3SPTA

Crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
474
structure length
474
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title Structure of Mycobacterium tuberculosis GlmU in complex with Acetyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 179
structure length 474
sequence length 474
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2011-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3sptA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sptA01
4M9CA 2IU9A 4M28A 1EYRA 3GVDA 3PKPA 1G23A 1LL3A 3OH2A 1KK6A 5FYEA 5CQMX 1ZJ1A 4H7OA 3SXAA 2D0JA 5DG3A 1G0RA 1ZDGA 1VGZA 1NHEB 2JCLA 4E6TA 1WVCA 4E1KA 1MP4A 2BO6A 1H5SC 3T7OA 1FGXA 5FTSA 5C4EA 1H7FA 4EEOA 2Y4JA 2AM4A 3JTJA 5CMGX 4UEGA 1TDTA 4D11C 1GA8A 2GGQA 4G3PA 2Y4KA 3KWDA 2YQHA 4IRPA 1H5RA 3EEVA 1JYKA 1LXAA 5C47A 3FTTA 1VH1A 4FRMA 3BFPA 4EE3A 1NQIB 3DK5A 1OQMB 4J18A 2WLCA 4FRHA 2Y6PA 4AYJA 5DEMA 1H7LA 1QG8A 1XZ6A 3O3PA 2UX8A 4IHGA 4DECA 3P1BA 2WLFA 1KK4A 2VS3A 1H4DA 5FTVA 3SX5A 5CMJA 3SXGA 3TWDA 3I3XA 3CGXA 4NALA 3K8DA 4P02A 2YQSA 3V8YA 4IHHA 2WLEA 4HCQA 1G2VA 3R8YA 1R81A 2XMHA 3R1WA 2AH9A 1SSQA 1O7OA 3VBPA 3E25A 3TV0A 1H7TA 4LW6A 4EAAA 4ECMA 3SXCA 2YESA 3RSBA 3PKQA 5FV9A 3BSSA 3R0SA 1LZJA 3OW5A 1FOAA 1ON8A 4EEMA 2RJ4A 1HM0A 1QREA 3TK8A 3T7NA 3HL3A 3K8EA 2W0WA 3KIAA 1H4EA 1VGWA 5C49A 5C4DA 1ZJ2A 4KPZA 1ZJ0A 4L41C 3KWCA 3BCVA 1JVGA 4ISXA 1VZXA 4FQWA 3R3RA 4NANA 1SSMA 2VFZA 4B3UA 1VZUA 2FFUA 1H4CA 1YP2A 2GGOA 1V84A 3FWWA 4KQLA 4EGGA 1ZCVA 4JISA 4M4KA 4M2AA 1FR8A 3U2UA 5IFYA 2WVKA 1ZCUA 1JV3A 3OH4A 1FZWA 4HO4A 2X5ZA 2O1GA 1FR9A 4E6UA 1ZI3A 1FO9A 4CVHA 3V0NA 1ZJPA 4NAIA 4G3QA 5C4BA 5I1FA 2O1FA 2I5KA 4FRLA 2VSIA 2VSHA 3D8VA 1FO8A 3JUKA 1H5RB 1HV9A 3D98A 3JQYA 2AQ9A 1KRVA 2RJ6A 4EVWA 4HO0A 4Y63A 1S80A 1OCXA 2IU8A 2FYAA 2AE7A 4Y6UA 1G95A 3F1CA 2RITA 2FYCB 4EEAA 1QRLA 4Y9XA 1H7GA 1KQAA 2BO7A 1R7VA 1QRFA 4B2WA 2OI6A 2Z87A 3CKQA 2VXMA 3GUEA 1W55A 2P2OA 1ZCTA 2YC5A 1J2ZA 4FCEA 4CJ8A 4D0TA 4CJCA 1R7XA 4FREA 1KRUA 3ZGFA 4B4GA 3VBMA 3SXEA 2X65A 2RJ9A 1LL2A 3I0EA 2W0VA 2P73A 2E3DA 3TZTA 3I0HA 3RMVA 1W57A 3IOHA 3I0CA 3SX7A 4FCUA 3FOQA 1ZI5A 3BRKX 3VBNA 2OI5A 5EJZA 5C3BA 2PX7A 3E26A 1O23B 3CJ8A 3OH0A 1FG5N 1H7HA 1YP3A 2WGZA 2Y7AA 1TZFA 1GQCA 2QH5A 1G9RA 3Q7UA 5CMFX 4NAKA 5CQOA 4HO9A 1ON6A 2I7BA 3QVBA 2QIVX 3MQGA 3NGWA 3R5DA 3I0JA 3I3AA 1GX0A 2ZU7A 4EABA 4Y62A 5C38A 3OKRA 4KC2A 4AC3A 4Y7FA 1E5KA 2VD4A 1QGSA 2XWMA 4KNRA 1R7TA 1GWVA 3V0PA 2V0KA 3DHOA 4FRAA 5F42A 2RJ7A 3IXCA 2NPOA 1V67A 2O1HA 4B42A 1LZ7A 1G97A 3SX3A 4N6BA 3FSCA 3RMWA 2ICXA 1KHRA 4N6AA 3R5CA 4R7PA 2XWLA 4EQYA 5CQNX 2VHEA 5EJ1A 1V83A 4G87A 3EG4A 2X60A 3ZLKA 1ZJ3A 1VM8A 1KWSA 3HJJA 2APCA 3U2TA 2D7RA 3FSXA 3I0DA 1NKHB 3R2WA 2IUAA 4IRQA 5C4CA 2WLGA 2YCMA 5AFUU 3F1XA 3SX8A 3DJ4A 2Z86A 3FS8A 5L6SA 4LW3A 1LZIA 1WSZA 5U2KA 2OEFA 1MP5A 1VPAA 2XATA 4M98A 1ZI4A 3OAMA 1TW5A 2TDTA 4E79A 5C8RA 2ICYA 1R82A 3VBLA 2V0HA 1O7QA 1WT1A 3ECTA 2P6WA 2PGVA 5IDTA 5C3AA 2PA4A 5EIYA 3Q1XA 3MC4A 5C4FA 1EZIA 4MYOA 4AYLA 4ASYA 3NZ2A 3BXYA 4HZDA 5AFUV 1IIMA 4Y7VA 4Y7UA 1IINA 2CU2A 3R5BA 1I52A 1QRMA 3USQA 4HO3A 3BSYA 1FXJA 2FY7A 3FSBA 4KNXA 3U2XA 3V91A 1S4NA 3CKJA 4K6RA 4B4MA 2V0LA 1SS9A 5E3PA 3I0KA 1V3WA 5FU0A 1MR9A 3V0LA 2VS4A 5AJNA 1H5SD 1R7UA 3R3IA 4C2SA 5JQQA 1FWYA 2OI7A 3OUPA 4R36A 1H5SA 3U2VA 2JF2A 2WLDA 4HO5A 3SXBA 1SSTA 4D11A 3ZLLA 3BSWA 2E8BA 5DDVA 1XHDA 5C1HA 3TQDA 3Q4SA 3DUVA 1O0RA 3VBJA 1KGTA 4GBPA 3I0FA 4XWIA 1MC3A 4KC1A 3U2WA 3V0MA 3P47A 1MRLA 3TIOA 5FU8A 3V90A 2JCJA 4DDZA 3OTZA 3Q80A 2JF3A 4Y7TA 4EEGA 2FYDB 4HUSA 3KWEA 1WT0A 1QWJA 2QIAA 2JCOA 2Y4LA 2OEGA 3IOJA 1PZYB 2BO8A 4N69A 3CKNA 1JV1A 1WT2A 2AESA 4KT7A 1G1LA 1NF5B 2A8UA 3ZGGA 3OH3A 4MYBA 3CKVA 1VGUA 2PGYA 3I0LA 1KK5A 3IGJA 1V82A 4D48A 5C48A 3V8ZA 2IC7A 2X5SA 4N27A 1NMMB 4B5BA 4ASJA 3V0QA 4EA7A 2P72A 1H7QA 4B2XA 5L6VA 2RJ5A 3GOSA 2V0JA 3SRTA 2AGDA 2RIJA 1W77A 4D0ZA 4HG6A 5CMIA 1G93A 2JCKA 5IDSA 2WE9A 1LVWA 1HM8A 3SPTA 4FROA 3USRA 4HOCA 2AECA 3VNPA 1VGTA 4BMAA 3N9WA 3MQHA 1OMXA 4P00A 4AAWA 3CKOA 5CQLX 4FRQA 4R37A 2ZU9A 4CJBA 1QGQA 4Y64A 4B4BA 2RJ1A 2BO4A 1VH3A 3C8VA 2WEEA 1VZTA 5CMHA 2YQCA 1H5SB 5FUHA 5C1GA 1Z90A 5C3DA 4MNDA 3OC9A 1MP3A 3OH1A 1LZ0A 4ARWA 2A8WA 2FKOA 2Y4MA 1H3MA 1QQ0A 1VICA 2MZBA 5J49A 1XHBA 1R80A 2YC3A 2XMEA 4HO8A 1JYLA 1S4OA 1KGQA 3VBIA 1G3LA 1TVYA 5ADXU 4KXOA 3F1YA 4JD0A 1YP4A 1K4VA 4FRPA 5HS2A 1HM9A 2AM3A 3V0OA 4KPXA 3T57A 4DE7A 3T7MA 4M2BA 3LW6A 2AM5A 2RJ0A 4IHFA 1H5TB 2V0IA 4EA8A 3OTMA 1T3DA 2RIZA 3U0YA 1NWGB 4EE4A 3R5AA 4KC4A 1WT3A 4FRDA 1ZI1A 1H7EA 4ZDQA 5BXCA 5ADXV 2VS5A 4J09A 1ZJOA 4FRBA 1THJA 3CU0A 2RJ8A 4Y7GA 1R7YA 4MFGA 3TDTA 2QGIA 3U0XA 4BQHA 1FXOA 3PNNA 3SXDA 3OU9A 1FRWA 3IOIA 3VBKA 4KRVA 1PZTA 1G8OA 2FYBA 5DEPA 2Q4JA 1JVDA 1S4PA 2WVLA 4HO6A 5E3RA 1TW1A 4Y6NA 3OGZA 1XATA 5E3QA 3ZF8A 3ST8A 1OMZA 2QKXA 1LL0A 4EA9A 4HZCA 3I0GA 1FGGA 4MZUA 5C1LA 4DCLA 1KRRA 3HSQA 4AA7A 3JUJA 4M99A 4E75A 3TISA 1MR7A 2WAWA 3EH0A 1INJA 2DPWA 2RIYA 5CQPA 2VXLA 2WVMA 1ZIZA 5AJOA 4G3SA 2YQJA 1ZHJA 2RIXA 3PMOA 3D5NA 4EE5A 4YS8A 1GX4A 1HJJA 2D7IA 2I5EA 3V4EA 1QRGA 2ZU8A 5DDTA 1H5TA 1GWWA 3POLA 2NXVA 1ZDFA 3I0IX 5C36A 1HJLA 1INIA 3EE5A 1GQ9A 4HO2A 5AJPA 1ZCYA 1YROB 2FFVA 3FSYA 4HURA 2XWNA
