3OTMA

Crystal structures of wild-type gamma-carbonic anhydrase from methanosarcina thermophila
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase
publication title Crystal structures of gamma-carbonic anhydrase mutants from Methanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 73
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3otmA00
4EABA 3VBMA 4EA8A 3OTMA 3OW5A 2V0LA 3F1XA 2VD4A 1QRMA 3JQYA 3DJ4A 1TDTA 3FSBA 1SSQA 3R5AA 3R5DA 4MFGA 3C8VA 2V0KA 3Q1XA 2FKOA 4M28A 4IHHA 3VBPA 2QIVX 2IUAA 2IU8A 3BSWA 3FS8A 3EG4A 1KRUA 3KWCA 3TIOA 5L6VA 3OUPA 4M9CA 3FWWA 3DK5A 1KRRA 1Z90A 2ICYA 2IU9A 4HUSA 5DEPA 3R5CA 3BSYA 3P1BA 3GUEA 3GOSA 3TK8A 3BFPA 1HM0A 3I3XA 3P47A 1HV9A 2RIJA 4G3SA 3OU9A 4N27A 2WLEA 4KNXA 2WLGA 3VBLA 1KRVA 4EA7A 2WLDA 4J18A 1KGQA 1T3DA 5E3RA 4EAAA 3R2WA 3KWEA 5DG3A 1QRLA 4HZCA 3VBKA 4E6TA 2JF3A 1SSMA 3VNPA 5E3PA 2Q4JA 1KGTA 4E1KA 1FWYA 4M2AA 1XATA 3HJJA 1MR9A 2GGQA 3D98A 5L6SA 3MC4A 2V0JA 4AAWA 3NZ2A 4R37A 3SPTA 1XHDA 1SSTA 5F42A 1KHRA 3VBIA 3EEVA 4H7OA 3MQHA 4KPZA 3ST8A 4K6RA 1LXAA 2QIAA 2AQ9A 3OTZA 3R1WA 4E75A 3D8VA 3I3AA 2OI5A 3VBJA 3BSSA 1MRLA 1KK5A 3FTTA 4KPXA 4IHFA 1KQAA 3VBNA 4EA9A 3SRTA 3BRKX 4EGGA 1V3WA 4G3QA 2I5KA 1QRFA 2W0VA 2OEGA 5U2KA 4G87A 3TWDA 1KK4A 4FCEA 4IHGA 3R5BA 1J2ZA 5AFUU 2V0HA 4N69A 4G3PA 3TV0A 4R7PA 3EH0A 1FXJA 4E79A 2P2OA 3T57A 2NPOA 1YP4A 3HSQA 4J09A 2XATA 4MZUA 3GVDA 3R8YA 1YP2A 4HZDA 2OI7A 1G97A 1HM9A 2OI6A 4KQLA 4AA7A 4ISXA 1V67A 2V0IA 5AFUV 2OEFA 1G95A 2WLFA 4N6AA 1QREA 3ECTA 1QRGA 4HCQA 4KNRA 4HURA 3FOQA 3R0SA 4M2BA 1THJA 2IC7A 5E3QA 1MR7A 3V4EA 5ADXV 1OCXA 3DHOA 2ICXA 1S80A 3BXYA 3FSXA 2WLCA 4M98A 3MQGA 2W0WA 4R36A 3FSCA 4AC3A 3CJ8A 3PMOA 1QQ0A 2VHEA 4M99A 4DCLA 3FSYA 5DEMA 3IGJA 1KK6A 3R3IA 2QKXA 4MYOA 3TDTA 3R3RA 3TISA 2TDTA 3KWDA 1YP3A 4E6UA 4EQYA 1HM8A 4N6BA 5ADXU 2JF2A 3IXCA 2GGOA
chains in the Genus database with same CATH superfamily
