;  5C49 A;  2QIV X;  4AYL A;  3HJJ A;  4FRE A;  1SSM A;  4HZC A;  4G87 A;  1TW1 A;  3CU0 A;  4NAI A;  1ZI5 A;  3ZGF A;  2JCL A;  3DUV A;  2VHE A;  1QGQ A;  2FYA A;  2AM4 A;  3R0S A;  5C47 A;  1W57 A;  1S4N A;  3OH4 A;  3U2U A;  3I0C A;  5DDT A;  2XWN A;  4B4G A;  3PKQ A;  2A8U A;  4M4K A;  1OQM B;  1FO9 A;  2WE9 A;  5BXC A;  3VBJ A;  5E3R A;  1ZJO A;  3Q80 A;  1GQC A;  1KK5 A;  5I1F A;  3I0I X;  2GGQ A;  4IHH A;  5C4F A;  1EYR A;  4HUS A;  4D11 A;  3TV0 A;  2X60 A;  3K8D A;  4EA8 A;  3BCV A;  4C2S A;  5FYE A;  2OEG A;  1INJ A;  1K4V A;  3R3I A;  2RJ5 A;  2AH9 A;  2P2O A;  1XHD A;  1MP4 A;  4P02 A;  1V84 A;  2VS3 A;  4JD0 A;  3P47 A;  3CJ8 A;  4EAA A;  1KK4 A;  2ICX A;  4Y9X A;  3MQH A;  1O23 B;  3GUE A;  1ZJ0 A;  1GX4 A;  2D0J A;  2Z87 A;  3NGW A;  5L6S A;  1G23 A;  1FXJ A;  2YQH A;  4NAK A;  5EIY A;  3SPT A;  3TIS A;  3OUP A;  2XMH A;  3U2X A;  2J0B A;  4KQL A;  1THJ A;  5DEM A;  2Y6P A;  3FWW A;  4EQY A;  2FY7 A;  1HM0 A;  4M2A A;  3OKR A;  5DDV A;  3R1W A;  1QQ0 A;  4B2W A;  3TZT A;  1KQA A;  2P73 A;  4FCE A;  4IHF A;  3IOI A;  2W0W A;  4FIY A;  3CKV A;  1ZCY A;  2C0N A;  2I5E A;  4N27 A;  4ASY A;  1HJL A;  2WLE A;  1TZF A;  2FYC B;  1H7F A;  2RJ6 A;  1WVC A;  3I0H A;  1QRM A;  3OH2 A;  1SSQ A;  2O1G A;  1KRV A;  1FRW A;  4EE4 A;  3V4E A;  1VZX A;  3I0D A;  2V0K A;  3KWE A;  3PKP A;  1H5R B;  2YQC A;  4M99 A;  1WT2 A;  3VBP A;  4J18 A;  1GWV A;  3V8Y A;  2RIZ A;  1I52 A;  2VXM A;  3HSQ A;  4R37 A;  2OI6 A;  5C4D A;  3OW5 A;  2RJ1 A;  2WEE A;  4CJB A;  3NZ2 A;  3FOQ A;  1R81 A;  2CU2 A;  2QIA A;  4B3U A;  2Y4M A;  2XAT A;  3R8Y A;  3D5N A;  2RIY A;  3VBL A;  1JV1 A;  4Y64 A;  2VD4 A;  4E75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...