chains in the Genus database with same CATH superfamily
4M9CA 2IU9A 4M28A 1EYRA 3GVDA 3PKPA 1G23A 3OH2A 1LL3A 1KK6A 5FYEA 5CQMX 1ZJ1A 4H7OA 3SXAA 2D0JA 5DG3A 1G0RA 1ZDGA 1VGZA 1NHEB 2JCLA 4E6TA 1WVCA 4E1KA 1MP4A 2BO6A 1H5SC 3T7OA 1FGXA 5FTSA 5C4EA 1H7FA 4EEOA 2Y4JA 2AM4A 3JTJA 5CMGX 1EWWA 4UEGA 1TDTA 4D11C 1GA8A 2GGQA 4G3PA 2Y4KA 3KWDA 2YQHA 4IRPA 1H5RA 3EEVA 1JYKA 1LXAA 5C47A 3FTTA 1VH1A 4FRMA 3BFPA 4EE3A 1N4IA 1NQIB 3DK5A 1OQMB 4J18A 2WLCA 4FRHA 2Y6PA 4AYJA 5DEMA 1H7LA 1QG8A 1XZ6A 3O3PA 2UX8A 4IHGA 4DECA 3P1BA 2WLFA 4Q7CA 1KK4A 2VS3A 1H4DA 5FTVA 3SX5A 5CMJA 3SXGA 3TWDA 3I3XA 3CGXA 4NALA 3K8DA 4P02A 2YQSA 3V8YA 4IHHA 2WLEA 4HCQA 1G2VA 3R8YA 1R81A 2XMHA 3R1WA 2AH9A 1SSQA 1O7OA 3VBPA 3E25A 3TV0A 1H7TA 4LW6A 4EAAA 4ECMA 3SXCA 2YESA 3RSBA 3PKQA 5FV9A 3BSSA 3R0SA 1LZJA 3OW5A 1FOAA 1ON8A 4EEMA 2RJ4A 1HM0A 1QREA 3TK8A 3T7NA 3HL3A 3K8EA 2W0WA 3KIAA 1H4EA 1VGWA 5C49A 5C4DA 1ZJ2A 4KPZA 1ZJ0A 4L41C 3KWCA 3BCVA 1JVGA 4ISXA 1VZXA 4FIYA 4FQWA 3R3RA 4NANA 1SSMA 2VFZA 4B3UA 1VZUA 2FFUA 1H4CA 1YP2A 2GGOA 1V84A 3FWWA 4KQLA 4EGGA 1ZCVA 4JISA 4M4KA 4M2AA 1FR8A 3U2UA 3SUCA 5IFYA 2WVKA 1ZCUA 1JV3A 3OH4A 1FZWA 4HO4A 2X5ZA 2O1GA 1FR9A 4E6UA 1ZI3A 1FO9A 4CVHA 3V0NA 1ZJPA 4NAIA 4G3QA 5C4BA 5I1FA 2O1FA 2VK9A 2I5KA 4FRLA 2VSIA 2VSHA 3D8VA 1FO8A 3JUKA 1H5RB 1HV9A 3D98A 3JQYA 2AQ9A 1KRVA 2RJ6A 4EVWA 4HO0A 4Y63A 1S80A 1OCXA 2IU8A 2FYAA 2AE7A 4Y6UA 1G95A 3F1CA 2RITA 2FYCB 4EEAA 1QRLA 4Y9XA 1H7GA 1KQAA 2BO7A 1R7VA 1QRFA 4B2WA 2OI6A 2Z87A 3CKQA 2VXMA 3GUEA 1W55A 2P2OA 1ZCTA 2YC5A 1J2ZA 4FCEA 4CJ8A 4D0TA 4CJCA 1R7XA 4FREA 1KRUA 3ZGFA 4B4GA 3VBMA 3SXEA 2X65A 2RJ9A 1LL2A 3I0EA 2W0VA 2P73A 2E3DA 3TZTA 3I0HA 3RMVA 1W57A 3IOHA 3I0CA 3SX7A 4FCUA 3FOQA 1ZI5A 3BRKX 3VBNA 2OI5A 2C0NA 5EJZA 5C3BA 2PX7A 5D92A 3E26A 1O23B 3CJ8A 3OH0A 1FG5N 4O6NA 1H7HA 1YP3A 2WGZA 2Y7AA 1TZFA 1GQCA 2QH5A 1G9RA 3Q7UA 3GQAA 5CMFX 2J0AA 4NAKA 5CQOA 4HO9A 1ON6A 2I7BA 3QVBA 2QIVX 3MQGA 3NGWA 3R5DA 3I0JA 3I3AA 1GX0A 2ZU7A 4EABA 4Y62A 5C38A 3OKRA 4KC2A 4AC3A 4Y7FA 1E5KA 2VD4A 1QGSA 2XWMA 4KNRA 1R7TA 1GWVA 3V0PA 2V0KA 3DHOA 4FRAA 5F42A 2RJ7A 3IXCA 2NPOA 1V67A 2O1HA 4B42A 1LZ7A 1G97A 3SX3A 4N6BA 3FSCA 3RMWA 2ICXA 1KHRA 4N6AA 3R5CA 4R7PA 2XWLA 4EQYA 5CQNX 2VHEA 5EJ1A 1V83A 4O6MA 4G87A 3EG4A 2X60A 3ZLKA 1ZJ3A 1VM8A 1KWSA 3HJJA 2APCA 3U2TA 2D7RA 3FSXA 3I0DA 1NKHB 3R2WA 2IUAA 4IRQA 5C4CA 2WLGA 2YCMA 5AFUU 3F1XA 3SX8A 3DJ4A 4FIXA 2Z86A 3FS8A 5L6SA 4LW3A 1LZIA 1WSZA 5U2KA 2OEFA 1MP5A 1VPAA 2XATA 4M98A 1ZI4A 3OAMA 1TW5A 2TDTA 2J0BA 4E79A 5C8RA 2ICYA 1R82A 3VBLA 2V0HA 1O7QA 1WT1A 3ECTA 2P6WA 2PGVA 5IDTA 5C3AA 2PA4A 5EIYA 3Q1XA 3MC4A 5C4FA 1EZIA 4MYOA 4AYLA 4ASYA 3NZ2A 3BXYA 4HZDA 5AFUV 1IIMA 4Y7VA 4Y7UA 1IINA 2CU2A 3R5BA 1I52A 1QRMA 3USQA 4HO3A 3BSYA 1FXJA 2FY7A 3FSBA 4KNXA 3U2XA 3V91A 1S4NA 3CKJA 4K6RA 4B4MA 2V0LA 1SS9A 5E3PA 3I0KA 1V3WA 5FU0A 1MR9A 3V0LA 2VS4A 5AJNA 1H5SD 1R7UA 3R3IA 4C2SA 5JQQA 1FWYA 2OI7A 3OUPA 4R36A 1H5SA 3U2VA 2JF2A 2WLDA 4HO5A 3SXBA 1SSTA 4D11A 3ZLLA 3BSWA 2E8BA 5DDVA 1XHDA 5C1HA 3TQDA 3Q4SA 3DUVA 1O0RA 3VBJA 1KGTA 4GBPA 3I0FA 4XWIA 1MC3A 4KC1A 3U2WA 3V0MA 3P47A 1MRLA 3TIOA 5FU8A 3V90A 2JCJA 4DDZA 3OTZA 3Q80A 2JF3A 4Y7TA 4EEGA 2FYDB 4HUSA 3KWEA 1WT0A 1QWJA 2QIAA 2JCOA 2Y4LA 2OEGA 3IOJA 1PZYB 2BO8A 4N69A 3CKNA 1JV1A 1WT2A 2AESA 4KT7A 1G1LA 1NF5B 2A8UA 3ZGGA 3OH3A 4MYBA 3CKVA 1VGUA 2PGYA 3I0LA 1KK5A 3IGJA 1V82A 4D48A 5C48A 3V8ZA 2IC7A 2X5SA 4N27A 1NMMB 4B5BA 4ASJA 3V0QA 4EA7A 2P72A 1H7QA 4B2XA 5L6VA 2RJ5A 3GOSA 2V0JA 3SRTA 2AGDA 2RIJA 1W77A 3GQ8A 4D0ZA 4HG6A 5CMIA 1G93A 2JCKA 1Z2FA 5IDSA 2WE9A 1LVWA 1HM8A 3SPTA 5D91A 4FROA 3USRA 4HOCA 2AECA 3VNPA 1VGTA 4BMAA 3N9WA 3MQHA 1OMXA 4P00A 4AAWA 3CKOA 5CQLX 4FRQA 4R37A 2ZU9A 4CJBA 1QGQA 4Y64A 4B4BA 2RJ1A 2BO4A 1VH3A 3C8VA 2WEEA 1VZTA 5CMHA 2YQCA 1H5SB 5FUHA 5C1GA 1Z90A 5C3DA 4MNDA 3OH1A 1MP3A 3OC9A 1LZ0A 4ARWA 2A8WA 2FKOA 2Y4MA 1H3MA 1QQ0A 1VICA 2MZBA 5J49A 1XHBA 1R80A 2YC3A 2XMEA 4HO8A 