3SPTA

Crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
474
structure length
474
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Bifunctional protein glmU
publication title Structure of Mycobacterium tuberculosis GlmU in complex with Acetyl CoA
rcsb
source organism Mycobacterium tuberculosis
total genus 179
structure length 474
sequence length 474
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2011-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3sptA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sptA01
3VBJA 2YESA 4Y62A 3SXCA 3U2XA 1HM8A 1H5SB 1W55A 2RJ9A 5CMFX 3MC4A 2APCA 2FY7A 1XZ6A 4E79A 1FOAA 4KNRA 3K8DA 3R3IA 3I3XA 1H7HA 4B42A 4EVWA 5C48A 1ZJOA 3TISA 1H3MA 1FO9A 1H7GA 3EG4A 3IOIA 2BO4A 2RIJA 4M9CA 1VGWA 3ZGGA 4AYJA 3IOHA 2AE7A 1VH1A 4FRAA 1V83A 3VBLA 5C49A 4HO4A 1O7OA 3OTMA 2FYDB 2RJ4A 3OUPA 1QGQA 5L6VA 2BO6A 4G3SA 1YP3A 3R3RA 3DHOA 2ICYA 1WVCA 2P72A 2PX7A 3F1CA 1H7EA 1R7UA 2A8WA 4HO0A 3JUJA 3ZGFA 3VBPA 2Q4JA 1KRUA 3CJ8A 1H5SD 5C3DA 2O1FA 3PKQA 1VM8A 4G3QA 1G9RA 1ZDGA 1MP4A 3D5NA 3NZ2A 1FXJA 1XHBA 1V3WA 1S4PA 1O23B 1KGQA 2VD4A 4ASYA 3FTTA 1WT2A 3D8VA 2FYCB 1FG5N 4HO6A 4Y64A 3N9WA 5FU8A 3U0XA 1VPAA 2OI6A 4UEGA 1TZFA 1KRRA 3ZLLA 1G93A 3KWDA 3I3AA 4Y7GA 3SRTA 1ZHJA 1G0RA 3VBIA 2WLGA 3SX7A 4M2BA 1TW5A 1KK6A 1ZCUA 5F42A 2QIVX 4FRBA 3FSCA 3T7NA 2P73A 4KNXA 1H7TA 2I5EA 5E3QA 4Y63A 1ZIZA 2OI7A 2XWNA 4XWIA 1TDTA 2IU9A 4IHHA 3EE5A 3EEVA 1Z90A 3GOSA 4KQLA 1W57A 4FQWA 1JYLA 2Y6PA 2JCKA 2VS4A 1LZ0A 3DJ4A 1S4NA 1H7FA 5I1FA 3BSWA 4EEAA 3PNNA 2WGZA 1R80A 5FU0A 3R1WA 3FSXA 1OMXA 5CQMX 1E5KA 4G87A 1R7XA 4GBPA 1VGZA 2QKXA 3ECTA 3LW6A 3ZF8A 3V90A 2FFVA 2NPOA 3KIAA 4D0TA 4Y7UA 5CMGX 1KK5A 5C1HA 3SPTA 1VZTA 4Y6NA 1ZJ2A 5C8RA 3KWCA 3OTZA 2E3DA 5CMJA 3I0KA 4MFGA 4AC3A 5C4FA 2RIXA 3HL3A 2O1HA 3HSQA 3R5BA 2WLEA 1LZIA 4DE7A 3I0DA 3OH0A 3PKPA 1ZCYA 1ZCTA 3OU9A 5DDTA 3I0IX 1LZ7A 2IC7A 1R82A 3V0MA 4KC4A 3I0FA 3E26A 2V0HA 1VICA 2XMHA 3F1YA 5DDVA 5EIYA 4FRMA 1QQ0A 1EYRA 3U2TA 1JVGA 1OCXA 3CU0A 1TVYA 3SXGA 1ZJ3A 2D7IA 1HV9A 3P1BA 4B2WA 1YP2A 5E3RA 2RITA 2BO8A 3USQA 4KC2A 1J2ZA 1WT1A 1G1LA 1H4DA 2OI5A 4HO5A 4HUSA 1MP3A 2FKOA 5BXCA 1ZJPA 1G3LA 4M98A 1THJA 1SSQA 2X60A 2P6WA 4HO8A 2WLCA 1V82A 2QGIA 2ZU8A 1NKHB 3U2UA 1LXAA 1H5TA 4ARWA 4DCLA 4D48A 1JV3A 4C2SA 4LW3A 2AGDA 1WT0A 4EA7A 1LL3A 1QWJA 4K6RA 1GA8A 3Q7UA 3TZTA 5C38A 1JV1A 4FCEA 2Z87A 1G95A 5ADXV 2VXLA 1ZJ1A 3DUVA 1NQIB 2Y4MA 4R36A 4B4MA 4IRQA 2NXVA 3JUKA 4FRHA 1FGGA 2X65A 2XWLA 2V0LA 4G3PA 3RSBA 5ADXU 4NAKA 1NHEB 2JCLA 5C4CA 5AJOA 2JCJA 4B3UA 1PZTA 3MQGA 4EAAA 4EGGA 5C3BA 1YP4A 5C4EA 2WAWA 2RJ0A 3TV0A 4LW6A 5IDSA 4ZDQA 1TW1A 4E6UA 5DEMA 2Y7AA 2JF3A 3I0CA 4EQYA 4HCQA 4FROA 1K4VA 2PGVA 1R7VA 2V0JA 3OKRA 1MR7A 2ICXA 2XWMA 1QRMA 2ZU7A 2AM3A 3SXDA 5HS2A 1V84A 2Y4KA 2VXMA 4B4BA 4L41C 2RJ8A 4J18A 4AYLA 1FWYA 4MNDA 3VBMA 2QH5A 4EE5A 5AFUV 1FZWA 3BCVA 2VSHA 3V0NA 1S4OA 1LL0A 3I0GA 1KWSA 4N69A 3OW5A 2YCMA 3Q80A 4D11C 2CU2A 3TK8A 1ON8A 1VGUA 5CQNX 4EEMA 1FR8A 3V0QA 1SSTA 4YS8A 5J49A 1H7QA 1I52A 4EABA 4JISA 2YQJA 2QIAA 3BRKX 3R0SA 1VGTA 3FSYA 2VS5A 1R7TA 2FYBA 3OH3A 3OH1A 2XATA 5CQLX 2VFZA 3ZLKA 4AAWA 1O0RA 4EA8A 2YQHA 4MYBA 4R37A 2AESA 3SXEA 5L6SA 3SXBA 1QREA 1ZI4A 5FV9A 5AJNA 3R5DA 3V4EA 2UX8A 1S80A 4IHGA 3BXYA 4KPZA 4HO3A 5CQOA 2AECA 2AM5A 4B4GA 2AM4A 1VH3A 4HZDA 2Y4LA 2ZU9A 3CKNA 1XHDA 1HM0A 3USRA 3F1XA 4P00A 3U2VA 5C4DA 4HZCA 2AH9A 2X5SA 1FRWA 2GGQA 1O7QA 3QVBA 3SXAA 4CVHA 4FRQA 4HURA 2VHEA 2YC5A 1FR9A 3OH2A 1YROB 3V0LA 4ASJA 1IINA 4FRPA 2VS3A 2MZBA 2E8BA 3U0YA 2WEEA 3EH0A 4FRLA 1G23A 1NMMB 2DPWA 4ISXA 1ON6A 1R7YA 2W0WA 1H5RB 1PZYB 3NGWA 4E1KA 4M99A 1H5TB 4B5BA 2D7RA 1GX4A 3VBKA 4KRVA 5EJZA 3IOJA 4DDZA 5FUHA 1H5RA 4NANA 3V8ZA 4EE3A 2I7BA 2BO7A 5CMIA 2Y4JA 5U2KA 3JQYA 2WVKA 4HO9A 4B2XA 1ZI1A 2JCOA 5FTSA 4KXOA 5C1GA 1FXOA 2JF2A 3FSBA 2RJ6A 4FCUA 2GGOA 1QGSA 3E25A 5IDTA 4N27A 2FFUA 1H4CA 1H5SA 3VBNA 1INIA 1T3DA 1R81A 4Y7TA 3O3PA 3IXCA 2TDTA 1G2VA 4HG6A 4HO2A 3SX3A 1MP5A 4Y7VA 1HJJA 4Y7FA 1V67A 4D0ZA 3FS8A 5C36A 2OEFA 3BSSA 4Y9XA 2WLDA 5C3AA 4EEGA 1GX0A 3I0LA 2RJ1A 3V0PA 1VZXA 2Z86A 3RMVA 2O1GA 4EEOA 1GWWA 1G97A 1SSMA 3CGXA 1H5SC 2WLFA 4D11A 2VSIA 3DK5A 1W77A 3Q4SA 5CQPA 1IIMA 2PA4A 3V8YA 2RJ5A 1QRGA 3D98A 1JVDA 3I0EA 1GWVA 1NF5B 3GUEA 1WT3A 3MQHA 4BQHA 2OEGA 4KC1A 4M2AA 3GVDA 2PGYA 4FREA 2FYAA 3U2WA 5IFYA 3TDTA 5C47A 3TIOA 4HOCA 3Q1XA 5FYEA 2IUAA 1QG8A 5FTVA 5C4BA 2A8UA 3KWEA 1GQ9A 3ST8A 4ECMA 4E6TA 4DECA 4BMAA 3R5AA 4AA7A 1KK4A 1ZJ0A 1H7LA 3P47A 3R5CA 1KGTA 4FRDA 3OH4A 3V0OA 3T7MA 2XMEA 2YQCA 1FO8A 5AFUU 3JTJA 4R7PA 3CKVA 4EA9A 4JD0A 3I0JA 4NAIA 2RIZA 4EE4A 4P02A 4MYOA 1NWGB 1WSZA 5AJPA 4IHFA 2I5KA 3C8VA 1G8OA 3SX8A 1H4EA 1KQAA 1ZCVA 1LZJA 3OC9A 3CKJA 1HJLA 3POLA 3BSYA 1ZI5A 1LL2A 2WE9A 1OMZA 4M28A 1ZDFA 5JQQA 1QRLA 2W0VA 2RJ7A 2V0IA 5DG3A 4H7OA 1QRFA 1KHRA 4MZUA 4N6AA 4KT7A 2IU8A 1MC3A 1INJA 1SS9A 3I0HA 4Y6UA 5EJ1A 4NALA 3FWWA 1JYKA 2D0JA 3VNPA 3OGZA 3BFPA 3T57A 1EZIA 3SX5A 4J09A 1FGXA 1MRLA 2YQSA 1XATA 4KPXA 1HM9A 3CKOA 1ZI3A 4IRPA 4CJBA 3HJJA 5C1LA 3RMWA 2AQ9A 3TQDA 1LVWA 5DEPA 3R8YA 1MR9A 2V0KA 3PMOA 1KRVA 3CKQA 1GQCA 3OAMA 3T7OA 3IGJA 5E3PA 2X5ZA 5CMHA 1VZUA 2WVLA 2YC3A 4E75A 3TWDA 3R2WA 3V91A 4CJ8A 2WVMA 4CJCA 1OQMB 3FOQA 4N6BA 2P2OA 2RIYA 3K8EA 4M4KA
