3OTMA

Crystal structures of wild-type gamma-carbonic anhydrase from methanosarcina thermophila
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase
publication title Crystal structures of gamma-carbonic anhydrase mutants from Methanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
total genus 73
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3otmA00
2VHEA 3HSQA 2GGQA 1XHDA 3KWEA 4IHHA 4M2AA 3VBPA 2IC7A 1J2ZA 3KWDA 1YP4A 3BSWA 1SSMA 3IXCA 4K6RA 1HM0A 4HURA 4M9CA 2ICYA 3BSYA 3D98A 3MQGA 2V0JA 4KQLA 3R5BA 4FCEA 1FXJA 3SRTA 3NZ2A 2WLCA 1KGTA 2AQ9A 3Q1XA 1KK4A 2I5KA 5DG3A 3OTMA 2QIVX 3GVDA 2V0KA 3TWDA 4KPZA 4EA9A 2NPOA 3FTTA 1HM9A 1THJA 4ISXA 3EH0A 4HZCA 4EA8A 4G87A 1SSTA 5L6SA 1KQAA 3V4EA 5U2KA 3VBJA 4DCLA 2TDTA 3CJ8A 5DEPA 2V0HA 3OTZA 1QRLA 2OI6A 1KHRA 1V67A 3C8VA 1S80A 5E3QA 1MRLA 3FSXA 2WLEA 4E1KA 4E75A 1LXAA 2ICXA 3R1WA 3P1BA 3BRKX 2Q4JA 2W0VA 3MC4A 3BXYA 3MQHA 4MFGA 2OI5A 3I3XA 1QQ0A 1QREA 5F42A 3R8YA 3PMOA 3R5AA 2VD4A 1MR7A 3DJ4A 1XATA 4HZDA 1OCXA 3R2WA 3D8VA 3KWCA 3GOSA 3JQYA 1MR9A 4EGGA 3FWWA 3OW5A 3T57A 4EAAA 2IUAA 4N6AA 3BFPA 2WLGA 3OU9A 2W0WA 4G3QA 3GUEA 4EQYA 5ADXV 2P2OA 2GGOA 3VBLA 2OEFA 3R3IA 1HM8A 3ECTA 4G3SA 4E6TA 4M98A 4MZUA 3HJJA 2WLFA 1HV9A 1SSQA 2XATA 1T3DA 2QIAA 3TK8A 3ST8A 3TV0A 2IU8A 5L6VA 3DK5A 4IHFA 3OUPA 4R7PA 2JF2A 3R5CA 1KK5A 4HCQA 1TDTA 1V3WA 5E3PA 1G97A 1QRMA 4G3PA 4M28A 3VBIA 2OI7A 1YP3A 3BSSA 1QRFA 4N27A 2JF3A 1G95A 4J18A 5AFUU 3P47A 1KK6A 4EABA 4AC3A 4N6BA 4E79A 3TISA 2QKXA 3I3AA 3IGJA 4IHGA 4KNRA 2V0IA 3VBMA 3FSBA 3TDTA 4H7OA 3FSCA 3FOQA 3EEVA 3FS8A 4R36A 4E6UA 4MYOA 5AFUV 3TIOA 4M2BA 3DHOA 4J09A 4HUSA 3F1XA 1QRGA 4N69A 4M99A 1FWYA 5ADXU 4KPXA 1KRUA 1YP2A 3R3RA 3FSYA 4AA7A 4AAWA 2RIJA 1KRRA 3SPTA 3EG4A 3R5DA 5E3RA 2IU9A 2FKOA 5DEMA 4EA7A 2WLDA 2OEGA 3VBNA 3VBKA 1Z90A 4R37A 1KGQA 3VNPA 4KNXA 3R0SA 2V0LA 1KRVA
chains in the Genus database with same CATH superfamily