1JYLA 1S4OA 1KGQA 1L0SA 3VBIA 1G3LA 1TVYA 5ADXU 4KXOA 3F1YA 4JD0A 1YP4A 1K4VA 4FRPA 5HS2A 1HM9A 2AM3A 3V0OA 4KPXA 3T57A 4DE7A 3T7MA 4M2BA 3LW6A 2AM5A 2RJ0A 4IHFA 1H5TB 2V0IA 4EA8A 3OTMA 1T3DA 2RIZA 3GQ9A 1NWGB 3U0YA 4EE4A 3R5AA 4KC4A 1WT3A 4FRDA 1ZI1A 1H7EA 4ZDQA 5BXCA 5ADXV 2VS5A 4J09A 1ZJOA 4FRBA 1THJA 3CU0A 2RJ8A 4Y7GA 1R7YA 1M8NA 4MFGA 3TDTA 2QGIA 3U0XA 4BQHA 1FXOA 3PNNA 3SXDA 3OU9A 1FRWA 3IOIA 3VBKA 4KRVA 1PZTA 1G8OA 2FYBA 5DEPA 2Q4JA 1JVDA 1S4PA 2WVLA 4HO6A 5E3RA 1TW1A 4Y6NA 3OGZA 1XATA 5E3QA 3ZF8A 3ST8A 1OMZA 2QKXA 1LL0A 4EA9A 4HZCA 3I0GA 1FGGA 4MZUA 5C1LA 4DCLA 1KRRA 3HSQA 4AA7A 3JUJA 4M99A 4E75A 3TISA 1MR7A 2WAWA 3EH0A 1INJA 2DPWA 2RIYA 5CQPA 2VXLA 2WVMA 1ZIZA 5AJOA 4G3SA 2YQJA 1ZHJA 2RIXA 3PMOA 3D5NA 4EE5A 4YS8A 1GX4A 1HJJA 2D7IA 2I5EA 3V4EA 4MIXA 1QRGA 2ZU8A 5DDTA 1H5TA 1GWWA 3POLA 2NXVA 1ZDFA 3I0IX 5C36A 1HJLA 1INIA 3EE5A 1GQ9A 4HO2A 5AJPA 1ZCYA 1YROB 2FFVA 3FSYA 4HURA 3GQ7A 2XWNA
chains in the Genus database with same CATH topology
4M9CA 2IU9A 4M28A 1EYRA 3GVDA 3PKPA 1G23A 1LL3A 3OH2A 1KK6A 5FYEA 5CQMX 1ZJ1A 4H7OA 3SXAA 2D0JA 5DG3A 1G0RA 1ZDGA 1VGZA 1NHEB 2JCLA 4E6TA 1WVCA 4E1KA 1MP4A 2BO6A 1H5SC 3T7OA 1FGXA 5FTSA 5C4EA 1H7FA 4EEOA 2Y4JA 2AM4A 3JTJA 5CMGX 4UEGA 1TDTA 4D11C 1GA8A 2GGQA 4G3PA 2Y4KA 3KWDA 2YQHA 4IRPA 1H5RA 3EEVA 1JYKA 1LXAA 5C47A 3FTTA 1VH1A 4FRMA 3BFPA 4EE3A 1NQIB 3DK5A 1OQMB 4J18A 2WLCA 4FRHA 2Y6PA 4AYJA 5DEMA 1H7LA 1QG8A 1XZ6A 3O3PA 2UX8A 4IHGA 4DECA 3P1BA 2WLFA 4Q7CA 1KK4A 2VS3A 1H4DA 5FTVA 3SX5A 5CMJA 3SXGA 3TWDA 3I3XA 3CGXA 4NALA 3K8DA 4P02A 2YQSA 3V8YA 4IHHA 2WLEA 4HCQA 1G2VA 3R8YA 1R81A 2XMHA 3R1WA 2AH9A 1SSQA 1O7OA 3VBPA 3E25A 3TV0A 1H7TA 4LW6A 4EAAA 4ECMA 3SXCA 2YESA 3RSBA 3PKQA 5FV9A 3BSSA 3R0SA 1LZJA 3OW5A 1FOAA 1ON8A 4EEMA 2RJ4A 1HM0A 1QREA 3TK8A 3T7NA 3HL3A 3K8EA 2W0WA 3KIAA 1H4EA 1VGWA 5C49A 5C4DA 1ZJ2A 4KPZA 1ZJ0A 4L41C 3KWCA 3BCVA 1JVGA 4ISXA 1VZXA 4FIYA 4FQWA 3R3RA 4NANA 1SSMA 2VFZA 4B3UA 1VZUA 2FFUA 1H4CA 1YP2A 2GGOA 1V84A 3FWWA 4KQLA 4EGGA 1ZCVA 4JISA 4M4KA 4M2AA 1FR8A 3U2UA 5IFYA 2WVKA 1ZCUA 1JV3A 3OH4A 1FZWA 4HO4A 2X5ZA 2O1GA 1FR9A 4E6UA 1ZI3A 1FO9A 4CVHA 3V0NA 1ZJPA 4NAIA 4G3QA 5C4BA 5I1FA 2O1FA 2VK9A 2I5KA 4FRLA 2VSIA 2VSHA 3D8VA 1FO8A 3JUKA 1H5RB 1HV9A 3D98A 3JQYA 2AQ9A 1KRVA 2RJ6A 4EVWA 4HO0A 4Y63A 1S80A 1OCXA 2IU8A 2FYAA 2AE7A 4Y6UA 1G95A 3F1CA 2RITA 2FYCB 4EEAA 1QRLA 4Y9XA 1H7GA 1KQAA 2BO7A 1R7VA 1QRFA 4B2WA 2OI6A 2Z87A 3CKQA 2VXMA 3GUEA 1W55A 2P2OA 1ZCTA 2YC5A 1J2ZA 4FCEA 4CJ8A 4D0TA 4CJCA 1R7XA 4FREA 1KRUA 3ZGFA 4B4GA 3VBMA 3SXEA 2X65A 2RJ9A 1LL2A 3I0EA 2W0VA 2P73A 2E3DA 3TZTA 3I0HA 3RMVA 1W57A 3IOHA 3I0CA 3SX7A 4FCUA 3FOQA 1ZI5A 3BRKX 3VBNA 2OI5A 2C0NA 5EJZA 5C3BA 2PX7A 5D92A 3E26A 1O23B 3CJ8A 3OH0A 1FG5N 4O6NA 1H7HA 1YP3A 2WGZA 2Y7AA 1TZFA 1GQCA 2QH5A 1G9RA 3Q7UA 5CMFX 2J0AA 4NAKA 5CQOA 4HO9A 1ON6A 2I7BA 3QVBA 2QIVX 3MQGA 3NGWA 3R5DA 3I0JA 3I3AA 1GX0A 2ZU7A 4EABA 4Y62A 5C38A 3OKRA 4KC2A 4AC3A 4Y7FA 1E5KA 2VD4A 1QGSA 2XWMA 4KNRA 1R7TA 1GWVA 3V0PA 2V0KA 3DHOA 4FRAA 5F42A 2RJ7A 3IXCA 2NPOA 1V67A 2O1HA 4B42A 1LZ7A 1G97A 3SX3A 4N6BA 3FSCA 3RMWA 2ICXA 1KHRA 4N6AA 3R5CA 4R7PA 2XWLA 4EQYA 5CQNX 2VHEA 5EJ1A 1V83A 4O6MA 4G87A 3EG4A 2X60A 3ZLKA 1ZJ3A 1VM8A 1KWSA 3HJJA 2APCA 3U2TA 2D7RA 3FSXA 3I0DA 1NKHB 3R2WA 2IUAA 4IRQA 5C4CA 2WLGA 2YCMA 5AFUU 3F1XA 3SX8A 3DJ4A 4FIXA 2Z86A 3FS8A 5L6SA 4LW3A 1LZIA 1WSZA 5U2KA 2OEFA 1MP5A 1VPAA 2XATA 4M98A 1ZI4A 3OAMA 1TW5A 2TDTA 2J0BA 4E79A 5C8RA 2ICYA 1R82A 3VBLA 2V0HA 1O7QA 1WT1A 3ECTA 2P6WA 2PGVA 5IDTA 5C3AA 2PA4A 5EIYA 3Q1XA 3MC4A 5C4FA 1EZIA 4MYOA 4AYLA 4ASYA 3NZ2A 3BXYA 4HZDA 5AFUV 1IIMA 4Y7VA 4Y7UA 1IINA 2CU2A 3R5BA 1I52A 1QRMA 3USQA 4HO3A 3BSYA 1FXJA 2FY7A 3FSBA 4KNXA 3U2XA 3V91A 1S4NA 3CKJA 4K6RA 4B4MA 2V0LA 1SS9A 5E3PA 3I0KA 1V3WA 5FU0A 1MR9A 3V0LA 2VS4A 5AJNA 1H5SD 1R7UA 3R3IA 4C2SA 5JQQA 1FWYA 2OI7A 3OUPA 4R36A 1H5SA 3U2VA 2JF2A 2WLDA 4HO5A 3SXBA 1SSTA 4D11A 3ZLLA 3BSWA 2E8BA 5DDVA 1XHDA 5C1HA 3TQDA 3Q4SA 3DUVA 1O0RA 3VBJA 1KGTA 4GBPA 3I0FA 4XWIA 1MC3A 4KC1A 3U2WA 3V0MA 3P47A 1MRLA 3TIOA 5FU8A 3V90A 2JCJA 4DDZA 3OTZA 3Q80A 2JF3A 4Y7TA 4EEGA 2FYDB 4HUSA 3KWEA 1WT0A 1QWJA 2QIAA 2JCOA 2Y4LA 2OEGA 3IOJA 1PZYB 2BO8A 4N69A 3CKNA 1JV1A 1WT2A 2AESA 4KT7A 1G1LA 1NF5B 2A8UA 3ZGGA 3OH3A 4MYBA 3CKVA 1VGUA 2PGYA 3I0LA 1KK5A 3IGJA 1V82A 4D48A 5C48A 3V8ZA 2IC7A 2X5SA 4N27A 1NMMB 4B5BA 4ASJA 3V0QA 4EA7A 2P72A 1H7QA 4B2XA 5L6VA 2RJ5A 3GOSA 2V0JA 3SRTA 2AGDA 2RIJA 1W77A 4D0ZA 4HG6A 5CMIA 1G93A 2JCKA 5IDSA 2WE9A 1LVWA 1HM8A 3SPTA 5D91A 4FROA 3USRA 4HOCA 2AECA 3VNPA 1VGTA 4BMAA 3N9WA 3MQHA 