chains in the Genus database with same CATH superfamily
3VBJA 2YESA 4Y62A 3SXCA 3U2XA 1HM8A 1H5SB 1W55A 2RJ9A 5CMFX 3MC4A 2APCA 2FY7A 1XZ6A 4E79A 1FOAA 4KNRA 3K8DA 3R3IA 3I3XA 1H7HA 4B42A 4EVWA 5C48A 1ZJOA 3TISA 1H3MA 1FO9A 4Q7CA 1H7GA 3EG4A 3IOIA 2BO4A 2RIJA 4M9CA 1VGWA 3ZGGA 4AYJA 3IOHA 2AE7A 1VH1A 1N4IA 4FRAA 1V83A 3VBLA 5C49A 4HO4A 1O7OA 3OTMA 2FYDB 2RJ4A 3OUPA 1QGQA 5L6VA 2BO6A 4G3SA 1YP3A 3R3RA 3DHOA 2ICYA 1WVCA 2P72A 2PX7A 3F1CA 1H7EA 1R7UA 2A8WA 4HO0A 3SUCA 3JUJA 3ZGFA 3VBPA 2Q4JA 1KRUA 3CJ8A 1H5SD 5C3DA 2O1FA 3PKQA 1VM8A 4G3QA 1G9RA 1ZDGA 1MP4A 3D5NA 3NZ2A 1FXJA 1XHBA 1V3WA 1S4PA 1O23B 1KGQA 2VD4A 4ASYA 3FTTA 1WT2A 3D8VA 2FYCB 1FG5N 4HO6A 4Y64A 3N9WA 5FU8A 3U0XA 1VPAA 2OI6A 4UEGA 1TZFA 1KRRA 3ZLLA 1G93A 3KWDA 3I3AA 3GQ9A 4Y7GA 3SRTA 1ZHJA 1G0RA 3VBIA 2WLGA 3SX7A 4M2BA 1TW5A 1KK6A 1ZCUA 5F42A 2QIVX 4FRBA 3FSCA 3T7NA 2P73A 4KNXA 1H7TA 2I5EA 5E3QA 4Y63A 1ZIZA 2OI7A 2XWNA 4XWIA 1TDTA 2IU9A 4IHHA 3EE5A 3EEVA 1Z90A 3GOSA 4KQLA 1W57A 4FQWA 1JYLA 2Y6PA 2JCKA 2VS4A 1LZ0A 3DJ4A 1S4NA 1H7FA 5I1FA 3BSWA 4EEAA 3PNNA 2WGZA 1R80A 5FU0A 1Z2FA 3R1WA 3FSXA 1OMXA 5CQMX 1E5KA 4G87A 1R7XA 4GBPA 1VGZA 2QKXA 3ECTA 3LW6A 3ZF8A 3V90A 2FFVA 2NPOA 3KIAA 4D0TA 4Y7UA 5CMGX 1KK5A 5C1HA 3SPTA 1VZTA 4Y6NA 1ZJ2A 5C8RA 3KWCA 3OTZA 2E3DA 5CMJA 3I0KA 4MFGA 4AC3A 5C4FA 2RIXA 3HL3A 2O1HA 3HSQA 3R5BA 2WLEA 1LZIA 4DE7A 3I0DA 3OH0A 3PKPA 1ZCYA 1ZCTA 3OU9A 5DDTA 3I0IX 1LZ7A 2IC7A 1R82A 3V0MA 4KC4A 3I0FA 3E26A 2V0HA 1VICA 2XMHA 3F1YA 5DDVA 5EIYA 4FRMA 1QQ0A 1EYRA 3U2TA 1JVGA 1OCXA 3CU0A 1TVYA 3SXGA 1ZJ3A 2D7IA 1HV9A 3P1BA 4B2WA 1YP2A 5E3RA 2RITA 2BO8A 3USQA 4KC2A 1J2ZA 1WT1A 1G1LA 1H4DA 2OI5A 4HO5A 1M8NA 4HUSA 2FKOA 1MP3A 5BXCA 1ZJPA 1G3LA 4M98A 1THJA 1SSQA 2X60A 2P6WA 4HO8A 2WLCA 1V82A 2QGIA 2ZU8A 1NKHB 3U2UA 1LXAA 1H5TA 4ARWA 4DCLA 4D48A 1JV3A 4C2SA 4LW3A 2AGDA 3GQ7A 1WT0A 4EA7A 1LL3A 1QWJA 4K6RA 1GA8A 3Q7UA 3TZTA 5C38A 1JV1A 4FCEA 2Z87A 1G95A 5ADXV 2VXLA 1ZJ1A 3DUVA 1NQIB 2Y4MA 4R36A 4B4MA 4IRQA 2NXVA 3JUKA 2VK9A 4FRHA 1FGGA 2X65A 2XWLA 2V0LA 4G3PA 3RSBA 5ADXU 4NAKA 1NHEB 2JCLA 5C4CA 5AJOA 2JCJA 4B3UA 1PZTA 3MQGA 4EAAA 4EGGA 5C3BA 1YP4A 4FIYA 2WAWA 5C4EA 2RJ0A 3TV0A 4LW6A 5IDSA 4ZDQA 1TW1A 5D91A 4E6UA 5DEMA 2Y7AA 2JF3A 3I0CA 4EQYA 4HCQA 4FROA 1K4VA 2PGVA 1R7VA 1L0SA 2V0JA 3OKRA 1MR7A 2ICXA 2XWMA 1QRMA 2ZU7A 2AM3A 3SXDA 5HS2A 1V84A 2Y4KA 2VXMA 4B4BA 4L41C 2RJ8A 4J18A 4AYLA 1FWYA 4MNDA 3VBMA 2QH5A 4EE5A 5AFUV 1FZWA 3BCVA 2VSHA 3V0NA 1S4OA 1LL0A 3I0GA 1KWSA 4N69A 3OW5A 2YCMA 3Q80A 4D11C 2CU2A 3TK8A 1ON8A 1VGUA 5CQNX 4EEMA 1FR8A 3V0QA 1SSTA 4YS8A 5J49A 1H7QA 1I52A 4EABA 4JISA 2YQJA 2QIAA 3BRKX 3R0SA 1VGTA 3FSYA 2VS5A 1R7TA 2FYBA 3OH3A 3OH1A 2XATA 5CQLX 2VFZA 3ZLKA 4AAWA 1O0RA 4EA8A 2YQHA 4MYBA 4R37A 2AESA 3SXEA 5L6SA 3SXBA 1QREA 1ZI4A 5FV9A 5AJNA 3R5DA 3V4EA 2UX8A 1S80A 4IHGA 3BXYA 4KPZA 4HO3A 5CQOA 2AECA 2AM5A 4B4GA 2AM4A 1VH3A 4HZDA 2Y4LA 2ZU9A 3CKNA 1XHDA 1HM0A 3USRA 3F1XA 4P00A 3U2VA 5C4DA 4HZCA 2AH9A 2X5SA 1FRWA 2GGQA 1O7QA 3QVBA 3SXAA 4CVHA 4FRQA 4HURA 2VHEA 2YC5A 1FR9A 3OH2A 1YROB 3V0LA 4ASJA 1IINA 2J0AA 4FRPA 2VS3A 2MZBA 2E8BA 3U0YA 2WEEA 3EH0A 4FRLA 1G23A 1NMMB 2DPWA 4ISXA 2C0NA 1ON6A 1R7YA 2W0WA 1H5RB 1PZYB 3NGWA 4E1KA 4M99A 1H5TB 4B5BA 2D7RA 1GX4A 3VBKA 4KRVA 5EJZA 3IOJA 4DDZA 5FUHA 1H5RA 4O6MA 4NANA 3V8ZA 4EE3A 2I7BA 2BO7A 5CMIA 2Y4JA 5U2KA 3JQYA 2WVKA 4HO9A 4B2XA 1ZI1A 2JCOA 5FTSA 4KXOA 5D92A 5C1GA 1FXOA 2JF2A 3FSBA 2RJ6A 4FCUA 1EWWA 2GGOA 1QGSA 3E25A 5IDTA 4N27A 2FFUA 1H4CA 1H5SA 3VBNA 1INIA 1T3DA 1R81A 4Y7TA 4O6NA 3O3PA 3IXCA 2TDTA 1G2VA 4HG6A 3GQAA 4HO2A 3SX3A 1MP5A 4Y7VA 1HJJA 4Y7FA 1V67A 4D0ZA 3FS8A 5C36A 2OEFA 3BSSA 4Y9XA 2WLDA 5C3AA 4EEGA 1GX0A 3I0LA 2RJ1A 3V0PA 1VZXA 2Z86A 3RMVA 2O1GA 4EEOA 1GWWA 1G97A 1SSMA 3CGXA 1H5SC 2WLFA 4D11A 2VSIA 3DK5A 1W77A 3Q4SA 5CQPA 1IIMA 2PA4A 3V8YA 2RJ5A 1QRGA 3D98A 1JVDA 3I0EA 1GWVA 1NF5B 3GUEA 1WT3A 3MQHA 4BQHA 2OEGA 