2VHEA 3HSQA 2GGQA 1XHDA 3KWEA 3OH4A 4IHHA 4M2AA 3VBPA 2IC7A 1J2ZA 3KWDA 1YP4A 3BSWA 1SSMA 3IXCA 4K6RA 1HM0A 4HURA 4M9CA 2ICYA 3BSYA 3D98A 3MQGA 2V0JA 4KQLA 3R5BA 4FCEA 1FXJA 3SRTA 3NZ2A 2WLCA 1KGTA 2AQ9A 3Q1XA 1KK4A 2I5KA 3GQ8A 3OTMA 2QIVX 5DG3A 3GVDA 2V0KA 3TWDA 4KPZA 4EA9A 2NPOA 3FTTA 1HM9A 1THJA 4ISXA 3EH0A 4HZCA 4EA8A 4G87A 1SSTA 5L6SA 1KQAA 3V4EA 5U2KA 3VBJA 4DCLA 2TDTA 1EWWA 3CJ8A 5DEPA 2V0HA 3OTZA 1QRLA 2OI6A 1KHRA 1V67A 3C8VA 1S80A 5E3QA 1MRLA 3FSXA 2WLEA 4E1KA 4E75A 1LXAA 2ICXA 3R1WA 3OGZA 3BRKX 3P1BA 1L0SA 2Q4JA 2W0VA 3MC4A 3BXYA 3MQHA 4MFGA 2OI5A 3I3XA 1QQ0A 1QREA 5F42A 3R8YA 3GQ9A 3PMOA 3R5AA 2VD4A 1MR7A 3DJ4A 1XATA 4HZDA 1OCXA 3R2WA 3D8VA 3KWCA 3GOSA 3JQYA 1MR9A 1N4IA 3FWWA 4EGGA 3OW5A 3T57A 4EAAA 2IUAA 4N6AA 3BFPA 2WLGA 3OU9A 2W0WA 4G3QA 3GUEA 4EQYA 5ADXV 2P2OA 2GGOA 3VBLA 2OEFA 3R3IA 1HM8A 3ECTA 4G3SA 4E6TA 4M98A 4MZUA 3HJJA 2WLFA 1HV9A 1SSQA 2XATA 1T3DA 2QIAA 3OH3A 3OH0A 3TK8A 3ST8A 3TV0A 2IU8A 5L6VA 3DK5A 4IHFA 3OUPA 4R7PA 2JF2A 3OH1A 3R5CA 1KK5A 4HCQA 1TDTA 1V3WA 5E3PA 1G97A 1QRMA 4G3PA 4M28A 3VBIA 2OI7A 1YP3A 3BSSA 1QRFA 4N27A 2JF3A 1G95A 4J18A 5AFUU 3P47A 1KK6A 4EABA 4AC3A 4N6BA 4E79A 3TISA 2QKXA 1Z2FA 3GQAA 3I3AA 3IGJA 4IHGA 4KNRA 2V0IA 3VBMA 3FSBA 3TDTA 4H7OA 3FSCA 3FOQA 3EEVA 3FS8A 4R36A 4E6UA 4MYOA 5AFUV 3TIOA 4M2BA 3DHOA 4J09A 4HUSA 3F1XA 1QRGA 4N69A 4M99A 1FWYA 3SUCA 5ADXU 3OH2A 4KPXA 1KRUA 1YP2A 3R3RA 3FSYA 4AA7A 4AAWA 2RIJA 1KRRA 3SPTA 3EG4A 3R5DA 5E3RA 2IU9A 2FKOA 5DEMA 4EA7A 3GQ7A 2WLDA 2OEGA 1M8NA 3VBNA 3VBKA 1Z90A 4R37A 1KGQA 3VNPA 4KNXA 3R0SA 2V0LA 1KRVA
chains in the Genus database with same CATH topology
2VHEA 3HSQA 2GGQA 1XHDA 3KWEA 4IHHA 4M2AA 3VBPA 2IC7A 1J2ZA 3KWDA 1YP4A 3BSWA 1SSMA 3IXCA 4K6RA 1HM0A 4HURA 4M9CA 2ICYA 3BSYA 3D98A 3MQGA 2V0JA 4KQLA 3R5BA 4FCEA 1FXJA 3SRTA 3NZ2A 2WLCA 1KGTA 2AQ9A 3Q1XA 1KK4A 2I5KA 5DG3A 3OTMA 2QIVX 3GVDA 2V0KA 3TWDA 4KPZA 4EA9A 2NPOA 3FTTA 1HM9A 1THJA 4ISXA 3EH0A 4HZCA 4EA8A 4G87A 1SSTA 5L6SA 1KQAA 3V4EA 5U2KA 3VBJA 4DCLA 2TDTA 3CJ8A 5DEPA 2V0HA 3OTZA 1QRLA 2OI6A 1KHRA 1V67A 3C8VA 1S80A 5E3QA 1MRLA 3FSXA 