4EABA 3VBMA 4EA8A 3OTMA 3OW5A 2V0LA 3F1XA 2VD4A 1QRMA 3JQYA 3DJ4A 1TDTA 3FSBA 1SSQA 3R5AA 3R5DA 4MFGA 3GQ9A 3C8VA 2V0KA 3Q1XA 2FKOA 4M28A 1Z2FA 4IHHA 3VBPA 2QIVX 2IUAA 2IU8A 3BSWA 3FS8A 3EG4A 1KRUA 3KWCA 3TIOA 5L6VA 3OUPA 4M9CA 3FWWA 3DK5A 1KRRA 1Z90A 2ICYA 2IU9A 4HUSA 3SUCA 5DEPA 3R5CA 3BSYA 3P1BA 3GUEA 3GOSA 3TK8A 3BFPA 1HM0A 3I3XA 3P47A 1HV9A 2RIJA 4G3SA 3OU9A 4N27A 3OGZA 2WLEA 4KNXA 2WLGA 1M8NA 3VBLA 1KRVA 3OH2A 4EA7A 2WLDA 4J18A 1KGQA 1T3DA 5E3RA 4EAAA 3R2WA 3KWEA 5DG3A 1QRLA 4HZCA 3VBKA 4E6TA 2JF3A 1SSMA 3VNPA 5E3PA 2Q4JA 1KGTA 4E1KA 1FWYA 4M2AA 1XATA 3HJJA 1MR9A 2GGQA 3D98A 5L6SA 3MC4A 2V0JA 4AAWA 1EWWA 3NZ2A 4R37A 3GQ8A 1XHDA 1SSTA 5F42A 1KHRA 3SPTA 3VBIA 3OH4A 3EEVA 4H7OA 3MQHA 4KPZA 3ST8A 4K6RA 1LXAA 2QIAA 2AQ9A 3OTZA 3R1WA 4E75A 3D8VA 3I3AA 2OI5A 3VBJA 3BSSA 1MRLA 1KK5A 3FTTA 4KPXA 4IHFA 1KQAA 3VBNA 4EA9A 3SRTA 3BRKX 4EGGA 1V3WA 4G3QA 2I5KA 1QRFA 2W0VA 2OEGA 5U2KA 4G87A 3TWDA 1KK4A 4FCEA 4IHGA 1N4IA 3R5BA 1J2ZA 5AFUU 2V0HA 4N69A 4G3PA 3TV0A 4R7PA 3EH0A 1FXJA 4E79A 2P2OA 3T57A 2NPOA 1YP4A 3HSQA 3OH1A 2XATA 4J09A 3GVDA 4MZUA 3R8YA 1YP2A 4HZDA 2OI7A 1G97A 1HM9A 2OI6A 4KQLA 4AA7A 4ISXA 1V67A 2V0IA 5AFUV 2OEFA 3OH0A 1G95A 2WLFA 4N6AA 1QREA 3ECTA 1QRGA 4HCQA 4KNRA 4HURA 3FOQA 3R0SA 4M2BA 1THJA 2IC7A 5E3QA 1MR7A 3V4EA 5ADXV 1OCXA 3DHOA 2ICXA 1S80A 1L0SA 3BXYA 3FSXA 2WLCA 4M98A 3MQGA 2W0WA 3OH3A 3FSCA 3GQAA 4R36A 3GQ7A 3CJ8A 4AC3A 3PMOA 1QQ0A 2VHEA 4M99A 4DCLA 3FSYA 5DEMA 3IGJA 1KK6A 3R3IA 2QKXA 4MYOA 3TDTA 3R3RA 3TISA 2TDTA 3KWDA 1YP3A 4E6UA 4EQYA 1HM8A 4N6BA 5ADXU 2JF2A 3IXCA 2GGOA
chains in the Genus database with same CATH topology
4EABA 3VBMA 4EA8A 3OTMA 3OW5A 2V0LA 3F1XA 2VD4A 1QRMA 3JQYA 3DJ4A 1TDTA 3FSBA 1SSQA 3R5AA 3R5DA 4MFGA 3C8VA 2V0KA 3Q1XA 2FKOA 4M28A 4IHHA 3VBPA 2QIVX 2IUAA 2IU8A 3BSWA 3FS8A 3EG4A 1KRUA 3KWCA 3TIOA 5L6VA 3OUPA 4M9CA 3FWWA 3DK5A 1KRRA 1Z90A 2ICYA 2IU9A 4HUSA 5DEPA 3R5CA 3BSYA 3P1BA 3GUEA 3GOSA 3TK8A 3BFPA 1HM0A 3I3XA 3P47A 1HV9A 2RIJA 4G3SA 3OU9A 4N27A 2WLEA 4KNXA 2WLGA 3VBLA 1KRVA 4EA7A 2WLDA 4J18A 1KGQA 1T3DA 5E3RA 4EAAA 3R2WA 3KWEA 5DG3A 1QRLA 