4KC1A 4M2AA 3GVDA 2PGYA 4FREA 2FYAA 3U2WA 5IFYA 4FIXA 3TDTA 5C47A 3TIOA 4HOCA 3Q1XA 5FYEA 2IUAA 1QG8A 5FTVA 5C4BA 2A8UA 3KWEA 1GQ9A 3ST8A 4ECMA 4E6TA 4DECA 4BMAA 3R5AA 4AA7A 1KK4A 1ZJ0A 1H7LA 3P47A 3R5CA 1KGTA 4FRDA 3OH4A 3V0OA 3T7MA 2XMEA 2J0BA 2YQCA 1FO8A 5AFUU 3JTJA 4R7PA 3CKVA 4EA9A 4JD0A 3I0JA 4NAIA 2RIZA 4EE4A 4P02A 4MYOA 1NWGB 1WSZA 5AJPA 4IHFA 2I5KA 3C8VA 1G8OA 3SX8A 1H4EA 1KQAA 1ZCVA 1LZJA 3OC9A 3CKJA 1HJLA 3POLA 3BSYA 1ZI5A 1LL2A 2WE9A 1OMZA 4M28A 1ZDFA 5JQQA 1QRLA 2W0VA 2RJ7A 2V0IA 5DG3A 4H7OA 1QRFA 1KHRA 4MZUA 4N6AA 4KT7A 2IU8A 1MC3A 1INJA 1SS9A 3I0HA 4Y6UA 5EJ1A 4NALA 3FWWA 1JYKA 2D0JA 3VNPA 3OGZA 3BFPA 3T57A 1EZIA 3SX5A 4J09A 1FGXA 1MRLA 2YQSA 1XATA 4KPXA 1HM9A 3CKOA 1ZI3A 4IRPA 4CJBA 3HJJA 5C1LA 3RMWA 2AQ9A 3TQDA 1LVWA 5DEPA 3R8YA 1MR9A 2V0KA 3PMOA 1KRVA 3CKQA 1GQCA 3OAMA 3T7OA 3IGJA 5E3PA 2X5ZA 5CMHA 1VZUA 2WVLA 3GQ8A 2YC3A 4E75A 3TWDA 3R2WA 3V91A 4MIXA 2WVMA 4CJ8A 4CJCA 1OQMB 3FOQA 4N6BA 2P2OA 2RIYA 3K8EA 4M4KA
chains in the Genus database with same CATH topology
3VBJA 2YESA 4Y62A 3SXCA 3U2XA 1HM8A 1H5SB 1W55A 2RJ9A 5CMFX 3MC4A 2APCA 2FY7A 1XZ6A 4E79A 1FOAA 4KNRA 3K8DA 3R3IA 3I3XA 1H7HA 4B42A 4EVWA 5C48A 1ZJOA 3TISA 1H3MA 1FO9A 4Q7CA 1H7GA 3EG4A 3IOIA 2BO4A 2RIJA 4M9CA 1VGWA 3ZGGA 4AYJA 3IOHA 2AE7A 1VH1A 4FRAA 1V83A 3VBLA 5C49A 4HO4A 1O7OA 3OTMA 2FYDB 2RJ4A 3OUPA 1QGQA 5L6VA 2BO6A 4G3SA 1YP3A 3R3RA 3DHOA 2ICYA 1WVCA 2P72A 2PX7A 3F1CA 1H7EA 1R7UA 2A8WA 4HO0A 3JUJA 3ZGFA 3VBPA 2Q4JA 1KRUA 3CJ8A 1H5SD 5C3DA 2O1FA 3PKQA 1VM8A 4G3QA 1G9RA 1ZDGA 1MP4A 3D5NA 3NZ2A 1FXJA 1XHBA 1V3WA 1S4PA 1O23B 1KGQA 2VD4A 4ASYA 3FTTA 1WT2A 3D8VA 2FYCB 1FG5N 4HO6A 4Y64A 3N9WA 5FU8A 3U0XA 1VPAA 2OI6A 4UEGA 1TZFA 1KRRA 3ZLLA 1G93A 3KWDA 3I3AA 4Y7GA 3SRTA 1ZHJA 1G0RA 3VBIA 2WLGA 3SX7A 4M2BA 1TW5A 1KK6A 1ZCUA 5F42A 2QIVX 4FRBA 3FSCA 3T7NA 2P73A 4KNXA 1H7TA 2I5EA 5E3QA 4Y63A 1ZIZA 2OI7A 2XWNA 4XWIA 1TDTA 2IU9A 4IHHA 3EE5A 3EEVA 1Z90A 3GOSA 4KQLA 1W57A 4FQWA 1JYLA 2Y6PA 2JCKA 2VS4A 1LZ0A 3DJ4A 1S4NA 1H7FA 5I1FA 3BSWA 4EEAA 3PNNA 2WGZA 1R80A 5FU0A 3R1WA 3FSXA 1OMXA 5CQMX 1E5KA 4G87A 1R7XA 4GBPA 1VGZA 2QKXA 3ECTA 3LW6A 3ZF8A 3V90A 2FFVA 2NPOA 3KIAA 4D0TA 4Y7UA 5CMGX 1KK5A 5C1HA 3SPTA 1VZTA 4Y6NA 1ZJ2A 5C8RA 3KWCA 3OTZA 2E3DA 5CMJA 3I0KA 4MFGA 4AC3A 5C4FA 2RIXA 3HL3A 2O1HA 3HSQA 3R5BA 2WLEA 1LZIA 4DE7A 3I0DA 3OH0A 3PKPA 1ZCYA 1ZCTA 3OU9A 5DDTA 3I0IX 1LZ7A 2IC7A 1R82A 3V0MA 4KC4A 3I0FA 3E26A 2V0HA 1VICA 2XMHA 3F1YA 5DDVA 5EIYA 4FRMA 1QQ0A 1EYRA 3U2TA 1JVGA 1OCXA 3CU0A 1TVYA 3SXGA 1ZJ3A 2D7IA 1HV9A 3P1BA 4B2WA 1YP2A 5E3RA 2RITA 2BO8A 3USQA 4KC2A 1J2ZA 1WT1A 1G1LA 1H4DA 2OI5A 4HO5A 4HUSA 1MP3A 2FKOA 5BXCA 1ZJPA 1G3LA 4M98A 1THJA 1SSQA 2X60A 2P6WA 4HO8A 2WLCA 1V82A 2QGIA 2ZU8A 1NKHB 3U2UA 1LXAA 1H5TA 4ARWA 4DCLA 4D48A 1JV3A 4C2SA 4LW3A 2AGDA 1WT0A 4EA7A 1LL3A 1QWJA 4K6RA 1GA8A 3Q7UA 3TZTA 5C38A 1JV1A 4FCEA 2Z87A 1G95A 5ADXV 2VXLA 1ZJ1A 3DUVA 1NQIB 2Y4MA 4R36A 4B4MA 4IRQA 2NXVA 3JUKA 2VK9A 4FRHA 1FGGA 2X65A 2XWLA 2V0LA 4G3PA 3RSBA 5ADXU 4NAKA 1NHEB 2JCLA 5C4CA 5AJOA 2JCJA 4B3UA 1PZTA 3MQGA 4EAAA 4EGGA 5C3BA 1YP4A 4FIYA 2WAWA 5C4EA 2RJ0A 3TV0A 4LW6A 5IDSA 4ZDQA 1TW1A 5D91A 4E6UA 5DEMA 2Y7AA 2JF3A 3I0CA 4EQYA 4HCQA 4FROA 1K4VA 2PGVA 1R7VA 2V0JA 3OKRA 1MR7A 2ICXA 2XWMA 1QRMA 2ZU7A 2AM3A 3SXDA 5HS2A 1V84A 2Y4KA 2VXMA 4B4BA 4L41C 2RJ8A 4J18A 4AYLA 1FWYA 4MNDA 3VBMA 2QH5A 4EE5A 5AFUV 1FZWA 3BCVA 2VSHA 3V0NA 1S4OA 1LL0A 3I0GA 1KWSA 4N69A 3OW5A 2YCMA 3Q80A 4D11C 2CU2A 3TK8A 1ON8A 1VGUA 5CQNX 4EEMA 1FR8A 3V0QA 1SSTA 4YS8A 5J49A 1H7QA 1I52A 4EABA 4JISA 2YQJA 2QIAA 3BRKX 3R0SA 1VGTA 3FSYA 2VS5A 1R7TA 2FYBA 3OH3A 3OH1A 2XATA 5CQLX 2VFZA 3ZLKA 4AAWA 1O0RA 4EA8A 2YQHA 4MYBA 4R37A 2AESA 3SXEA 5L6SA 3SXBA 1QREA 1ZI4A 5FV9A 5AJNA 3R5DA 3V4EA 2UX8A 1S80A 4IHGA 3BXYA 4KPZA 4HO3A 5CQOA 2AECA 2AM5A 4B4GA 2AM4A 1VH3A 4HZDA 2Y4LA 2ZU9A 3CKNA 1XHDA 1HM0A 3USRA 3F1XA 4P00A 3U2VA 5C4DA 4HZCA 2AH9A 2X5SA 1FRWA 2GGQA 1O7QA 3QVBA 3SXAA 4CVHA 4FRQA 4HURA 2VHEA 2YC5A 1FR9A 3OH2A 1YROB 3V0LA 4ASJA 1IINA 2J0AA 4FRPA 2VS3A 2MZBA 2E8BA 3U0YA 2WEEA 3EH0A 4FRLA 1G23A 1NMMB 2DPWA 4ISXA 2C0NA 1ON6A 1R7YA 2W0WA 1H5RB 1PZYB 3NGWA 4E1KA 4M99A 1H5TB 4B5BA 2D7RA 1GX4A 3VBKA 4KRVA 5EJZA 3IOJA 4DDZA 5FUHA 1H5RA 4O6MA 4NANA 3V8ZA 4EE3A 2I7BA 2BO7A 5CMIA 2Y4JA 5U2KA 3JQYA 2WVKA 4HO9A 4B2XA 1ZI1A 2JCOA 5FTSA 4KXOA 5D92A 5C1GA 1FXOA 2JF2A 3FSBA 2RJ6A 4FCUA 2GGOA 1QGSA 3E25A 5IDTA 4N27A 2FFUA 1H4CA 1H5SA 3VBNA 1INIA 1T3DA 1R81A 4Y7TA 4O6NA 3O3PA 3IXCA 2TDTA 1G2VA 4HG6A 4HO2A 3SX3A 1MP5A 4Y7VA 1HJJA 4Y7FA 1V67A 4D0ZA 3FS8A 5C36A 2OEFA 3BSSA 