2WLEA 4E1KA 4E75A 1LXAA 2ICXA 3R1WA 3P1BA 3BRKX 2Q4JA 2W0VA 3MC4A 3BXYA 3MQHA 4MFGA 2OI5A 3I3XA 1QQ0A 1QREA 5F42A 3R8YA 3PMOA 3R5AA 2VD4A 1MR7A 3DJ4A 1XATA 4HZDA 1OCXA 3R2WA 3D8VA 3KWCA 3GOSA 3JQYA 1MR9A 4EGGA 3FWWA 3OW5A 3T57A 4EAAA 2IUAA 4N6AA 3BFPA 2WLGA 3OU9A 2W0WA 4G3QA 3GUEA 4EQYA 5ADXV 2P2OA 2GGOA 3VBLA 2OEFA 3R3IA 1HM8A 3ECTA 4G3SA 4E6TA 4M98A 4MZUA 3HJJA 2WLFA 1HV9A 1SSQA 2XATA 1T3DA 2QIAA 3TK8A 3ST8A 3TV0A 2IU8A 5L6VA 3DK5A 4IHFA 3OUPA 4R7PA 2JF2A 3R5CA 1KK5A 4HCQA 1TDTA 1V3WA 5E3PA 1G97A 1QRMA 4G3PA 4M28A 3VBIA 2OI7A 1YP3A 3BSSA 1QRFA 4N27A 2JF3A 1G95A 4J18A 5AFUU 3P47A 1KK6A 4EABA 4AC3A 4N6BA 4E79A 3TISA 2QKXA 3I3AA 3IGJA 4IHGA 4KNRA 2V0IA 3VBMA 3FSBA 3TDTA 4H7OA 3FSCA 3FOQA 3EEVA 3FS8A 4R36A 4E6UA 4MYOA 5AFUV 3TIOA 4M2BA 3DHOA 4J09A 4HUSA 3F1XA 1QRGA 4N69A 4M99A 1FWYA 5ADXU 4KPXA 1KRUA 1YP2A 3R3RA 3FSYA 4AA7A 4AAWA 2RIJA 1KRRA 3SPTA 3EG4A 3R5DA 5E3RA 2IU9A 2FKOA 5DEMA 4EA7A 2WLDA 2OEGA 3VBNA 3VBKA 1Z90A 4R37A 1KGQA 3VNPA 4KNXA 3R0SA 2V0LA 1KRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHE A;  3HSQ A;  2GGQ A;  1XHD A;  3KWE A;  4IHH A;  4M2A A;  3VBP A;  2IC7 A;  1J2Z A;  3KWD A;  1YP4 A;  3BSW A;  1SSM A;  3IXC A;  4K6R A;  1HM0 A;  4HUR A;  4M9C A;  2ICY A;  3BSY A;  3D98 A;  3MQG A;  2V0J A;  4KQL A;  3R5B A;  4FCE A;  1FXJ A;  3SRT A;  3NZ2 A;  2WLC A;  1KGT A;  2AQ9 A;  3Q1X A;  1KK4 A;  2I5K A;  5DG3 A;  3OTM A;  2QIV X;  3GVD A;  2V0K A;  3TWD A;  4KPZ A;  4EA9 A;  2NPO A;  3FTT A;  1HM9 A;  1THJ A;  4ISX A;  3EH0 A;  4HZC A;  4EA8 A;  4G87 A;  1SST A;  5L6S A;  1KQA A;  3V4E A;  5U2K A;  3VBJ A;  4DCL A;  2TDT A;  3CJ8 A;  5DEP A;  2V0H A;  3OTZ A;  1QRL A;  2OI6 A;  1KHR A;  1V67 A;  3C8V A;  1S80 A;  5E3Q A;  1MRL A;  3FSX A;  2WLE A;  4E1K A;  4E75 A;  1LXA A;  2ICX A;  3R1W A;  3P1B A;  3BRK X;  2Q4J A;  2W0V A;  3MC4 A;  3BXY A;  3MQH A;  4MFG A;  2OI5 A;  3I3X A;  1QQ0 A;  1QRE A;  5F42 A;  3R8Y A;  3PMO A;  3R5A A;  2VD4 A;  1MR7 A;  3DJ4 A;  1XAT A;  4HZD