1OMXA 4P00A 4AAWA 3CKOA 5CQLX 4FRQA 4R37A 2ZU9A 4CJBA 1QGQA 4Y64A 4B4BA 2RJ1A 2BO4A 1VH3A 3C8VA 2WEEA 1VZTA 5CMHA 2YQCA 1H5SB 5FUHA 5C1GA 1Z90A 5C3DA 4MNDA 3OC9A 1MP3A 3OH1A 1LZ0A 4ARWA 2A8WA 2FKOA 2Y4MA 1H3MA 1QQ0A 1VICA 2MZBA 5J49A 1XHBA 1R80A 2YC3A 2XMEA 4HO8A 1JYLA 1S4OA 1KGQA 3VBIA 1G3LA 1TVYA 5ADXU 4KXOA 3F1YA 4JD0A 1YP4A 1K4VA 4FRPA 5HS2A 1HM9A 2AM3A 3V0OA 4KPXA 3T57A 4DE7A 3T7MA 4M2BA 3LW6A 2AM5A 2RJ0A 4IHFA 1H5TB 2V0IA 4EA8A 3OTMA 1T3DA 2RIZA 3U0YA 1NWGB 4EE4A 3R5AA 4KC4A 1WT3A 4FRDA 1ZI1A 1H7EA 4ZDQA 5BXCA 5ADXV 2VS5A 4J09A 1ZJOA 4FRBA 1THJA 3CU0A 2RJ8A 4Y7GA 1R7YA 4MFGA 3TDTA 2QGIA 3U0XA 4BQHA 1FXOA 3PNNA 3SXDA 3OU9A 1FRWA 3IOIA 3VBKA 4KRVA 1PZTA 1G8OA 2FYBA 5DEPA 2Q4JA 1JVDA 1S4PA 2WVLA 4HO6A 5E3RA 1TW1A 4Y6NA 3OGZA 1XATA 5E3QA 3ZF8A 3ST8A 1OMZA 2QKXA 1LL0A 4EA9A 4HZCA 3I0GA 1FGGA 4MZUA 5C1LA 4DCLA 1KRRA 3HSQA 4AA7A 3JUJA 4M99A 4E75A 3TISA 1MR7A 2WAWA 3EH0A 1INJA 2DPWA 2RIYA 5CQPA 2VXLA 2WVMA 1ZIZA 5AJOA 4G3SA 2YQJA 1ZHJA 2RIXA 3PMOA 3D5NA 4EE5A 4YS8A 1GX4A 1HJJA 2D7IA 2I5EA 3V4EA 4MIXA 1QRGA 2ZU8A 5DDTA 1H5TA 1GWWA 3POLA 2NXVA 1ZDFA 3I0IX 5C36A 1HJLA 1INIA 3EE5A 1GQ9A 4HO2A 5AJPA 1ZCYA 1YROB 2FFVA 3FSYA 4HURA 2XWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9C A;  2IU9 A;  4M28 A;  1EYR A;  3GVD A;  3PKP A;  1G23 A;  1LL3 A;  3OH2 A;  1KK6 A;  5FYE A;  5CQM X;  1ZJ1 A;  4H7O A;  3SXA A;  2D0J A;  5DG3 A;  1G0R A;  1ZDG A;  1VGZ A;  1NHE B;  2JCL A;  4E6T A;  1WVC A;  4E1K A;  1MP4 A;  2BO6 A;  1H5S C;  3T7O A;  1FGX A;  5FTS A;  5C4E A;  1H7F A;  4EEO A;  2Y4J A;  2AM4 A;  3JTJ A;  5CMG X;  4UEG A;  1TDT A;  4D11 C;  1GA8 A;  2GGQ A;  4G3P A;  2Y4K A;  3KWD A;  2YQH A;  4IRP A;  1H5R A;  3EEV A;  1JYK A;  1LXA A;  5C47 A;  3FTT A;  1VH1 A;  4FRM A;  3BFP A;  4EE3 A;  1NQI B;  3DK5 A;  1OQM B;  4J18 A;  2WLC A;  4FRH A;  2Y6P A;  4AYJ A;  5DEM A;  1H7L A;  1QG8 A;  1XZ6 A;  3O3P A;  2UX8 A;  4IHG A;  4DEC A;  3P1B A;  2WLF A;  1KK4 A;  2VS3 A;  1H4D A;  5FTV A;  3SX5 A;  5CMJ A;  3SXG A;  3TWD A;  3I3X A;  3CGX A;  4NAL A;  3K8D A;  4P02 A;  2YQS A;  3V8Y A;  4IHH A;  2WLE A;  4HCQ A;  1G2V A;  3R8Y A;  1R81 A;  2XMH A;  3R1W A;  2AH9 A;  1SSQ A;  1O7O A;  3VBP A;  3E25 A;  3TV0 A;  1H7T A;  4LW6 A;  4EAA A;  4ECM A;  3SXC A;  2YES A;  3RSB A;  3PKQ A;  5FV9 A;  3BSS A;  3R0S A;  1LZJ A;  3OW5 A;  1FOA A;  1ON8 A;  4EEM A;  2RJ4 A;  1HM0 A;  1QRE A;  3TK8 A;  3T7N A;  3HL3 A;  3K8E A;  2W0W A;  3KIA A;  1H4E A;  1VGW A;  5C49 A;  5C4D A;  1ZJ2 A;  4KPZ A;  1ZJ0 A;  4L41 C;  3KWC A;  3BCV A;  1JVG A;  4ISX A;  1VZX A;  4FQW A;  3R3R A;  4NAN A;  1SSM A;  2VFZ A;  4B3U A;  1VZU A;  2FFU A;  1H4C A;  1YP2 A;  2GGO A;  1V84 A;  3FWW A;  4KQL A;  4EGG A;  1ZCV A;  4JIS A;  4M4K A;  4M2A A;  1FR8 A;  3U2U A;  5IFY A;  2WVK A;  1ZCU A;  1JV3 A;  3OH4 A;  1FZW A;  4HO4 A;  2X5Z A;  2O1G A;  1FR9 A;  4E6U A;  1ZI3 A;  1FO9 A;  4CVH A;  3V0N A;  1ZJP A;  4NAI A;  4G3Q A;  5C4B A;  5I1F A;  2O1F A;  2I5K A;  4FRL A;  2VSI A;  2VSH A;  3D8V A;  1FO8 A;  3JUK A;  1H5R B;  1HV9 A;  3D98 A;  3JQY A;  2AQ9 A;  1KRV A;  2RJ6 A;  4EVW A;  4HO0 A;  4Y63 A;  1S80 A;  1OCX A;  2IU8 A;  2FYA A;  2AE7 A;  4Y6U A;  1G95 A;  3F1C A;  2RIT A;  2FYC B;  4EEA A;  1QRL A;  4Y9X A;  1H7G A;  1KQA A;  2BO7 A;  1R7V A;  1QRF A;  4B2W A;  2OI6 A;  2Z87 A;  3CKQ A;  2VXM A;  3GUE A;  1W55 A;  2P2O A;  1ZCT A;  2YC5 A;  1J2Z A;  4FCE A;  4CJ8 A;  4D0T A;  4CJC A;  1R7X A;  4FRE A;  1KRU A;  3ZGF A;  4B4G A;  3VBM A;  3SXE A;  2X65 A;  2RJ9 A;  1LL2 A;  3I0E A;  2W0V A;  2P73 A;  2E3D A;  3TZT A;  3I0H A;  3RMV A;  1W57 A;  3IOH A;  3I0C A;  3SX7 A;  4FCU A;  3FOQ A;  1ZI5 A;  3BRK X;  3VBN A;  2OI5 A;  5EJZ A;  5C3B A;  2PX7 A;  3E26 A;  1O23 B;  3CJ8 A;  3OH0 A;  1FG5 N;  1H7H A;  1YP3 A;  2WGZ A;  2Y7A A;  1TZF A;  1GQC A;  2QH5 A;  1G9R A;  3Q7U A;  5CMF X;  4NAK A;  5CQO A;  4HO9 A;  1ON6 A;  2I7B A;  3QVB A;  2QIV X;  3MQG A;  3NGW A;  3R5D A;  3I0J A;  3I3A A;  1GX0 A;  2ZU7 A;  4EAB A;  4Y62 A;  5C38 A;  3OKR A;  4KC2 A;  4AC3 A;  4Y7F A;  1E5K A;  2VD4 A;  1QGS A;  2XWM A;  4KNR A;  1R7T A;  1GWV A;  3V0P A;  2V0K A;  3DHO A;  4FRA A;  5F42 A;  2RJ7 A;  3IXC A;  2NPO A;  1V67 A;  2O1H A;  4B42 A;  1LZ7 A;  1G97 A;  3SX3 A;  4N6B A;  3FSC A;  3RMW A;  2ICX A;  1KHR A;  4N6A A;  3R5C A;  4R7P A;  2XWL A;  4EQY A;  5CQN X;  2VHE A;  5EJ1 A;  1V83 A;  4G87 A;  3EG4 A;  2X60 A;  3ZLK A;  1ZJ3 A;  1VM8 A;  1KWS A;  3HJJ A;  2APC A;  3U2T A;  2D7R A;  3FSX A;  3I0D A;  1NKH B;  