4Y9XA 2WLDA 5C3AA 4EEGA 1GX0A 3I0LA 2RJ1A 3V0PA 1VZXA 2Z86A 3RMVA 2O1GA 4EEOA 1GWWA 1G97A 1SSMA 3CGXA 1H5SC 2WLFA 4D11A 2VSIA 3DK5A 1W77A 3Q4SA 5CQPA 1IIMA 2PA4A 3V8YA 2RJ5A 1QRGA 3D98A 1JVDA 3I0EA 1GWVA 1NF5B 3GUEA 1WT3A 3MQHA 4BQHA 2OEGA 4KC1A 4M2AA 3GVDA 2PGYA 4FREA 2FYAA 3U2WA 5IFYA 4FIXA 3TDTA 5C47A 3TIOA 4HOCA 3Q1XA 5FYEA 2IUAA 1QG8A 5FTVA 5C4BA 2A8UA 3KWEA 1GQ9A 3ST8A 4ECMA 4E6TA 4DECA 4BMAA 3R5AA 4AA7A 1KK4A 1ZJ0A 1H7LA 3P47A 3R5CA 1KGTA 4FRDA 3OH4A 3V0OA 3T7MA 2XMEA 2J0BA 2YQCA 1FO8A 5AFUU 3JTJA 4R7PA 3CKVA 4EA9A 4JD0A 3I0JA 4NAIA 2RIZA 4EE4A 4P02A 4MYOA 1NWGB 1WSZA 5AJPA 4IHFA 2I5KA 3C8VA 1G8OA 3SX8A 1H4EA 1KQAA 1ZCVA 1LZJA 3OC9A 3CKJA 1HJLA 3POLA 3BSYA 1ZI5A 1LL2A 2WE9A 1OMZA 4M28A 1ZDFA 5JQQA 1QRLA 2W0VA 2RJ7A 2V0IA 5DG3A 4H7OA 1QRFA 1KHRA 4MZUA 4N6AA 4KT7A 2IU8A 1MC3A 1INJA 1SS9A 3I0HA 4Y6UA 5EJ1A 4NALA 3FWWA 1JYKA 2D0JA 3VNPA 3OGZA 3BFPA 3T57A 1EZIA 3SX5A 4J09A 1FGXA 1MRLA 2YQSA 1XATA 4KPXA 1HM9A 3CKOA 1ZI3A 4IRPA 4CJBA 3HJJA 5C1LA 3RMWA 2AQ9A 3TQDA 1LVWA 5DEPA 3R8YA 1MR9A 2V0KA 3PMOA 1KRVA 3CKQA 1GQCA 3OAMA 3T7OA 3IGJA 5E3PA 2X5ZA 5CMHA 1VZUA 2WVLA 2YC3A 4E75A 3TWDA 3R2WA 3V91A 4MIXA 2WVMA 4CJ8A 4CJCA 1OQMB 3FOQA 4N6BA 2P2OA 2RIYA 3K8EA 4M4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VBJ A;  2YES A;  4Y62 A;  3SXC A;  3U2X A;  1HM8 A;  1H5S B;  1W55 A;  2RJ9 A;  5CMF X;  3MC4 A;  2APC A;  2FY7 A;  1XZ6 A;  4E79 A;  1FOA A;  4KNR A;  3K8D A;  3R3I A;  3I3X A;  1H7H A;  4B42 A;  4EVW A;  5C48 A;  1ZJO A;  3TIS A;  1H3M A;  1FO9 A;  1H7G A;  3EG4 A;  3IOI A;  2BO4 A;  2RIJ A;  4M9C A;  1VGW A;  3ZGG A;  4AYJ A;  3IOH A;  2AE7 A;  1VH1 A;  4FRA A;  1V83 A;  3VBL A;  5C49 A;  4HO4 A;  1O7O A;  3OTM A;  2FYD B;  2RJ4 A;  3OUP A;  1QGQ A;  5L6V A;  2BO6 A;  4G3S A;  1YP3 A;  3R3R A;  3DHO A;  2ICY A;  1WVC A;  2P72 A;  2PX7 A;  3F1C A;  1H7E A;  1R7U A;  2A8W A;  4HO0 A;  3JUJ A;  3ZGF A;  3VBP A;  2Q4J A;  1KRU A;  3CJ8 A;  1H5S D;  5C3D A;  2O1F A;  3PKQ A;  1VM8 A;  4G3Q A;  1G9R A;  1ZDG A;  1MP4 A;  3D5N A;  3NZ2 A;  1FXJ A;  1XHB A;  1V3W A;  1S4P A;  1O23 B;  1KGQ A;  2VD4 A;  4ASY A;  3FTT A;  1WT2 A;  3D8V A;  2FYC B;  1FG5 N;  4HO6 A;  4Y64 A;  3N9W A;  5FU8 A;  3U0X A;  1VPA A;  2OI6 A;  4UEG A;  1TZF A;  1KRR A;  3ZLL A;  1G93 A;  3KWD A;  3I3A A;  4Y7G A;  3SRT A;  1ZHJ A;  1G0R A;  3VBI A;  2WLG A;  3SX7 A;  4M2B A;  1TW5 A;  1KK6 A;  1ZCU A;  5F42 A;  2QIV X;  4FRB A;  3FSC A;  3T7N A;  2P73 A;  4KNX A;  1H7T A;  2I5E A;  5E3Q A;  4Y63 A;  1ZIZ A;  2OI7 A;  2XWN A;  4XWI A;  1TDT A;  2IU9 A;  4IHH A;  3EE5 A;  3EEV A;  1Z90 A;  3GOS A;  4KQL A;  1W57 A;  4FQW A;  1JYL A;  2Y6P A;  2JCK A;  2VS4 A;  1LZ0 A;  3DJ4 A;  1S4N A;  1H7F A;  5I1F A;  3BSW A;  4EEA A;  3PNN A;  2WGZ A;  1R80 A;  5FU0 A;  3R1W A;  3FSX A;  1OMX A;  5CQM X;  1E5K A;  4G87 A;  1R7X A;  4GBP A;  1VGZ A;  2QKX A;  3ECT A;  3LW6 A;  3ZF8 A;  3V90 A;  2FFV A;  2NPO A;  3KIA A;  4D0T A;  4Y7U A;  5CMG X;  1KK5 A;  5C1H A;  3SPT A;  1VZT A;  4Y6N A;  1ZJ2 A;  5C8R A;  3KWC A;  3OTZ A;  2E3D A;  5CMJ A;  3I0K A;  4MFG A;  4AC3 A;  5C4F A;  2RIX A;  3HL3 A;  2O1H A;  3HSQ A;  3R5B A;  2WLE A;  1LZI A;  4DE7 A;  3I0D A;  3OH0 A;  3PKP A;  1ZCY A;  1ZCT A;  3OU9 A;  5DDT A;  3I0I X;  1LZ7 A;  2IC7 A;  1R82 A;  3V0M A;  4KC4 A;  3I0F A;  3E26 A;  2V0H A;  1VIC A;  2XMH A;  3F1Y A;  5DDV A;  5EIY A;  4FRM A;  1QQ0 A;  1EYR A;  3U2T A;  1JVG A;  1OCX A;  3CU0 A;  1TVY A;  3SXG A;  1ZJ3 A;  2D7I A;  1HV9 A;  3P1B A;  4B2W A;  1YP2 A;  5E3R A;  2RIT A;  2BO8 A;  3USQ A;  4KC2 A;  1J2Z A;  1WT1 A;  1G1L A;  1H4D A;  2OI5 A;  4HO5 A;  4HUS A;  1MP3 A;  2FKO A;  5BXC A;  1ZJP A;  1G3L A;  4M98 A;  1THJ A;  1SSQ A;  2X60 A;  2P6W A;  4HO8 A;  2WLC A;  1V82 A;  2QGI A;  2ZU8 A;  1NKH B;  3U2U A;  1LXA A;  1H5T A;  4ARW A;  4DCL A;  4D48 A;  1JV3 A;  4C2S A;  4LW3 A;  2AGD A;  1WT0 A;  4EA7 A;  1LL3 A;  1QWJ A;  4K6R A;  1GA8 A;  3Q7U A;  3TZT A;  5C38 A;  1JV1 A;  4FCE A;  2Z87 A;  1G95 A;  5ADX V;  2VXL A;  1ZJ1 A;  3DUV A;  1NQI B;  2Y4M A;  4R36 A;  4B4M A;  4IRQ A;  2NXV A;  3JUK A;  4FRH A;  1FGG A;  2X65 A;  2XWL A;  2V0L A;  4G3P A;  3RSB A;  5ADX U;  4NAK A;  1NHE B;  2JCL A;  5C4C A;  5AJO A;  2JCJ A;  4B3U A;  1PZT A;  3MQG A;  4EAA A;  4EGG A;  5C3B A;  1YP4 A;  5C4E A;  2WAW A;  2RJ0 A;  3TV0 A;  4LW6 A;  5IDS A;  4ZDQ A;  1TW1 A;  4E6U A;  5DEM A;  2Y7A A;  2JF3 A;  3I0C A;  4EQY A;  4HCQ A;  4FRO A;  1K4V A;  2PGV A;  1R7V A;  2V0J A;  3OKR A;  1MR7 A;  2ICX A;  2XWM A;  1QRM