A;  1OCX A;  3R2W A;  3D8V A;  3KWC A;  3GOS A;  3JQY A;  1MR9 A;  4EGG A;  3FWW A;  3OW5 A;  3T57 A;  4EAA A;  2IUA A;  4N6A A;  3BFP A;  2WLG A;  3OU9 A;  2W0W A;  4G3Q A;  3GUE A;  4EQY A;  5ADX V;  2P2O A;  2GGO A;  3VBL A;  2OEF A;  3R3I A;  1HM8 A;  3ECT A;  4G3S A;  4E6T A;  4M98 A;  4MZU A;  3HJJ A;  2WLF A;  1HV9 A;  1SSQ A;  2XAT A;  1T3D A;  2QIA A;  3TK8 A;  3ST8 A;  3TV0 A;  2IU8 A;  5L6V A;  3DK5 A;  4IHF A;  3OUP A;  4R7P A;  2JF2 A;  3R5C A;  1KK5 A;  4HCQ A;  1TDT A;  1V3W A;  5E3P A;  1G97 A;  1QRM A;  4G3P A;  4M28 A;  3VBI A;  2OI7 A;  1YP3 A;  3BSS A;  1QRF A;  4N27 A;  2JF3 A;  1G95 A;  4J18 A;  5AFU U;  3P47 A;  1KK6 A;  4EAB A;  4AC3 A;  4N6B A;  4E79 A;  3TIS A;  2QKX A;  3I3A A;  3IGJ A;  4IHG A;  4KNR A;  2V0I A;  3VBM A;  3FSB A;  3TDT A;  4H7O A;  3FSC A;  3FOQ A;  3EEV A;  3FS8 A;  4R36 A;  4E6U A;  4MYO A;  5AFU V;  3TIO A;  4M2B A;  3DHO A;  4J09 A;  4HUS A;  3F1X A;  1QRG A;  4N69 A;  4M99 A;  1FWY A;  5ADX U;  4KPX A;  1KRU A;  1YP2 A;  3R3R A;  3FSY A;  4AA7 A;  4AAW A;  2RIJ A;  1KRR A;  3SPT A;  3EG4 A;  3R5D A;  5E3R A;  2IU9 A;  2FKO A;  5DEM A;  4EA7 A;  2WLD A;  2OEG A;  3VBN A;  3VBK A;  1Z90 A;  4R37 A;  1KGQ A;  3VNP A;  4KNX A;  3R0S A;  2V0L A;  1KRV A; 
#chains in the Genus database with same CATH topology
 2VHE A;  3HSQ A;  2GGQ A;  1XHD A;  3KWE A;  3OH4 A;  4IHH A;  4M2A A;  3VBP A;  2IC7 A;  1J2Z A;  3KWD A;  1YP4 A;  3BSW A;  1SSM A;  3IXC A;  4K6R A;  1HM0 A;  4HUR A;  4M9C A;  2ICY A;  3BSY A;  3D98 A;  3MQG A;  2V0J A;  4KQL A;  3R5B A;  4FCE A;  1FXJ A;  3SRT A;  3NZ2 A;  2WLC A;  1KGT A;  2AQ9 A;  3Q1X A;  1KK4 A;  2I5K A;  3GQ8 A;  3OTM A;  2QIV X;  5DG3 A;  3GVD A;  2V0K A;  3TWD A;  4KPZ A;  4EA9 A;  2NPO A;  3FTT A;  1HM9 A;  1THJ A;  4ISX A;  3EH0 A;  4HZC A;  4EA8 A;  4G87 A;  1SST A;  5L6S A;  1KQA A;  3V4E A;  5U2K A;  3VBJ A;  4DCL A;  2TDT A;  1EWW A;  3CJ8 A;  5DEP A;  2V0H A;  3OTZ A;  1QRL A;  2OI6 A;  1KHR A;  1V67 A;  