3R2W A;  2IUA A;  4IRQ A;  5C4C A;  2WLG A;  2YCM A;  5AFU U;  3F1X A;  3SX8 A;  3DJ4 A;  2Z86 A;  3FS8 A;  5L6S A;  4LW3 A;  1LZI A;  1WSZ A;  5U2K A;  2OEF A;  1MP5 A;  1VPA A;  2XAT A;  4M98 A;  1ZI4 A;  3OAM A;  1TW5 A;  2TDT A;  4E79 A;  5C8R A;  2ICY A;  1R82 A;  3VBL A;  2V0H A;  1O7Q A;  1WT1 A;  3ECT A;  2P6W A;  2PGV A;  5IDT A;  5C3A A;  2PA4 A;  5EIY A;  3Q1X A;  3MC4 A;  5C4F A;  1EZI A;  4MYO A;  4AYL A;  4ASY A;  3NZ2 A;  3BXY A;  4HZD A;  5AFU V;  1IIM A;  4Y7V A;  4Y7U A;  1IIN A;  2CU2 A;  3R5B A;  1I52 A;  1QRM A;  3USQ A;  4HO3 A;  3BSY A;  1FXJ A;  2FY7 A;  3FSB A;  4KNX A;  3U2X A;  3V91 A;  1S4N A;  3CKJ A;  4K6R A;  4B4M A;  2V0L A;  1SS9 A;  5E3P A;  3I0K A;  1V3W A;  5FU0 A;  1MR9 A;  3V0L A;  2VS4 A;  5AJN A;  1H5S D;  1R7U A;  3R3I A;  4C2S A;  5JQQ A;  1FWY A;  2OI7 A;  3OUP A;  4R36 A;  1H5S A;  3U2V A;  2JF2 A;  2WLD A;  4HO5 A;  3SXB A;  1SST A;  4D11 A;  3ZLL A;  3BSW A;  2E8B A;  5DDV A;  1XHD A;  5C1H A;  3TQD A;  3Q4S A;  3DUV A;  1O0R A;  3VBJ A;  1KGT A;  4GBP A;  3I0F A;  4XWI A;  1MC3 A;  4KC1 A;  3U2W A;  3V0M A;  3P47 A;  1MRL A;  3TIO A;  5FU8 A;  3V90 A;  2JCJ A;  4DDZ A;  3OTZ A;  3Q80 A;  2JF3 A;  4Y7T A;  4EEG A;  2FYD B;  4HUS A;  3KWE A;  1WT0 A;  1QWJ A;  2QIA A;  2JCO A;  2Y4L A;  2OEG A;  3IOJ A;  1PZY B;  2BO8 A;  4N69 A;  3CKN A;  1JV1 A;  1WT2 A;  2AES A;  4KT7 A;  1G1L A;  1NF5 B;  2A8U A;  3ZGG A;  3OH3 A;  4MYB A;  3CKV A;  1VGU A;  2PGY A;  3I0L A;  1KK5 A;  3IGJ A;  1V82 A;  4D48 A;  5C48 A;  3V8Z A;  2IC7 A;  2X5S A;  4N27 A;  1NMM B;  4B5B A;  4ASJ A;  3V0Q A;  4EA7 A;  2P72 A;  1H7Q A;  4B2X A;  5L6V A;  2RJ5 A;  3GOS A;  2V0J A;  3SRT A;  2AGD A;  2RIJ A;  1W77 A;  4D0Z A;  4HG6 A;  5CMI A;  1G93 A;  2JCK A;  5IDS A;  2WE9 A;  1LVW A;  1HM8 A;  3SPT A;  4FRO A;  3USR A;  4HOC A;  2AEC A;  3VNP A;  1VGT A;  4BMA A;  3N9W A;  3MQH A;  1OMX A;  4P00 A;  4AAW A;  3CKO A;  5CQL X;  4FRQ A;  4R37 A;  2ZU9 A;  4CJB A;  1QGQ A;  4Y64 A;  4B4B A;  2RJ1 A;  2BO4 A;  1VH3 A;  3C8V A;  2WEE A;  1VZT A;  5CMH A;  2YQC A;  1H5S B;  5FUH A;  5C1G A;  1Z90 A;  5C3D A;  4MND A;  3OC9 A;  1MP3 A;  3OH1 A;  1LZ0 A;  4ARW A;  2A8W A;  2FKO A;  2Y4M A;  1H3M A;  1QQ0 A;  1VIC A;  2MZB A;  5J49 A;  1XHB A;  1R80 A;  2YC3 A;  2XME A;  4HO8 A;  1JYL A;  1S4O A;  1KGQ A;  3VBI A;  1G3L A;  1TVY A;  5ADX U;  4KXO A;  3F1Y A;  4JD0 A;  1YP4 A;  1K4V A;  4FRP A;  5HS2 A;  1HM9 A;  2AM3 A;  3V0O A;  4KPX A;  3T57 A;  4DE7 A;  3T7M A;  4M2B A;  3LW6 A;  2AM5 A;  2RJ0 A;  4IHF A;  1H5T B;  2V0I A;  4EA8 A;  3OTM A;  1T3D A;  2RIZ A;  3U0Y A;  1NWG B;  4EE4 A;  3R5A A;  4KC4 A;  1WT3 A;  4FRD A;  1ZI1 A;  1H7E A;  4ZDQ A;  5BXC A;  5ADX V;  2VS5 A;  4J09 A;  1ZJO A;  4FRB A;  1THJ A;  3CU0 A;  2RJ8 A;  4Y7G A;  1R7Y A;  4MFG A;  3TDT A;  2QGI A;  3U0X A;  4BQH A;  1FXO A;  3PNN A;  3SXD A;  3OU9 A;  1FRW A;  3IOI A;  3VBK A;  4KRV A;  1PZT A;  1G8O A;  2FYB A;  5DEP A;  2Q4J A;  1JVD A;  1S4P A;  2WVL A;  4HO6 A;  5E3R A;  1TW1 A;  4Y6N A;  3OGZ A;  1XAT A;  5E3Q A;  3ZF8 A;  3ST8 A;  1OMZ A;  2QKX A;  1LL0 A;  4EA9 A;  4HZC A;  3I0G A;  1FGG A;  4MZU A;  5C1L A;  4DCL A;  1KRR A;  3HSQ A;  4AA7 A;  3JUJ A;  4M99 A;  4E75 A;  3TIS A;  1MR7 A;  2WAW A;  3EH0 A;  1INJ A;  2DPW A;  2RIY A;  5CQP A;  2VXL A;  2WVM A;  1ZIZ A;  5AJO A;  4G3S A;  2YQJ A;  1ZHJ A;  2RIX A;  3PMO A;  3D5N A;  4EE5 A;  4YS8 A;  1GX4 A;  1HJJ A;  2D7I A;  2I5E A;  3V4E A;  1QRG A;  2ZU8 A;  5DDT A;  1H5T A;  1GWW A;  3POL A;  2NXV A;  1ZDF A;  3I0I X;  5C36 A;  1HJL A;  1INI A;  3EE5 A;  1GQ9 A;  4HO2 A;  5AJP A;  1ZCY A;  1YRO B;  2FFV A;  3FSY A;  4HUR A;  2XWN A; 
#chains in the Genus database with same CATH topology
 4M9C A;  2IU9 A;  4M28 A;  1EYR A;  3GVD A;  3PKP A;  1G23 A;  3OH2 A;  1LL3 A;  1KK6 A;  5FYE A;  5CQM X;  1ZJ1 A;  4H7O A;  3SXA A;  2D0J A;  5DG3 A;  1G0R A;  1ZDG A;  1VGZ A;  1NHE B;  2JCL A;  4E6T A;  1WVC A;  4E1K A;  1MP4 A;  2BO6 A;  1H5S C;  3T7O A;  1FGX A;  5FTS A;  5C4E A;  1H7F A;  4EEO A;  2Y4J A;  2AM4 A;  3JTJ A;  5CMG X;  1EWW A;  4UEG A;  1TDT A;  4D11 C;  1GA8 A;  2GGQ A;  4G3P A;  2Y4K A;  3KWD A;  2YQH A;  4IRP A;  1H5R A;  3EEV A;  1JYK A;  1LXA A;  5C47 A;  3FTT A;  1VH1 A;  4FRM A;  3BFP A;  4EE3 A;  1N4I A;  1NQI B;  3DK5 A;  1OQM B;  4J18 A;  2WLC A;  4FRH A;  2Y6P A;  4AYJ A;  5DEM A;  1H7L A;  1QG8 A;  1XZ6 A;  3O3P A;  2UX8 A;  4IHG A;  4DEC A;  3P1B A;  2WLF A;  4Q7C A;  1KK4 A;  2VS3 A;  1H4D A;  5FTV A;  3SX5 