4HZCA 3VBKA 4E6TA 2JF3A 1SSMA 3VNPA 5E3PA 2Q4JA 1KGTA 4E1KA 1FWYA 4M2AA 1XATA 3HJJA 1MR9A 2GGQA 3D98A 5L6SA 3MC4A 2V0JA 4AAWA 3NZ2A 4R37A 3SPTA 1XHDA 1SSTA 5F42A 1KHRA 3VBIA 3EEVA 4H7OA 3MQHA 4KPZA 3ST8A 4K6RA 1LXAA 2QIAA 2AQ9A 3OTZA 3R1WA 4E75A 3D8VA 3I3AA 2OI5A 3VBJA 3BSSA 1MRLA 1KK5A 3FTTA 4KPXA 4IHFA 1KQAA 3VBNA 4EA9A 3SRTA 3BRKX 4EGGA 1V3WA 4G3QA 2I5KA 1QRFA 2W0VA 2OEGA 5U2KA 4G87A 3TWDA 1KK4A 4FCEA 4IHGA 3R5BA 1J2ZA 5AFUU 2V0HA 4N69A 4G3PA 3TV0A 4R7PA 3EH0A 1FXJA 4E79A 2P2OA 3T57A 2NPOA 1YP4A 3HSQA 4J09A 2XATA 4MZUA 3GVDA 3R8YA 1YP2A 4HZDA 2OI7A 1G97A 1HM9A 2OI6A 4KQLA 4AA7A 4ISXA 1V67A 2V0IA 5AFUV 2OEFA 1G95A 2WLFA 4N6AA 1QREA 3ECTA 1QRGA 4HCQA 4KNRA 4HURA 3FOQA 3R0SA 4M2BA 1THJA 2IC7A 5E3QA 1MR7A 3V4EA 5ADXV 1OCXA 3DHOA 2ICXA 1S80A 3BXYA 3FSXA 2WLCA 4M98A 3MQGA 2W0WA 4R36A 3FSCA 4AC3A 3CJ8A 3PMOA 1QQ0A 2VHEA 4M99A 4DCLA 3FSYA 5DEMA 3IGJA 1KK6A 3R3IA 2QKXA 4MYOA 3TDTA 3R3RA 3TISA 2TDTA 3KWDA 1YP3A 4E6UA 4EQYA 1HM8A 4N6BA 5ADXU 2JF2A 3IXCA 2GGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAB A;  3VBM A;  4EA8 A;  3OTM A;  3OW5 A;  2V0L A;  3F1X A;  2VD4 A;  1QRM A;  3JQY A;  3DJ4 A;  1TDT A;  3FSB A;  1SSQ A;  3R5A A;  3R5D A;  4MFG A;  3C8V A;  2V0K A;  3Q1X A;  2FKO A;  4M28 A;  4IHH A;  3VBP A;  2QIV X;  2IUA A;  2IU8 A;  3BSW A;  3FS8 A;  3EG4 A;  1KRU A;  3KWC A;  3TIO A;  5L6V A;  3OUP A;  4M9C A;  3FWW A;  3DK5 A;  1KRR A;  1Z90 A;  2ICY A;  2IU9 A;  4HUS A;  5DEP A;  3R5C A;  3BSY A;  3P1B A;  3GUE A;  3GOS A;  3TK8 A;  3BFP A;  1HM0 A;  3I3X A;  3P47 A;  1HV9 A;  2RIJ A;  4G3S A;  3OU9 A;  4N27 A;  2WLE A;  4KNX A;  2WLG A;  3VBL A;  1KRV A;  4EA7 A;  2WLD A;  4J18 A;  1KGQ A;  1T3D A;  5E3R A;  4EAA A;  3R2W A;  3KWE A;  5DG3 A;  1QRL A;  4HZC A;  3VBK A;  4E6T A;  2JF3 A;  1SSM A;  3VNP A;  5E3P A;  2Q4J A;  1KGT A;  4E1K A;  1FWY A;  4M2A A;  1XAT A;  3HJJ A;  1MR9 A;  2GGQ A;  3D98 A;  5L6S A;  3MC4 A;  2V0J A;  4AAW A;  3NZ2 A;  4R37 A;  3SPT A;  1XHD A;  1SST A;  