3C8V A;  1S80 A;  5E3Q A;  1MRL A;  3FSX A;  2WLE A;  4E1K A;  4E75 A;  1LXA A;  2ICX A;  3R1W A;  3OGZ A;  3BRK X;  3P1B A;  1L0S A;  2Q4J A;  2W0V A;  3MC4 A;  3BXY A;  3MQH A;  4MFG A;  2OI5 A;  3I3X A;  1QQ0 A;  1QRE A;  5F42 A;  3R8Y A;  3GQ9 A;  3PMO A;  3R5A A;  2VD4 A;  1MR7 A;  3DJ4 A;  1XAT A;  4HZD A;  1OCX A;  3R2W A;  3D8V A;  3KWC A;  3GOS A;  3JQY A;  1MR9 A;  1N4I A;  3FWW A;  4EGG A;  3OW5 A;  3T57 A;  4EAA A;  2IUA A;  4N6A A;  3BFP A;  2WLG A;  3OU9 A;  2W0W A;  4G3Q A;  3GUE A;  4EQY A;  5ADX V;  2P2O A;  2GGO A;  3VBL A;  2OEF A;  3R3I A;  1HM8 A;  3ECT A;  4G3S A;  4E6T A;  4M98 A;  4MZU A;  3HJJ A;  2WLF A;  1HV9 A;  1SSQ A;  2XAT A;  1T3D A;  2QIA A;  3OH3 A;  3OH0 A;  3TK8 A;  3ST8 A;  3TV0 A;  2IU8 A;  5L6V A;  3DK5 A;  4IHF A;  3OUP A;  4R7P A;  2JF2 A;  3OH1 A;  3R5C A;  1KK5 A;  4HCQ A;  1TDT A;  1V3W A;  5E3P A;  1G97 A;  1QRM A;  4G3P A;  4M28 A;  3VBI A;  2OI7 A;  1YP3 A;  3BSS A;  1QRF A;  4N27 A;  2JF3 A;  1G95 A;  4J18 A;  5AFU U;  3P47 A;  1KK6 A;  4EAB A;  4AC3 A;  4N6B A;  4E79 A;  3TIS A;  2QKX A;  1Z2F A;  3GQA A;  3I3A A;  3IGJ A;  4IHG A;  4KNR A;  2V0I A;  3VBM A;  3FSB A;  3TDT A;  4H7O A;  3FSC A;  3FOQ A;  3EEV A;  3FS8 A;  4R36 A;  4E6U A;  4MYO A;  5AFU V;  3TIO A;  4M2B A;  3DHO A;  4J09 A;  4HUS A;  3F1X A;  1QRG A;  4N69 A;  4M99 A;  1FWY A;  3SUC A;  5ADX U;  3OH2 A;  4KPX A;  1KRU A;  1YP2 A;  3R3R A;  3FSY A;  4AA7 A;  4AAW A;  2RIJ A;  1KRR A;  3SPT A;  3EG4 A;  3R5D A;  5E3R A;  2IU9 A;  2FKO A;  5DEM A;  4EA7 A;  3GQ7 A;  2WLD A;  2OEG A;  1M8N A;  3VBN A;  3VBK A;  1Z90 A;  4R37 A;  1KGQ A;  3VNP A;  4KNX A;  3R0S A;  2V0L A;  1KRV A; 
#chains in the Genus database with same CATH homology