A;  2ZU7 A;  2AM3 A;  3SXD A;  5HS2 A;  1V84 A;  2Y4K A;  2VXM A;  4B4B A;  4L41 C;  2RJ8 A;  4J18 A;  4AYL A;  1FWY A;  4MND A;  3VBM A;  2QH5 A;  4EE5 A;  5AFU V;  1FZW A;  3BCV A;  2VSH A;  3V0N A;  1S4O A;  1LL0 A;  3I0G A;  1KWS A;  4N69 A;  3OW5 A;  2YCM A;  3Q80 A;  4D11 C;  2CU2 A;  3TK8 A;  1ON8 A;  1VGU A;  5CQN X;  4EEM A;  1FR8 A;  3V0Q A;  1SST A;  4YS8 A;  5J49 A;  1H7Q A;  1I52 A;  4EAB A;  4JIS A;  2YQJ A;  2QIA A;  3BRK X;  3R0S A;  1VGT A;  3FSY A;  2VS5 A;  1R7T A;  2FYB A;  3OH3 A;  3OH1 A;  2XAT A;  5CQL X;  2VFZ A;  3ZLK A;  4AAW A;  1O0R A;  4EA8 A;  2YQH A;  4MYB A;  4R37 A;  2AES A;  3SXE A;  5L6S A;  3SXB A;  1QRE A;  1ZI4 A;  5FV9 A;  5AJN A;  3R5D A;  3V4E A;  2UX8 A;  1S80 A;  4IHG A;  3BXY A;  4KPZ A;  4HO3 A;  5CQO A;  2AEC A;  2AM5 A;  4B4G A;  2AM4 A;  1VH3 A;  4HZD A;  2Y4L A;  2ZU9 A;  3CKN A;  1XHD A;  1HM0 A;  3USR A;  3F1X A;  4P00 A;  3U2V A;  5C4D A;  4HZC A;  2AH9 A;  2X5S A;  1FRW A;  2GGQ A;  1O7Q A;  3QVB A;  3SXA A;  4CVH A;  4FRQ A;  4HUR A;  2VHE A;  2YC5 A;  1FR9 A;  3OH2 A;  1YRO B;  3V0L A;  4ASJ A;  1IIN A;  4FRP A;  2VS3 A;  2MZB A;  2E8B A;  3U0Y A;  2WEE A;  3EH0 A;  4FRL A;  1G23 A;  1NMM B;  2DPW A;  4ISX A;  1ON6 A;  1R7Y A;  2W0W A;  1H5R B;  1PZY B;  3NGW A;  4E1K A;  4M99 A;  1H5T B;  4B5B A;  2D7R A;  1GX4 A;  3VBK A;  4KRV A;  5EJZ A;  3IOJ A;  4DDZ A;  5FUH A;  1H5R A;  4NAN A;  3V8Z A;  4EE3 A;  2I7B A;  2BO7 A;  5CMI A;  2Y4J A;  5U2K A;  3JQY A;  2WVK A;  4HO9 A;  4B2X A;  1ZI1 A;  2JCO A;  5FTS A;  4KXO A;  5C1G A;  1FXO A;  2JF2 A;  3FSB A;  2RJ6 A;  4FCU A;  2GGO A;  1QGS A;  3E25 A;  5IDT A;  4N27 A;  2FFU A;  1H4C A;  1H5S A;  3VBN A;  1INI A;  1T3D A;  1R81 A;  4Y7T A;  3O3P A;  3IXC A;  2TDT A;  1G2V A;  4HG6 A;  4HO2 A;  3SX3 A;  1MP5 A;  4Y7V A;  1HJJ A;  4Y7F A;  1V67 A;  4D0Z A;  3FS8 A;  5C36 A;  2OEF A;  3BSS A;  4Y9X A;  2WLD A;  5C3A A;  4EEG A;  1GX0 A;  3I0L A;  2RJ1 A;  3V0P A;  1VZX A;  2Z86 A;  3RMV A;  2O1G A;  4EEO A;  1GWW A;  1G97 A;  1SSM A;  3CGX A;  1H5S C;  2WLF A;  4D11 A;  2VSI A;  3DK5 A;  1W77 A;  3Q4S A;  5CQP A;  1IIM A;  2PA4 A;  3V8Y A;  2RJ5 A;  1QRG A;  3D98 A;  1JVD A;  3I0E A;  1GWV A;  1NF5 B;  3GUE A;  1WT3 A;  3MQH A;  4BQH A;  2OEG A;  4KC1 A;  4M2A A;  3GVD A;  2PGY A;  4FRE A;  2FYA A;  3U2W A;  5IFY A;  3TDT A;  5C47 A;  3TIO A;  4HOC A;  3Q1X A;  5FYE A;  2IUA A;  1QG8 A;  5FTV A;  5C4B A;  2A8U A;  3KWE A;  1GQ9 A;  3ST8 A;  4ECM A;  4E6T A;  4DEC A;  4BMA A;  3R5A A;  4AA7 A;  1KK4 A;  1ZJ0 A;  1H7L A;  3P47 A;  3R5C A;  1KGT A;  4FRD A;  3OH4 A;  3V0O A;  3T7M A;  2XME A;  2YQC A;  1FO8 A;  5AFU U;  3JTJ A;  4R7P A;  3CKV A;  4EA9 A;  4JD0 A;  3I0J A;  4NAI A;  2RIZ A;  4EE4 A;  4P02 A;  4MYO A;  1NWG B;  1WSZ A;  5AJP A;  4IHF A;  2I5K A;  3C8V A;  1G8O A;  3SX8 A;  1H4E A;  1KQA A;  1ZCV A;  1LZJ A;  3OC9 A;  3CKJ A;  1HJL A;  3POL A;  3BSY A;  1ZI5 A;  1LL2 A;  2WE9 A;  1OMZ A;  4M28 A;  1ZDF A;  5JQQ A;  1QRL A;  2W0V A;  2RJ7 A;  2V0I A;  5DG3 A;  4H7O A;  1QRF A;  1KHR A;  4MZU A;  4N6A A;  4KT7 A;  2IU8 A;  1MC3 A;  1INJ A;  1SS9 A;  3I0H A;  4Y6U A;  5EJ1 A;  4NAL A;  3FWW A;  1JYK A;  2D0J A;  3VNP A;  3OGZ A;  3BFP A;  3T57 A;  1EZI A;  3SX5 A;  4J09 A;  1FGX A;  1MRL A;  2YQS A;  1XAT A;  4KPX A;  1HM9 A;  3CKO A;  1ZI3 A;  4IRP A;  4CJB A;  3HJJ A;  5C1L A;  3RMW A;  2AQ9 A;  3TQD A;  1LVW A;  5DEP A;  3R8Y A;  1MR9 A;  2V0K A;  3PMO A;  1KRV A;  3CKQ A;  1GQC A;  3OAM A;  3T7O A;  3IGJ A;  5E3P A;  2X5Z A;  5CMH A;  1VZU A;  2WVL A;  2YC3 A;  4E75 A;  3TWD A;  3R2W A;  3V91 A;  4CJ8 A;  2WVM A;  4CJC A;  1OQM B;  3FOQ A;  4N6B A;  2P2O A;  2RIY A;  3K8E A;  4M4K A; 
#chains in the Genus database with same CATH topology
 3VBJ A;  2YES A;  4Y62 A;  3SXC A;  3U2X A;  1HM8 A;  1H5S B;  1W55 A;  2RJ9 A;  5CMF X;  3MC4 A;  2APC A;  2FY7 A;  1XZ6 A;  4E79 A;  1FOA A;  4KNR A;  3K8D A;  3R3I A;  3I3X A;  1H7H A;  4B42 A;  4EVW A;  5C48 A;  1ZJO A;  3TIS A;  1H3M A;  1FO9 A;  4Q7C A;  1H7G A;  3EG4 A;  3IOI A;  2BO4 A;  2RIJ A;  4M9C A;  1VGW A;  3ZGG A;  4AYJ A;  3IOH A;  2AE7 A;  1VH1 A;  1N4I A;  4FRA A;  1V83 A;  3VBL A;  5C49 A;  4HO4 A;  1O7O A;  3OTM A;  2FYD B;  2RJ4 A;  3OUP A;  1QGQ A;  5L6V A;  2BO6 A;  4G3S A;  1YP3 A;  3R3R A;  3DHO A;  2ICY A;  1WVC A;  2P72 A;  2PX7 A;  3F1C A;  1H7E A;  1R7U A;  2A8W A;  4HO0 A;  3SUC A;  3JUJ A;  3ZGF A;  3VBP A;  2Q4J A;  1KRU A;  3CJ8 A;  1H5S D;  5C3D A;  2O1F A;  3PKQ A;  1VM8 A;  4G3Q A;  1G9R