A;  5CMJ A;  3SXG A;  3TWD A;  3I3X A;  3CGX A;  4NAL A;  3K8D A;  4P02 A;  2YQS A;  3V8Y A;  4IHH A;  2WLE A;  4HCQ A;  1G2V A;  3R8Y A;  1R81 A;  2XMH A;  3R1W A;  2AH9 A;  1SSQ A;  1O7O A;  3VBP A;  3E25 A;  3TV0 A;  1H7T A;  4LW6 A;  4EAA A;  4ECM A;  3SXC A;  2YES A;  3RSB A;  3PKQ A;  5FV9 A;  3BSS A;  3R0S A;  1LZJ A;  3OW5 A;  1FOA A;  1ON8 A;  4EEM A;  2RJ4 A;  1HM0 A;  1QRE A;  3TK8 A;  3T7N A;  3HL3 A;  3K8E A;  2W0W A;  3KIA A;  1H4E A;  1VGW A;  5C49 A;  5C4D A;  1ZJ2 A;  4KPZ A;  1ZJ0 A;  4L41 C;  3KWC A;  3BCV A;  1JVG A;  4ISX A;  1VZX A;  4FIY A;  4FQW A;  3R3R A;  4NAN A;  1SSM A;  2VFZ A;  4B3U A;  1VZU A;  2FFU A;  1H4C A;  1YP2 A;  2GGO A;  1V84 A;  3FWW A;  4KQL A;  4EGG A;  1ZCV A;  4JIS A;  4M4K A;  4M2A A;  1FR8 A;  3U2U A;  3SUC A;  5IFY A;  2WVK A;  1ZCU A;  1JV3 A;  3OH4 A;  1FZW A;  4HO4 A;  2X5Z A;  2O1G A;  1FR9 A;  4E6U A;  1ZI3 A;  1FO9 A;  4CVH A;  3V0N A;  1ZJP A;  4NAI A;  4G3Q A;  5C4B A;  5I1F A;  2O1F A;  2VK9 A;  2I5K A;  4FRL A;  2VSI A;  2VSH A;  3D8V A;  1FO8 A;  3JUK A;  1H5R B;  1HV9 A;  3D98 A;  3JQY A;  2AQ9 A;  1KRV A;  2RJ6 A;  4EVW A;  4HO0 A;  4Y63 A;  1S80 A;  1OCX A;  2IU8 A;  2FYA A;  2AE7 A;  4Y6U A;  1G95 A;  3F1C A;  2RIT A;  2FYC B;  4EEA A;  1QRL A;  4Y9X A;  1H7G A;  1KQA A;  2BO7 A;  1R7V A;  1QRF A;  4B2W A;  2OI6 A;  2Z87 A;  3CKQ A;  2VXM A;  3GUE A;  1W55 A;  2P2O A;  1ZCT A;  2YC5 A;  1J2Z A;  4FCE A;  4CJ8 A;  4D0T A;  4CJC A;  1R7X A;  4FRE A;  1KRU A;  3ZGF A;  4B4G A;  3VBM A;  3SXE A;  2X65 A;  2RJ9 A;  1LL2 A;  3I0E A;  2W0V A;  2P73 A;  2E3D A;  3TZT A;  3I0H A;  3RMV A;  1W57 A;  3IOH A;  3I0C A;  3SX7 A;  4FCU A;  3FOQ A;  1ZI5 A;  3BRK X;  3VBN A;  2OI5 A;  2C0N A;  5EJZ A;  5C3B A;  2PX7 A;  5D92 A;  3E26 A;  1O23 B;  3CJ8 A;  3OH0 A;  1FG5 N;  4O6N A;  1H7H A;  1YP3 A;  2WGZ A;  2Y7A A;  1TZF A;  1GQC A;  2QH5 A;  1G9R A;  3Q7U A;  3GQA A;  5CMF X;  2J0A A;  4NAK A;  5CQO A;  4HO9 A;  1ON6 A;  2I7B A;  3QVB A;  2QIV X;  3MQG A;  3NGW A;  3R5D A;  3I0J A;  3I3A A;  1GX0 A;  2ZU7 A;  4EAB A;  4Y62 A;  5C38 A;  3OKR A;  4KC2 A;  4AC3 A;  4Y7F A;  1E5K A;  2VD4 A;  1QGS A;  2XWM A;  4KNR A;  1R7T A;  1GWV A;  3V0P A;  2V0K A;  3DHO A;  4FRA A;  5F42 A;  2RJ7 A;  3IXC A;  2NPO A;  1V67 A;  2O1H A;  4B42 A;  1LZ7 A;  1G97 A;  3SX3 A;  4N6B A;  3FSC A;  3RMW A;  2ICX A;  1KHR A;  4N6A A;  3R5C A;  4R7P A;  2XWL A;  4EQY A;  5CQN X;  2VHE A;  5EJ1 A;  1V83 A;  4O6M A;  4G87 A;  3EG4 A;  2X60 A;  3ZLK A;  1ZJ3 A;  1VM8 A;  1KWS A;  3HJJ A;  2APC A;  3U2T A;  2D7R A;  3FSX A;  3I0D A;  1NKH B;  3R2W A;  2IUA A;  4IRQ A;  5C4C A;  2WLG A;  2YCM A;  5AFU U;  3F1X A;  3SX8 A;  3DJ4 A;  4FIX A;  2Z86 A;  3FS8 A;  5L6S A;  4LW3 A;  1LZI A;  1WSZ A;  5U2K A;  2OEF A;  1MP5 A;  1VPA A;  2XAT A;  4M98 A;  1ZI4 A;  3OAM A;  1TW5 A;  2TDT A;  2J0B A;  4E79 A;  5C8R A;  2ICY A;  1R82 A;  3VBL A;  2V0H A;  1O7Q A;  1WT1 A;  3ECT A;  2P6W A;  2PGV A;  5IDT A;  5C3A A;  2PA4 A;  5EIY A;  3Q1X A;  3MC4 A;  5C4F A;  1EZI A;  4MYO A;  4AYL A;  4ASY A;  3NZ2 A;  3BXY A;  4HZD A;  5AFU V;  1IIM A;  4Y7V A;  4Y7U A;  1IIN A;  2CU2 A;  3R5B A;  1I52 A;  1QRM A;  3USQ A;  4HO3 A;  3BSY A;  1FXJ A;  2FY7 A;  3FSB A;  4KNX A;  3U2X A;  3V91 A;  1S4N A;  3CKJ A;  4K6R A;  4B4M A;  2V0L A;  1SS9 A;  5E3P A;  3I0K A;  1V3W A;  5FU0 A;  1MR9 A;  3V0L A;  2VS4 A;  5AJN A;  1H5S D;  1R7U A;  3R3I A;  4C2S A;  5JQQ A;  1FWY A;  2OI7 A;  3OUP A;  4R36 A;  1H5S A;  3U2V A;  2JF2 A;  2WLD A;  4HO5 A;  3SXB A;  1SST A;  4D11 A;  3ZLL A;  3BSW A;  2E8B A;  5DDV A;  1XHD A;  5C1H A;  3TQD A;  3Q4S A;  3DUV A;  1O0R A;  3VBJ A;  1KGT A;  4GBP A;  3I0F A;  4XWI A;  1MC3 A;  4KC1 A;  3U2W A;  3V0M A;  3P47 A;  1MRL A;  3TIO A;  5FU8 A;  3V90 A;  2JCJ A;  4DDZ A;  3OTZ A;  3Q80 A;  2JF3 A;  4Y7T A;  4EEG A;  2FYD B;  4HUS A;  3KWE A;  1WT0 A;  1QWJ A;  2QIA A;  2JCO A;  2Y4L A;  2OEG A;  3IOJ A;  1PZY B;  2BO8 A;  4N69 A;  3CKN A;  1JV1 A;  1WT2 A;  2AES A;  4KT7 A;  1G1L A;  1NF5 B;  2A8U A;  3ZGG A;  3OH3 A;  4MYB A;  3CKV A;  1VGU A;  2PGY A;  3I0L A;  1KK5 A;  3IGJ A;  1V82 A;  4D48 A;  5C48 A;  3V8Z A;  2IC7 A;  2X5S A;  4N27 A;  1NMM B;  4B5B A;  4ASJ A;  3V0Q A;  4EA7 A;  2P72 A;  1H7Q A;  4B2X A;  5L6V A;  2RJ5 A;  3GOS A;  2V0J A;  3SRT A;  2AGD A;  2RIJ A;  1W77 A;  3GQ8 A;  4D0Z A;  4HG6 A;  5CMI A;  1G93 A;  2JCK A;  1Z2F A;  5IDS A;  2WE9 A;  1LVW A;  1HM8 A;  3SPT A;  5D91 A;  4FRO A;  3USR A;  4HOC A;  2AEC A;  3VNP A;  1VGT