 2VHE A;  3HSQ A;  2GGQ A;  1XHD A;  3KWE A;  4IHH A;  4M2A A;  3VBP A;  2IC7 A;  1J2Z A;  3KWD A;  1YP4 A;  3BSW A;  1SSM A;  3IXC A;  4K6R A;  1HM0 A;  4HUR A;  4M9C A;  2ICY A;  3BSY A;  3D98 A;  3MQG A;  2V0J A;  4KQL A;  3R5B A;  4FCE A;  1FXJ A;  3SRT A;  3NZ2 A;  2WLC A;  1KGT A;  2AQ9 A;  3Q1X A;  1KK4 A;  2I5K A;  5DG3 A;  3OTM A;  2QIV X;  3GVD A;  2V0K A;  3TWD A;  4KPZ A;  4EA9 A;  2NPO A;  3FTT A;  1HM9 A;  1THJ A;  4ISX A;  3EH0 A;  4HZC A;  4EA8 A;  4G87 A;  1SST A;  5L6S A;  1KQA A;  3V4E A;  5U2K A;  3VBJ A;  4DCL A;  2TDT A;  3CJ8 A;  5DEP A;  2V0H A;  3OTZ A;  1QRL A;  2OI6 A;  1KHR A;  1V67 A;  3C8V A;  1S80 A;  5E3Q A;  1MRL A;  3FSX A;  2WLE A;  4E1K A;  4E75 A;  1LXA A;  2ICX A;  3R1W A;  3P1B A;  3BRK X;  2Q4J A;  2W0V A;  3MC4 A;  3BXY A;  3MQH A;  4MFG A;  2OI5 A;  3I3X A;  1QQ0 A;  1QRE A;  5F42 A;  3R8Y A;  3PMO A;  3R5A A;  2VD4 A;  1MR7 A;  3DJ4 A;  1XAT A;  4HZD A;  1OCX A;  3R2W A;  3D8V A;  3KWC A;  3GOS A;  3JQY A;  1MR9 A;  4EGG A;  3FWW A;  3OW5 A;  3T57 A;  4EAA A;  2IUA A;  4N6A A;  3BFP A;  2WLG A;  3OU9 A;  2W0W A;  4G3Q A;  3GUE A;  4EQY A;  5ADX V;  2P2O A;  2GGO A;  3VBL A;  2OEF A;  3R3I A;  1HM8 A;  3ECT A;  4G3S A;  4E6T A;  4M98 A;  4MZU A;  3HJJ A;  2WLF A;  1HV9 A;  1SSQ A;  2XAT A;  1T3D A;  2QIA A;  3TK8 A;  3ST8 A;  3TV0 A;  2IU8 A;  5L6V A;  3DK5 A;  4IHF A;  3OUP A;  4R7P A;  2JF2 A;  3R5C A;  1KK5 A;  4HCQ A;  1TDT A;  1V3W A;  5E3P A;  1G97 A;  1QRM A;  4G3P A;  4M28 A;  3VBI A;  2OI7 A;  1YP3 A;  3BSS A;  1QRF A;  4N27 A;  2JF3 A;  1G95 A;  4J18 A;  5AFU U;  3P47 A;  1KK6 A;  4EAB A;  4AC3 A;  4N6B A;  4E79 A;  3TIS A;  2QKX A;  3I3A A;  3IGJ A;  4IHG A;  4KNR A;  2V0I A;  3VBM A;  3FSB A;  3TDT A;  4H7O A;  3FSC A;  3FOQ A;  3EEV A;  3FS8 A;  4R36 A;  4E6U A;  4MYO A;  5AFU V;  3TIO A;  4M2B A;  3DHO A;  4J09 A;  4HUS A;  3F1X A;  1QRG A;  4N69 A;  4M99 A;  1FWY A;  5ADX U;  4KPX A;  1KRU A;  1YP2 A;  3R3R A;  3FSY A;  4AA7 A;  4AAW A;  2RIJ A;  1KRR A;  3SPT A;  3EG4 A;  3R5D A;  5E3R A;  2IU9 A;  2FKO A;  5DEM A;  4EA7 A;  2WLD A;  2OEG A;  3VBN A;  3VBK A;  1Z90 A;  4R37 A;  1KGQ A;  3VNP A;  4KNX A;  3R0S A;  2V0L A;  1KRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...