A;  1ZDG A;  1MP4 A;  3D5N A;  3NZ2 A;  1FXJ A;  1XHB A;  1V3W A;  1S4P A;  1O23 B;  1KGQ A;  2VD4 A;  4ASY A;  3FTT A;  1WT2 A;  3D8V A;  2FYC B;  1FG5 N;  4HO6 A;  4Y64 A;  3N9W A;  5FU8 A;  3U0X A;  1VPA A;  2OI6 A;  4UEG A;  1TZF A;  1KRR A;  3ZLL A;  1G93 A;  3KWD A;  3I3A A;  3GQ9 A;  4Y7G A;  3SRT A;  1ZHJ A;  1G0R A;  3VBI A;  2WLG A;  3SX7 A;  4M2B A;  1TW5 A;  1KK6 A;  1ZCU A;  5F42 A;  2QIV X;  4FRB A;  3FSC A;  3T7N A;  2P73 A;  4KNX A;  1H7T A;  2I5E A;  5E3Q A;  4Y63 A;  1ZIZ A;  2OI7 A;  2XWN A;  4XWI A;  1TDT A;  2IU9 A;  4IHH A;  3EE5 A;  3EEV A;  1Z90 A;  3GOS A;  4KQL A;  1W57 A;  4FQW A;  1JYL A;  2Y6P A;  2JCK A;  2VS4 A;  1LZ0 A;  3DJ4 A;  1S4N A;  1H7F A;  5I1F A;  3BSW A;  4EEA A;  3PNN A;  2WGZ A;  1R80 A;  5FU0 A;  1Z2F A;  3R1W A;  3FSX A;  1OMX A;  5CQM X;  1E5K A;  4G87 A;  1R7X A;  4GBP A;  1VGZ A;  2QKX A;  3ECT A;  3LW6 A;  3ZF8 A;  3V90 A;  2FFV A;  2NPO A;  3KIA A;  4D0T A;  4Y7U A;  5CMG X;  1KK5 A;  5C1H A;  3SPT A;  1VZT A;  4Y6N A;  1ZJ2 A;  5C8R A;  3KWC A;  3OTZ A;  2E3D A;  5CMJ A;  3I0K A;  4MFG A;  4AC3 A;  5C4F A;  2RIX A;  3HL3 A;  2O1H A;  3HSQ A;  3R5B A;  2WLE A;  1LZI A;  4DE7 A;  3I0D A;  3OH0 A;  3PKP A;  1ZCY A;  1ZCT A;  3OU9 A;  5DDT A;  3I0I X;  1LZ7 A;  2IC7 A;  1R82 A;  3V0M A;  4KC4 A;  3I0F A;  3E26 A;  2V0H A;  1VIC A;  2XMH A;  3F1Y A;  5DDV A;  5EIY A;  4FRM A;  1QQ0 A;  1EYR A;  3U2T A;  1JVG A;  1OCX A;  3CU0 A;  1TVY A;  3SXG A;  1ZJ3 A;  2D7I A;  1HV9 A;  3P1B A;  4B2W A;  1YP2 A;  5E3R A;  2RIT A;  2BO8 A;  3USQ A;  4KC2 A;  1J2Z A;  1WT1 A;  1G1L A;  1H4D A;  2OI5 A;  4HO5 A;  1M8N A;  4HUS A;  2FKO A;  1MP3 A;  5BXC A;  1ZJP A;  1G3L A;  4M98 A;  1THJ A;  1SSQ A;  2X60 A;  2P6W A;  4HO8 A;  2WLC A;  1V82 A;  2QGI A;  2ZU8 A;  1NKH B;  3U2U A;  1LXA A;  1H5T A;  4ARW A;  4DCL A;  4D48 A;  1JV3 A;  4C2S A;  4LW3 A;  2AGD A;  3GQ7 A;  1WT0 A;  4EA7 A;  1LL3 A;  1QWJ A;  4K6R A;  1GA8 A;  3Q7U A;  3TZT A;  5C38 A;  1JV1 A;  4FCE A;  2Z87 A;  1G95 A;  5ADX V;  2VXL A;  1ZJ1 A;  3DUV A;  1NQI B;  2Y4M A;  4R36 A;  4B4M A;  4IRQ A;  2NXV A;  3JUK A;  2VK9 A;  4FRH A;  1FGG A;  2X65 A;  2XWL A;  2V0L A;  4G3P A;  3RSB A;  5ADX U;  4NAK A;  1NHE B;  2JCL A;  5C4C A;  5AJO A;  2JCJ A;  4B3U A;  1PZT A;  3MQG A;  4EAA A;  4EGG A;  5C3B A;  1YP4 A;  4FIY A;  2WAW A;  5C4E A;  2RJ0 A;  3TV0 A;  4LW6 A;  5IDS A;  4ZDQ A;  1TW1 A;  5D91 A;  4E6U A;  5DEM A;  2Y7A A;  2JF3 A;  3I0C A;  4EQY A;  4HCQ A;  4FRO A;  1K4V A;  2PGV A;  1R7V A;  1L0S A;  2V0J A;  3OKR A;  1MR7 A;  2ICX A;  2XWM A;  1QRM A;  2ZU7 A;  2AM3 A;  3SXD A;  5HS2 A;  1V84 A;  2Y4K A;  2VXM A;  4B4B A;  4L41 C;  2RJ8 A;  4J18 A;  4AYL A;  1FWY A;  4MND A;  3VBM A;  2QH5 A;  4EE5 A;  5AFU V;  1FZW A;  3BCV A;  2VSH A;  3V0N A;  1S4O A;  1LL0 A;  3I0G A;  1KWS A;  4N69 A;  3OW5 A;  2YCM A;  3Q80 A;  4D11 C;  2CU2 A;  3TK8 A;  1ON8 A;  1VGU A;  5CQN X;  4EEM A;  1FR8 A;  3V0Q A;  1SST A;  4YS8 A;  5J49 A;  1H7Q A;  1I52 A;  4EAB A;  4JIS A;  2YQJ A;  2QIA A;  3BRK X;  3R0S A;  1VGT A;  3FSY A;  2VS5 A;  1R7T A;  2FYB A;  3OH3 A;  3OH1 A;  2XAT A;  5CQL X;  2VFZ A;  3ZLK A;  4AAW A;  1O0R A;  4EA8 A;  2YQH A;  4MYB A;  4R37 A;  2AES A;  3SXE A;  5L6S A;  3SXB A;  1QRE A;  1ZI4 A;  5FV9 A;  5AJN A;  3R5D A;  3V4E A;  2UX8 A;  1S80 A;  4IHG A;  3BXY A;  4KPZ A;  4HO3 A;  5CQO A;  2AEC A;  2AM5 A;  4B4G A;  2AM4 A;  1VH3 A;  4HZD A;  2Y4L A;  2ZU9 A;  3CKN A;  1XHD A;  1HM0 A;  3USR A;  3F1X A;  4P00 A;  3U2V A;  5C4D A;  4HZC A;  2AH9 A;  2X5S A;  1FRW A;  2GGQ A;  1O7Q A;  3QVB A;  3SXA A;  4CVH A;  4FRQ A;  4HUR A;  2VHE A;  2YC5 A;  1FR9 A;  3OH2 A;  1YRO B;  3V0L A;  4ASJ A;  1IIN A;  2J0A A;  4FRP A;  2VS3 A;  2MZB A;  2E8B A;  3U0Y A;  2WEE A;  3EH0 A;  4FRL A;  1G23 A;  1NMM B;  2DPW A;  4ISX A;  2C0N A;  1ON6 A;  1R7Y A;  2W0W A;  1H5R B;  1PZY B;  3NGW A;  4E1K A;  4M99 A;  1H5T B;  4B5B A;  2D7R A;  1GX4 A;  3VBK A;  4KRV A;  5EJZ A;  3IOJ A;  4DDZ A;  5FUH A;  1H5R A;  4O6M A;  4NAN A;  3V8Z A;  4EE3 A;  2I7B A;  2BO7 A;  5CMI A;  2Y4J A;  5U2K A;  3JQY A;  2WVK A;  4HO9 A;  4B2X A;  1ZI1 A;  2JCO A;  5FTS A;  4KXO A;  5D92 A;  5C1G A;  1FXO A;  2JF2 A;  3FSB A;  2RJ6 A;  4FCU A;  1EWW A;  2GGO A;  1QGS A;  3E25 A;  5IDT A;  4N27 A;  2FFU A;  1H4C A;  1H5S A;  3VBN A;  1INI A;  1T3D A;  1R81 A;  4Y7T A;  4O6N A;  3O3P A;  3IXC A;  2TDT A;  1G2V A;  4HG6 A;  3GQA A;  4HO2 A;  3SX3 A;  1MP5 A;  4Y7V A;  1HJJ A;  4Y7F A;  1V67 A;  4D0Z A;  3FS8 A;  