A;  4BMA A;  3N9W A;  3MQH A;  1OMX A;  4P00 A;  4AAW A;  3CKO A;  5CQL X;  4FRQ A;  4R37 A;  2ZU9 A;  4CJB A;  1QGQ A;  4Y64 A;  4B4B A;  2RJ1 A;  2BO4 A;  1VH3 A;  3C8V A;  2WEE A;  1VZT A;  5CMH A;  2YQC A;  1H5S B;  5FUH A;  5C1G A;  1Z90 A;  5C3D A;  4MND A;  3OH1 A;  1MP3 A;  3OC9 A;  1LZ0 A;  4ARW A;  2A8W A;  2FKO A;  2Y4M A;  1H3M A;  1QQ0 A;  1VIC A;  2MZB A;  5J49 A;  1XHB A;  1R80 A;  2YC3 A;  2XME A;  4HO8 A;  1JYL A;  1S4O A;  1KGQ A;  1L0S A;  3VBI A;  1G3L A;  1TVY A;  5ADX U;  4KXO A;  3F1Y A;  4JD0 A;  1YP4 A;  1K4V A;  4FRP A;  5HS2 A;  1HM9 A;  2AM3 A;  3V0O A;  4KPX A;  3T57 A;  4DE7 A;  3T7M A;  4M2B A;  3LW6 A;  2AM5 A;  2RJ0 A;  4IHF A;  1H5T B;  2V0I A;  4EA8 A;  3OTM A;  1T3D A;  2RIZ A;  3GQ9 A;  1NWG B;  3U0Y A;  4EE4 A;  3R5A A;  4KC4 A;  1WT3 A;  4FRD A;  1ZI1 A;  1H7E A;  4ZDQ A;  5BXC A;  5ADX V;  2VS5 A;  4J09 A;  1ZJO A;  4FRB A;  1THJ A;  3CU0 A;  2RJ8 A;  4Y7G A;  1R7Y A;  1M8N A;  4MFG A;  3TDT A;  2QGI A;  3U0X A;  4BQH A;  1FXO A;  3PNN A;  3SXD A;  3OU9 A;  1FRW A;  3IOI A;  3VBK A;  4KRV A;  1PZT A;  1G8O A;  2FYB A;  5DEP A;  2Q4J A;  1JVD A;  1S4P A;  2WVL A;  4HO6 A;  5E3R A;  1TW1 A;  4Y6N A;  3OGZ A;  1XAT A;  5E3Q A;  3ZF8 A;  3ST8 A;  1OMZ A;  2QKX A;  1LL0 A;  4EA9 A;  4HZC A;  3I0G A;  1FGG A;  4MZU A;  5C1L A;  4DCL A;  1KRR A;  3HSQ A;  4AA7 A;  3JUJ A;  4M99 A;  4E75 A;  3TIS A;  1MR7 A;  2WAW A;  3EH0 A;  1INJ A;  2DPW A;  2RIY A;  5CQP A;  2VXL A;  2WVM A;  1ZIZ A;  5AJO A;  4G3S A;  2YQJ A;  1ZHJ A;  2RIX A;  3PMO A;  3D5N A;  4EE5 A;  4YS8 A;  1GX4 A;  1HJJ A;  2D7I A;  2I5E A;  3V4E A;  4MIX A;  1QRG A;  2ZU8 A;  5DDT A;  1H5T A;  1GWW A;  3POL A;  2NXV A;  1ZDF A;  3I0I X;  5C36 A;  1HJL A;  1INI A;  3EE5 A;  1GQ9 A;  4HO2 A;  5AJP A;  1ZCY A;  1YRO B;  2FFV A;  3FSY A;  4HUR A;  3GQ7 A;  2XWN A; 
#chains in the Genus database with same CATH homology
 4M9C A;  2IU9 A;  4M28 A;  1EYR A;  3GVD A;  3PKP A;  1G23 A;  1LL3 A;  3OH2 A;  1KK6 A;  5FYE A;  5CQM X;  1ZJ1 A;  4H7O A;  3SXA A;  2D0J A;  5DG3 A;  1G0R A;  1ZDG A;  1VGZ A;  1NHE B;  2JCL A;  4E6T A;  1WVC A;  4E1K A;  1MP4 A;  2BO6 A;  1H5S C;  3T7O A;  1FGX A;  5FTS A;  5C4E A;  1H7F A;  4EEO A;  2Y4J A;  2AM4 A;  3JTJ A;  5CMG X;  4UEG A;  1TDT A;  4D11 C;  1GA8 A;  2GGQ A;  4G3P A;  2Y4K A;  3KWD A;  2YQH A;  4IRP A;  1H5R A;  3EEV A;  1JYK A;  1LXA A;  5C47 A;  3FTT A;  1VH1 A;  4FRM A;  3BFP A;  4EE3 A;  1NQI B;  3DK5 A;  1OQM B;  4J18 A;  2WLC A;  4FRH A;  2Y6P A;  4AYJ A;  5DEM A;  1H7L A;  1QG8 A;  1XZ6 A;  3O3P A;  2UX8 A;  4IHG A;  4DEC A;  3P1B A;  2WLF A;  4Q7C A;  1KK4 A;  2VS3 A;  1H4D A;  5FTV A;  3SX5 A;  5CMJ A;  3SXG A;  3TWD A;  3I3X A;  3CGX A;  4NAL A;  3K8D A;  4P02 A;  2YQS A;  3V8Y A;  4IHH A;  2WLE A;  4HCQ A;  1G2V A;  3R8Y A;  1R81 A;  2XMH A;  3R1W A;  2AH9 A;  1SSQ A;  1O7O A;  3VBP A;  3E25 A;  3TV0 A;  1H7T A;  4LW6 A;  4EAA A;  4ECM A;  3SXC A;  2YES A;  3RSB A;  3PKQ A;  5FV9 A;  3BSS A;  3R0S A;  1LZJ A;  3OW5 A;  1FOA A;  1ON8 A;  4EEM A;  2RJ4 A;  1HM0 A;  1QRE A;  3TK8 A;  3T7N A;  3HL3 A;  3K8E A;  2W0W A;  3KIA A;  1H4E A;  1VGW A;  5C49 A;  5C4D A;  1ZJ2 A;  4KPZ A;  1ZJ0 A;  4L41 C;  3KWC A;  3BCV A;  1JVG A;  4ISX A;  1VZX A;  4FIY A;  4FQW A;  3R3R A;  4NAN A;  1SSM A;  2VFZ A;  4B3U A;  1VZU A;  2FFU A;  1H4C A;  1YP2 A;  2GGO A;  1V84 A;  3FWW A;  4KQL A;  4EGG A;  1ZCV A;  4JIS A;  4M4K A;  4M2A A;  1FR8 A;  3U2U A;  5IFY A;  2WVK A;  1ZCU A;  1JV3 A;  3OH4 A;  1FZW A;  4HO4 A;  2X5Z A;  2O1G A;  1FR9 A;  4E6U A;  1ZI3 A;  1FO9 A;  4CVH A;  3V0N A;  1ZJP A;  4NAI A;  4G3Q A;  5C4B A;  5I1F A;  2O1F A;  2VK9 A;  2I5K A;  4FRL A;  2VSI A;  2VSH A;  3D8V A;  1FO8 A;  3JUK A;  1H5R B;  1HV9 A;  3D98 A;  3JQY A;  2AQ9 A;  1KRV A;  2RJ6 A;  4EVW A;  4HO0 A;  4Y63 A;  1S80 A;  1OCX A;  2IU8 A;  2FYA A;  2AE7 A;  4Y6U A;  1G95 A;  3F1C A;  2RIT A;  2FYC B;  4EEA A;  1QRL A;  4Y9X A;  1H7G A;  1KQA A;  2BO7 A;  1R7V A;  1QRF A;  4B2W A;  2OI6 A;  2Z87 A;  3CKQ A;  2VXM A;  3GUE A;  1W55 A;  2P2O A;  1ZCT A;  2YC5 A;  1J2Z A;  4FCE A;  4CJ8 A;  4D0T A;  4CJC A;  1R7X A;  4FRE A;  1KRU A;  3ZGF A;  4B4G A;  3VBM A;  3SXE A;  2X65 A;  2RJ9 A;  1LL2 A;  3I0E A;  2W0V A;  2P73 A;  2E3D A;  3TZT A;  3I0H A;  3RMV A;  1W57 A;  3IOH A;  3I0C A;  3SX7 A;  4FCU A;  3FOQ A;  1ZI5 A;  3BRK X;  3VBN A;  2OI5 A;  2C0N A;  5EJZ A;  5C3B A;  2PX7 A;  5D92 A;  3E26 A;  1O23 B;  3CJ8 A;  3OH0 A;  1FG5 N;  4O6N A;  1H7H A;  1YP3 A;  