5F42 A;  1KHR A;  3VBI A;  3EEV A;  4H7O A;  3MQH A;  4KPZ A;  3ST8 A;  4K6R A;  1LXA A;  2QIA A;  2AQ9 A;  3OTZ A;  3R1W A;  4E75 A;  3D8V A;  3I3A A;  2OI5 A;  3VBJ A;  3BSS A;  1MRL A;  1KK5 A;  3FTT A;  4KPX A;  4IHF A;  1KQA A;  3VBN A;  4EA9 A;  3SRT A;  3BRK X;  4EGG A;  1V3W A;  4G3Q A;  2I5K A;  1QRF A;  2W0V A;  2OEG A;  5U2K A;  4G87 A;  3TWD A;  1KK4 A;  4FCE A;  4IHG A;  3R5B A;  1J2Z A;  5AFU U;  2V0H A;  4N69 A;  4G3P A;  3TV0 A;  4R7P A;  3EH0 A;  1FXJ A;  4E79 A;  2P2O A;  3T57 A;  2NPO A;  1YP4 A;  3HSQ A;  4J09 A;  2XAT A;  4MZU A;  3GVD A;  3R8Y A;  1YP2 A;  4HZD A;  2OI7 A;  1G97 A;  1HM9 A;  2OI6 A;  4KQL A;  4AA7 A;  4ISX A;  1V67 A;  2V0I A;  5AFU V;  2OEF A;  1G95 A;  2WLF A;  4N6A A;  1QRE A;  3ECT A;  1QRG A;  4HCQ A;  4KNR A;  4HUR A;  3FOQ A;  3R0S A;  4M2B A;  1THJ A;  2IC7 A;  5E3Q A;  1MR7 A;  3V4E A;  5ADX V;  1OCX A;  3DHO A;  2ICX A;  1S80 A;  3BXY A;  3FSX A;  2WLC A;  4M98 A;  3MQG A;  2W0W A;  4R36 A;  3FSC A;  4AC3 A;  3CJ8 A;  3PMO A;  1QQ0 A;  2VHE A;  4M99 A;  4DCL A;  3FSY A;  5DEM A;  3IGJ A;  1KK6 A;  3R3I A;  2QKX A;  4MYO A;  3TDT A;  3R3R A;  3TIS A;  2TDT A;  3KWD A;  1YP3 A;  4E6U A;  4EQY A;  1HM8 A;  4N6B A;  5ADX U;  2JF2 A;  3IXC A;  2GGO A; 
#chains in the Genus database with same CATH topology
 4EAB A;  3VBM A;  4EA8 A;  3OTM A;  3OW5 A;  2V0L A;  3F1X A;  2VD4 A;  1QRM A;  3JQY A;  3DJ4 A;  1TDT A;  3FSB A;  1SSQ A;  3R5A A;  3R5D A;  4MFG A;  3GQ9 A;  3C8V A;  2V0K A;  3Q1X A;  2FKO A;  4M28 A;  1Z2F A;  4IHH A;  3VBP A;  2QIV X;  2IUA A;  2IU8 A;  3BSW A;  3FS8 A;  3EG4 A;  1KRU A;  3KWC A;  3TIO A;  5L6V A;  3OUP A;  4M9C A;  3FWW A;  3DK5 A;  1KRR A;  1Z90 A;  2ICY A;  2IU9 A;  4HUS A;  3SUC A;  5DEP A;  3R5C A;  3BSY A;  3P1B A;  3GUE A;  3GOS A;  3TK8 A;  3BFP A;  1HM0 A;  3I3X A;  3P47 A;  1HV9 A;  2RIJ A;  4G3S A;  3OU9 A;  4N27 A;  3OGZ A;  2WLE A;  4KNX A;  2WLG A;  1M8N A;  3VBL A;  1KRV A;  3OH2 A;  4EA7 A;  2WLD A;  4J18 