5C36 A;  2OEF A;  3BSS A;  4Y9X A;  2WLD A;  5C3A A;  4EEG A;  1GX0 A;  3I0L A;  2RJ1 A;  3V0P A;  1VZX A;  2Z86 A;  3RMV A;  2O1G A;  4EEO A;  1GWW A;  1G97 A;  1SSM A;  3CGX A;  1H5S C;  2WLF A;  4D11 A;  2VSI A;  3DK5 A;  1W77 A;  3Q4S A;  5CQP A;  1IIM A;  2PA4 A;  3V8Y A;  2RJ5 A;  1QRG A;  3D98 A;  1JVD A;  3I0E A;  1GWV A;  1NF5 B;  3GUE A;  1WT3 A;  3MQH A;  4BQH A;  2OEG A;  4KC1 A;  4M2A A;  3GVD A;  2PGY A;  4FRE A;  2FYA A;  3U2W A;  5IFY A;  4FIX A;  3TDT A;  5C47 A;  3TIO A;  4HOC A;  3Q1X A;  5FYE A;  2IUA A;  1QG8 A;  5FTV A;  5C4B A;  2A8U A;  3KWE A;  1GQ9 A;  3ST8 A;  4ECM A;  4E6T A;  4DEC A;  4BMA A;  3R5A A;  4AA7 A;  1KK4 A;  1ZJ0 A;  1H7L A;  3P47 A;  3R5C A;  1KGT A;  4FRD A;  3OH4 A;  3V0O A;  3T7M A;  2XME A;  2J0B A;  2YQC A;  1FO8 A;  5AFU U;  3JTJ A;  4R7P A;  3CKV A;  4EA9 A;  4JD0 A;  3I0J A;  4NAI A;  2RIZ A;  4EE4 A;  4P02 A;  4MYO A;  1NWG B;  1WSZ A;  5AJP A;  4IHF A;  2I5K A;  3C8V A;  1G8O A;  3SX8 A;  1H4E A;  1KQA A;  1ZCV A;  1LZJ A;  3OC9 A;  3CKJ A;  1HJL A;  3POL A;  3BSY A;  1ZI5 A;  1LL2 A;  2WE9 A;  1OMZ A;  4M28 A;  1ZDF A;  5JQQ A;  1QRL A;  2W0V A;  2RJ7 A;  2V0I A;  5DG3 A;  4H7O A;  1QRF A;  1KHR A;  4MZU A;  4N6A A;  4KT7 A;  2IU8 A;  1MC3 A;  1INJ A;  1SS9 A;  3I0H A;  4Y6U A;  5EJ1 A;  4NAL A;  3FWW A;  1JYK A;  2D0J A;  3VNP A;  3OGZ A;  3BFP A;  3T57 A;  1EZI A;  3SX5 A;  4J09 A;  1FGX A;  1MRL A;  2YQS A;  1XAT A;  4KPX A;  1HM9 A;  3CKO A;  1ZI3 A;  4IRP A;  4CJB A;  3HJJ A;  5C1L A;  3RMW A;  2AQ9 A;  3TQD A;  1LVW A;  5DEP A;  3R8Y A;  1MR9 A;  2V0K A;  3PMO A;  1KRV A;  3CKQ A;  1GQC A;  3OAM A;  3T7O A;  3IGJ A;  5E3P A;  2X5Z A;  5CMH A;  1VZU A;  2WVL A;  3GQ8 A;  2YC3 A;  4E75 A;  3TWD A;  3R2W A;  3V91 A;  4MIX A;  2WVM A;  4CJ8 A;  4CJC A;  1OQM B;  3FOQ A;  4N6B A;  2P2O A;  2RIY A;  3K8E A;  4M4K A; 
#chains in the Genus database with same CATH homology
 3VBJ A;  2YES A;  4Y62 A;  3SXC A;  3U2X A;  1HM8 A;  1H5S B;  1W55 A;  2RJ9 A;  5CMF X;  3MC4 A;  2APC A;  2FY7 A;  1XZ6 A;  4E79 A;  1FOA A;  4KNR A;  3K8D A;  3R3I A;  3I3X A;  1H7H A;  4B42 A;  4EVW A;  5C48 A;  1ZJO A;  3TIS A;  1H3M A;  1FO9 A;  4Q7C A;  1H7G A;  3EG4 A;  3IOI A;  2BO4 A;  2RIJ A;  4M9C A;  1VGW A;  3ZGG A;  4AYJ A;  3IOH A;  2AE7 A;  1VH1 A;  4FRA A;  1V83 A;  3VBL A;  5C49 A;  4HO4 A;  1O7O A;  3OTM A;  2FYD B;  2RJ4 A;  3OUP A;  1QGQ A;  5L6V A;  2BO6 A;  4G3S A;  1YP3 A;  3R3R A;  3DHO A;  2ICY A;  1WVC A;  2P72 A;  2PX7 A;  3F1C A;  1H7E A;  1R7U A;  2A8W A;  4HO0 A;  3JUJ A;  3ZGF A;  3VBP A;  2Q4J A;  1KRU A;  3CJ8 A;  1H5S D;  5C3D A;  2O1F A;  3PKQ A;  1VM8 A;  4G3Q A;  1G9R A;  1ZDG A;  1MP4 A;  3D5N A;  3NZ2 A;  1FXJ A;  1XHB A;  1V3W A;  1S4P A;  1O23 B;  1KGQ A;  2VD4 A;  4ASY A;  3FTT A;  1WT2 A;  3D8V A;  2FYC B;  1FG5 N;  4HO6 A;  4Y64 A;  3N9W A;  5FU8 A;  3U0X A;  1VPA A;  2OI6 A;  4UEG A;  1TZF A;  1KRR A;  3ZLL A;  1G93 A;  3KWD A;  3I3A A;  4Y7G A;  3SRT A;  1ZHJ A;  1G0R A;  3VBI A;  2WLG A;  3SX7 A;  4M2B A;  1TW5 A;  1KK6 A;  1ZCU A;  5F42 A;  2QIV X;  4FRB A;  3FSC A;  3T7N A;  2P73 A;  4KNX A;  1H7T A;  2I5E A;  5E3Q A;  4Y63 A;  1ZIZ A;  2OI7 A;  2XWN A;  4XWI A;  1TDT A;  2IU9 A;  4IHH A;  3EE5 A;  3EEV A;  1Z90 A;  3GOS A;  4KQL A;  1W57 A;  4FQW A;  1JYL A;  2Y6P A;  2JCK A;  2VS4 A;  1LZ0 A;  3DJ4 A;  1S4N A;  1H7F A;  5I1F A;  3BSW A;  4EEA A;  3PNN A;  2WGZ A;  1R80 A;  5FU0 A;  3R1W A;  3FSX A;  1OMX A;  5CQM X;  1E5K A;  4G87 A;  1R7X A;  4GBP A;  1VGZ A;  2QKX A;  3ECT A;  3LW6 A;  3ZF8 A;  3V90 A;  2FFV A;  2NPO A;  3KIA A;  4D0T A;  4Y7U A;  5CMG X;  1KK5 A;  5C1H A;  3SPT A;  1VZT A;  4Y6N A;  1ZJ2 A;  5C8R A;  3KWC A;  3OTZ A;  2E3D A;  5CMJ A;  3I0K A;  4MFG A;  4AC3 A;  5C4F A;  2RIX A;  3HL3 A;  2O1H A;  3HSQ A;  3R5B A;  2WLE A;  1LZI A;  4DE7 A;  3I0D A;  3OH0 A;  3PKP A;  1ZCY A;  1ZCT A;  3OU9 A;  5DDT A;  3I0I X;  1LZ7 A;  2IC7 A;  1R82 A;  3V0M A;  4KC4 A;  3I0F A;  3E26 A;  2V0H A;  1VIC A;  2XMH A;  3F1Y A;  5DDV A;  5EIY A;  4FRM A;  1QQ0 A;  1EYR A;  3U2T A;  1JVG A;  1OCX A;  3CU0 A;  1TVY A;  3SXG A;  1ZJ3 A;  2D7I A;  1HV9 A;  3P1B A;  4B2W A;  1YP2 A;  5E3R A;  2RIT A;  2BO8 A;  3USQ A;  4KC2 A;  1J2Z A;  1WT1 A;  1G1L A;  1H4D A;  2OI5 A;  4HO5 A;  4HUS A;  1MP3 A;  2FKO A;  5BXC A;  1ZJP A;  1G3L A;  4M98 A;  1THJ A;  1SSQ A;  2X60 A;  2P6W A;  4HO8 A;  2WLC A;  1V82 A;  2QGI A;  2ZU8 A;  1NKH B;  3U2U A;  1LXA A;  1H5T A;  4ARW A;  4DCL A;  4D48 A;  1JV3 A;  4C2S A;  