2WGZ A;  2Y7A A;  1TZF A;  1GQC A;  2QH5 A;  1G9R A;  3Q7U A;  5CMF X;  2J0A A;  4NAK A;  5CQO A;  4HO9 A;  1ON6 A;  2I7B A;  3QVB A;  2QIV X;  3MQG A;  3NGW A;  3R5D A;  3I0J A;  3I3A A;  1GX0 A;  2ZU7 A;  4EAB A;  4Y62 A;  5C38 A;  3OKR A;  4KC2 A;  4AC3 A;  4Y7F A;  1E5K A;  2VD4 A;  1QGS A;  2XWM A;  4KNR A;  1R7T A;  1GWV A;  3V0P A;  2V0K A;  3DHO A;  4FRA A;  5F42 A;  2RJ7 A;  3IXC A;  2NPO A;  1V67 A;  2O1H A;  4B42 A;  1LZ7 A;  1G97 A;  3SX3 A;  4N6B A;  3FSC A;  3RMW A;  2ICX A;  1KHR A;  4N6A A;  3R5C A;  4R7P A;  2XWL A;  4EQY A;  5CQN X;  2VHE A;  5EJ1 A;  1V83 A;  4O6M A;  4G87 A;  3EG4 A;  2X60 A;  3ZLK A;  1ZJ3 A;  1VM8 A;  1KWS A;  3HJJ A;  2APC A;  3U2T A;  2D7R A;  3FSX A;  3I0D A;  1NKH B;  3R2W A;  2IUA A;  4IRQ A;  5C4C A;  2WLG A;  2YCM A;  5AFU U;  3F1X A;  3SX8 A;  3DJ4 A;  4FIX A;  2Z86 A;  3FS8 A;  5L6S A;  4LW3 A;  1LZI A;  1WSZ A;  5U2K A;  2OEF A;  1MP5 A;  1VPA A;  2XAT A;  4M98 A;  1ZI4 A;  3OAM A;  1TW5 A;  2TDT A;  2J0B A;  4E79 A;  5C8R A;  2ICY A;  1R82 A;  3VBL A;  2V0H A;  1O7Q A;  1WT1 A;  3ECT A;  2P6W A;  2PGV A;  5IDT A;  5C3A A;  2PA4 A;  5EIY A;  3Q1X A;  3MC4 A;  5C4F A;  1EZI A;  4MYO A;  4AYL A;  4ASY A;  3NZ2 A;  3BXY A;  4HZD A;  5AFU V;  1IIM A;  4Y7V A;  4Y7U A;  1IIN A;  2CU2 A;  3R5B A;  1I52 A;  1QRM A;  3USQ A;  4HO3 A;  3BSY A;  1FXJ A;  2FY7 A;  3FSB A;  4KNX A;  3U2X A;  3V91 A;  1S4N A;  3CKJ A;  4K6R A;  4B4M A;  2V0L A;  1SS9 A;  5E3P A;  3I0K A;  1V3W A;  5FU0 A;  1MR9 A;  3V0L A;  2VS4 A;  5AJN A;  1H5S D;  1R7U A;  3R3I A;  4C2S A;  5JQQ A;  1FWY A;  2OI7 A;  3OUP A;  4R36 A;  1H5S A;  3U2V A;  2JF2 A;  2WLD A;  4HO5 A;  3SXB A;  1SST A;  4D11 A;  3ZLL A;  3BSW A;  2E8B A;  5DDV A;  1XHD A;  5C1H A;  3TQD A;  3Q4S A;  3DUV A;  1O0R A;  3VBJ A;  1KGT A;  4GBP A;  3I0F A;  4XWI A;  1MC3 A;  4KC1 A;  3U2W A;  3V0M A;  3P47 A;  1MRL A;  3TIO A;  5FU8 A;  3V90 A;  2JCJ A;  4DDZ A;  3OTZ A;  3Q80 A;  2JF3 A;  4Y7T A;  4EEG A;  2FYD B;  4HUS A;  3KWE A;  1WT0 A;  1QWJ A;  2QIA A;  2JCO A;  2Y4L A;  2OEG A;  3IOJ A;  1PZY B;  2BO8 A;  4N69 A;  3CKN A;  1JV1 A;  1WT2 A;  2AES A;  4KT7 A;  1G1L A;  1NF5 B;  2A8U A;  3ZGG A;  3OH3 A;  4MYB A;  3CKV A;  1VGU A;  2PGY A;  3I0L A;  1KK5 A;  3IGJ A;  1V82 A;  4D48 A;  5C48 A;  3V8Z A;  2IC7 A;  2X5S A;  4N27 A;  1NMM B;  4B5B A;  4ASJ A;  3V0Q A;  4EA7 A;  2P72 A;  1H7Q A;  4B2X A;  5L6V A;  2RJ5 A;  3GOS A;  2V0J A;  3SRT A;  2AGD A;  2RIJ A;  1W77 A;  4D0Z A;  4HG6 A;  5CMI A;  1G93 A;  2JCK A;  5IDS A;  2WE9 A;  1LVW A;  1HM8 A;  3SPT A;  5D91 A;  4FRO A;  3USR A;  4HOC A;  2AEC A;  3VNP A;  1VGT A;  4BMA A;  3N9W A;  3MQH A;  1OMX A;  4P00 A;  4AAW A;  3CKO A;  5CQL X;  4FRQ A;  4R37 A;  2ZU9 A;  4CJB A;  1QGQ A;  4Y64 A;  4B4B A;  2RJ1 A;  2BO4 A;  1VH3 A;  3C8V A;  2WEE A;  1VZT A;  5CMH A;  2YQC A;  1H5S B;  5FUH A;  5C1G A;  1Z90 A;  5C3D A;  4MND A;  3OC9 A;  1MP3 A;  3OH1 A;  1LZ0 A;  4ARW A;  2A8W A;  2FKO A;  2Y4M A;  1H3M A;  1QQ0 A;  1VIC A;  2MZB A;  5J49 A;  1XHB A;  1R80 A;  2YC3 A;  2XME A;  4HO8 A;  1JYL A;  1S4O A;  1KGQ A;  3VBI A;  1G3L A;  1TVY A;  5ADX U;  4KXO A;  3F1Y A;  4JD0 A;  1YP4 A;  1K4V A;  4FRP A;  5HS2 A;  1HM9 A;  2AM3 A;  3V0O A;  4KPX A;  3T57 A;  4DE7 A;  3T7M A;  4M2B A;  3LW6 A;  2AM5 A;  2RJ0 A;  4IHF A;  1H5T B;  2V0I A;  4EA8 A;  3OTM A;  1T3D A;  2RIZ A;  3U0Y A;  1NWG B;  4EE4 A;  3R5A A;  4KC4 A;  1WT3 A;  4FRD A;  1ZI1 A;  1H7E A;  4ZDQ A;  5BXC A;  5ADX V;  2VS5 A;  4J09 A;  1ZJO A;  4FRB A;  1THJ A;  3CU0 A;  2RJ8 A;  4Y7G A;  1R7Y A;  4MFG A;  3TDT A;  2QGI A;  3U0X A;  4BQH A;  1FXO A;  3PNN A;  3SXD A;  3OU9 A;  1FRW A;  3IOI A;  3VBK A;  4KRV A;  1PZT A;  1G8O A;  2FYB A;  5DEP A;  2Q4J A;  1JVD A;  1S4P A;  2WVL A;  4HO6 A;  5E3R A;  1TW1 A;  4Y6N A;  3OGZ A;  1XAT A;  5E3Q A;  3ZF8 A;  3ST8 A;  1OMZ A;  2QKX A;  1LL0 A;  4EA9 A;  4HZC A;  3I0G A;  1FGG A;  4MZU A;  5C1L A;  4DCL A;  1KRR A;  3HSQ A;  4AA7 A;  3JUJ A;  4M99 A;  4E75 A;  3TIS A;  1MR7 A;  2WAW A;  3EH0 A;  1INJ A;  2DPW A;  2RIY A;  5CQP A;  2VXL A;  2WVM A;  1ZIZ A;  5AJO A;  4G3S A;  2YQJ A;  1ZHJ A;  2RIX A;  3PMO A;  3D5N A;  4EE5 A;  4YS8 A;  1GX4 A;  1HJJ A;  2D7I A;  2I5E A;  3V4E A;  4MIX A;  1QRG A;  2ZU8 A;  5DDT A;  1H5T A;  1GWW A;  3POL A;  2NXV A;  1ZDF A;  3I0I X;  5C36 A;  1HJL A;  1INI A;  3EE5 A;  1GQ9 A;  4HO2 A;  5AJP A;  1ZCY A;  1YRO B;  2FFV A;  3FSY A;  4HUR A;  2XWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...