A;  1KGQ A;  1T3D A;  5E3R A;  4EAA A;  3R2W A;  3KWE A;  5DG3 A;  1QRL A;  4HZC A;  3VBK A;  4E6T A;  2JF3 A;  1SSM A;  3VNP A;  5E3P A;  2Q4J A;  1KGT A;  4E1K A;  1FWY A;  4M2A A;  1XAT A;  3HJJ A;  1MR9 A;  2GGQ A;  3D98 A;  5L6S A;  3MC4 A;  2V0J A;  4AAW A;  1EWW A;  3NZ2 A;  4R37 A;  3GQ8 A;  1XHD A;  1SST A;  5F42 A;  1KHR A;  3SPT A;  3VBI A;  3OH4 A;  3EEV A;  4H7O A;  3MQH A;  4KPZ A;  3ST8 A;  4K6R A;  1LXA A;  2QIA A;  2AQ9 A;  3OTZ A;  3R1W A;  4E75 A;  3D8V A;  3I3A A;  2OI5 A;  3VBJ A;  3BSS A;  1MRL A;  1KK5 A;  3FTT A;  4KPX A;  4IHF A;  1KQA A;  3VBN A;  4EA9 A;  3SRT A;  3BRK X;  4EGG A;  1V3W A;  4G3Q A;  2I5K A;  1QRF A;  2W0V A;  2OEG A;  5U2K A;  4G87 A;  3TWD A;  1KK4 A;  4FCE A;  4IHG A;  1N4I A;  3R5B A;  1J2Z A;  5AFU U;  2V0H A;  4N69 A;  4G3P A;  3TV0 A;  4R7P A;  3EH0 A;  1FXJ A;  4E79 A;  2P2O A;  3T57 A;  2NPO A;  1YP4 A;  3HSQ A;  3OH1 A;  2XAT A;  4J09 A;  3GVD A;  4MZU A;  3R8Y A;  1YP2 A;  4HZD A;  2OI7 A;  1G97 A;  1HM9 A;  2OI6 A;  4KQL A;  4AA7 A;  4ISX A;  1V67 A;  2V0I A;  5AFU V;  2OEF A;  3OH0 A;  1G95 A;  2WLF A;  4N6A A;  1QRE A;  3ECT A;  1QRG A;  4HCQ A;  4KNR A;  4HUR A;  3FOQ A;  3R0S A;  4M2B A;  1THJ A;  2IC7 A;  5E3Q A;  1MR7 A;  3V4E A;  5ADX V;  1OCX A;  3DHO A;  2ICX A;  1S80 A;  1L0S A;  3BXY A;  3FSX A;  2WLC A;  4M98 A;  3MQG A;  2W0W A;  3OH3 A;  3FSC A;  3GQA A;  4R36 A;  3GQ7 A;  3CJ8 A;  4AC3 A;  3PMO A;  1QQ0 A;  2VHE A;  4M99 A;  4DCL A;  3FSY A;  5DEM A;  3IGJ A;  1KK6 A;  3R3I A;  2QKX A;  4MYO A;  3TDT A;  3R3R A;  3TIS A;  2TDT A;  3KWD A;  1YP3 A;  4E6U A;  4EQY A;  1HM8 A;  4N6B A;  5ADX U;  2JF2 A;  3IXC A;  2GGO A; 
#chains in the Genus database with same CATH homology