4LW3 A;  2AGD A;  1WT0 A;  4EA7 A;  1LL3 A;  1QWJ A;  4K6R A;  1GA8 A;  3Q7U A;  3TZT A;  5C38 A;  1JV1 A;  4FCE A;  2Z87 A;  1G95 A;  5ADX V;  2VXL A;  1ZJ1 A;  3DUV A;  1NQI B;  2Y4M A;  4R36 A;  4B4M A;  4IRQ A;  2NXV A;  3JUK A;  2VK9 A;  4FRH A;  1FGG A;  2X65 A;  2XWL A;  2V0L A;  4G3P A;  3RSB A;  5ADX U;  4NAK A;  1NHE B;  2JCL A;  5C4C A;  5AJO A;  2JCJ A;  4B3U A;  1PZT A;  3MQG A;  4EAA A;  4EGG A;  5C3B A;  1YP4 A;  4FIY A;  2WAW A;  5C4E A;  2RJ0 A;  3TV0 A;  4LW6 A;  5IDS A;  4ZDQ A;  1TW1 A;  5D91 A;  4E6U A;  5DEM A;  2Y7A A;  2JF3 A;  3I0C A;  4EQY A;  4HCQ A;  4FRO A;  1K4V A;  2PGV A;  1R7V A;  2V0J A;  3OKR A;  1MR7 A;  2ICX A;  2XWM A;  1QRM A;  2ZU7 A;  2AM3 A;  3SXD A;  5HS2 A;  1V84 A;  2Y4K A;  2VXM A;  4B4B A;  4L41 C;  2RJ8 A;  4J18 A;  4AYL A;  1FWY A;  4MND A;  3VBM A;  2QH5 A;  4EE5 A;  5AFU V;  1FZW A;  3BCV A;  2VSH A;  3V0N A;  1S4O A;  1LL0 A;  3I0G A;  1KWS A;  4N69 A;  3OW5 A;  2YCM A;  3Q80 A;  4D11 C;  2CU2 A;  3TK8 A;  1ON8 A;  1VGU A;  5CQN X;  4EEM A;  1FR8 A;  3V0Q A;  1SST A;  4YS8 A;  5J49 A;  1H7Q A;  1I52 A;  4EAB A;  4JIS A;  2YQJ A;  2QIA A;  3BRK X;  3R0S A;  1VGT A;  3FSY A;  2VS5 A;  1R7T A;  2FYB A;  3OH3 A;  3OH1 A;  2XAT A;  5CQL X;  2VFZ A;  3ZLK A;  4AAW A;  1O0R A;  4EA8 A;  2YQH A;  4MYB A;  4R37 A;  2AES A;  3SXE A;  5L6S A;  3SXB A;  1QRE A;  1ZI4 A;  5FV9 A;  5AJN A;  3R5D A;  3V4E A;  2UX8 A;  1S80 A;  4IHG A;  3BXY A;  4KPZ A;  4HO3 A;  5CQO A;  2AEC A;  2AM5 A;  4B4G A;  2AM4 A;  1VH3 A;  4HZD A;  2Y4L A;  2ZU9 A;  3CKN A;  1XHD A;  1HM0 A;  3USR A;  3F1X A;  4P00 A;  3U2V A;  5C4D A;  4HZC A;  2AH9 A;  2X5S A;  1FRW A;  2GGQ A;  1O7Q A;  3QVB A;  3SXA A;  4CVH A;  4FRQ A;  4HUR A;  2VHE A;  2YC5 A;  1FR9 A;  3OH2 A;  1YRO B;  3V0L A;  4ASJ A;  1IIN A;  2J0A A;  4FRP A;  2VS3 A;  2MZB A;  2E8B A;  3U0Y A;  2WEE A;  3EH0 A;  4FRL A;  1G23 A;  1NMM B;  2DPW A;  4ISX A;  2C0N A;  1ON6 A;  1R7Y A;  2W0W A;  1H5R B;  1PZY B;  3NGW A;  4E1K A;  4M99 A;  1H5T B;  4B5B A;  2D7R A;  1GX4 A;  3VBK A;  4KRV A;  5EJZ A;  3IOJ A;  4DDZ A;  5FUH A;  1H5R A;  4O6M A;  4NAN A;  3V8Z A;  4EE3 A;  2I7B A;  2BO7 A;  5CMI A;  2Y4J A;  5U2K A;  3JQY A;  2WVK A;  4HO9 A;  4B2X A;  1ZI1 A;  2JCO A;  5FTS A;  4KXO A;  5D92 A;  5C1G A;  1FXO A;  2JF2 A;  3FSB A;  2RJ6 A;  4FCU A;  2GGO A;  1QGS A;  3E25 A;  5IDT A;  4N27 A;  2FFU A;  1H4C A;  1H5S A;  3VBN A;  1INI A;  1T3D A;  1R81 A;  4Y7T A;  4O6N A;  3O3P A;  3IXC A;  2TDT A;  1G2V A;  4HG6 A;  4HO2 A;  3SX3 A;  1MP5 A;  4Y7V A;  1HJJ A;  4Y7F A;  1V67 A;  4D0Z A;  3FS8 A;  5C36 A;  2OEF A;  3BSS A;  4Y9X A;  2WLD A;  5C3A A;  4EEG A;  1GX0 A;  3I0L A;  2RJ1 A;  3V0P A;  1VZX A;  2Z86 A;  3RMV A;  2O1G A;  4EEO A;  1GWW A;  1G97 A;  1SSM A;  3CGX A;  1H5S C;  2WLF A;  4D11 A;  2VSI A;  3DK5 A;  1W77 A;  3Q4S A;  5CQP A;  1IIM A;  2PA4 A;  3V8Y A;  2RJ5 A;  1QRG A;  3D98 A;  1JVD A;  3I0E A;  1GWV A;  1NF5 B;  3GUE A;  1WT3 A;  3MQH A;  4BQH A;  2OEG A;  4KC1 A;  4M2A A;  3GVD A;  2PGY A;  4FRE A;  2FYA A;  3U2W A;  5IFY A;  4FIX A;  3TDT A;  5C47 A;  3TIO A;  4HOC A;  3Q1X A;  5FYE A;  2IUA A;  1QG8 A;  5FTV A;  5C4B A;  2A8U A;  3KWE A;  1GQ9 A;  3ST8 A;  4ECM A;  4E6T A;  4DEC A;  4BMA A;  3R5A A;  4AA7 A;  1KK4 A;  1ZJ0 A;  1H7L A;  3P47 A;  3R5C A;  1KGT A;  4FRD A;  3OH4 A;  3V0O A;  3T7M A;  2XME A;  2J0B A;  2YQC A;  1FO8 A;  5AFU U;  3JTJ A;  4R7P A;  3CKV A;  4EA9 A;  4JD0 A;  3I0J A;  4NAI A;  2RIZ A;  4EE4 A;  4P02 A;  4MYO A;  1NWG B;  1WSZ A;  5AJP A;  4IHF A;  2I5K A;  3C8V A;  1G8O A;  3SX8 A;  1H4E A;  1KQA A;  1ZCV A;  1LZJ A;  3OC9 A;  3CKJ A;  1HJL A;  3POL A;  3BSY A;  1ZI5 A;  1LL2 A;  2WE9 A;  1OMZ A;  4M28 A;  1ZDF A;  5JQQ A;  1QRL A;  2W0V A;  2RJ7 A;  2V0I A;  5DG3 A;  4H7O A;  1QRF A;  1KHR A;  4MZU A;  4N6A A;  4KT7 A;  2IU8 A;  1MC3 A;  1INJ A;  1SS9 A;  3I0H A;  4Y6U A;  5EJ1 A;  4NAL A;  3FWW A;  1JYK A;  2D0J A;  3VNP A;  3OGZ A;  3BFP A;  3T57 A;  1EZI A;  3SX5 A;  4J09 A;  1FGX A;  1MRL A;  2YQS A;  1XAT A;  4KPX A;  1HM9 A;  3CKO A;  1ZI3 A;  4IRP A;  4CJB A;  3HJJ A;  5C1L A;  3RMW A;  2AQ9 A;  3TQD A;  1LVW A;  5DEP A;  3R8Y A;  1MR9 A;  2V0K A;  3PMO A;  1KRV A;  3CKQ A;  1GQC A;  3OAM A;  3T7O A;  3IGJ A;  5E3P A;  2X5Z A;  5CMH A;  1VZU A;  2WVL A;  2YC3 A;  4E75 A;  3TWD A;  3R2W A;  3V91 A;  4MIX A;  2WVM A;  4CJ8 A;  4CJC A;  1OQM B;  3FOQ A;  4N6B A;  2P2O A;  2RIY A;  3K8E A;  4M4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...