 4EAB A;  3VBM A;  4EA8 A;  3OTM A;  3OW5 A;  2V0L A;  3F1X A;  2VD4 A;  1QRM A;  3JQY A;  3DJ4 A;  1TDT A;  3FSB A;  1SSQ A;  3R5A A;  3R5D A;  4MFG A;  3C8V A;  2V0K A;  3Q1X A;  2FKO A;  4M28 A;  4IHH A;  3VBP A;  2QIV X;  2IUA A;  2IU8 A;  3BSW A;  3FS8 A;  3EG4 A;  1KRU A;  3KWC A;  3TIO A;  5L6V A;  3OUP A;  4M9C A;  3FWW A;  3DK5 A;  1KRR A;  1Z90 A;  2ICY A;  2IU9 A;  4HUS A;  5DEP A;  3R5C A;  3BSY A;  3P1B A;  3GUE A;  3GOS A;  3TK8 A;  3BFP A;  1HM0 A;  3I3X A;  3P47 A;  1HV9 A;  2RIJ A;  4G3S A;  3OU9 A;  4N27 A;  2WLE A;  4KNX A;  2WLG A;  3VBL A;  1KRV A;  4EA7 A;  2WLD A;  4J18 A;  1KGQ A;  1T3D A;  5E3R A;  4EAA A;  3R2W A;  3KWE A;  5DG3 A;  1QRL A;  4HZC A;  3VBK A;  4E6T A;  2JF3 A;  1SSM A;  3VNP A;  5E3P A;  2Q4J A;  1KGT A;  4E1K A;  1FWY A;  4M2A A;  1XAT A;  3HJJ A;  1MR9 A;  2GGQ A;  3D98 A;  5L6S A;  3MC4 A;  2V0J A;  4AAW A;  3NZ2 A;  4R37 A;  3SPT A;  1XHD A;  1SST A;  5F42 A;  1KHR A;  3VBI A;  3EEV A;  4H7O A;  3MQH A;  4KPZ A;  3ST8 A;  4K6R A;  1LXA A;  2QIA A;  2AQ9 A;  3OTZ A;  3R1W A;  4E75 A;  3D8V A;  3I3A A;  2OI5 A;  3VBJ A;  3BSS A;  1MRL A;  1KK5 A;  3FTT A;  4KPX A;  4IHF A;  1KQA A;  3VBN A;  4EA9 A;  3SRT A;  3BRK X;  4EGG A;  1V3W A;  4G3Q A;  2I5K A;  1QRF A;  2W0V A;  2OEG A;  5U2K A;  4G87 A;  3TWD A;  1KK4 A;  4FCE A;  4IHG A;  3R5B A;  1J2Z A;  5AFU U;  2V0H A;  4N69 A;  4G3P A;  3TV0 A;  4R7P A;  3EH0 A;  1FXJ A;  4E79 A;  2P2O A;  3T57 A;  2NPO A;  1YP4 A;  3HSQ A;  4J09 A;  2XAT A;  4MZU A;  3GVD A;  3R8Y A;  1YP2 A;  4HZD A;  2OI7 A;  1G97 A;  1HM9 A;  2OI6 A;  4KQL A;  4AA7 A;  4ISX A;  1V67 A;  2V0I A;  5AFU V;  2OEF A;  1G95 A;  2WLF A;  4N6A A;  1QRE A;  3ECT A;  1QRG A;  4HCQ A;  4KNR A;  4HUR A;  3FOQ A;  3R0S A;  4M2B A;  1THJ A;  2IC7 A;  5E3Q A;  1MR7 A;  3V4E A;  5ADX V;  1OCX A;  3DHO A;  2ICX A;  1S80 A;  3BXY A;  3FSX A;  2WLC A;  4M98 A;  3MQG A;  2W0W A;  4R36 A;  3FSC A;  4AC3 A;  3CJ8 A;  3PMO A;  1QQ0 A;  2VHE A;  4M99 A;  4DCL A;  3FSY A;  5DEM A;  3IGJ A;  1KK6 A;  3R3I A;  2QKX A;  4MYO A;  3TDT A;  3R3R A;  3TIS A;  2TDT A;  3KWD A;  1YP3 A;  4E6U A;  4EQY A;  1HM8 A;  4N6B A;  5ADX U;  2JF2 A;  3IXC A;  2GGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...