5ADXV

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
SGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5adxV00
4EQYA 1HV9A 1QRMA 3FWWA 2AQ9A 3MC4A 3IXCA 3DHOA 3FSBA 2WLCA 3D8VA 3VBNA 2Q4JA 3F1XA 3HJJA 3JQYA 3OU9A 4HCQA 3KWCA 1S80A 4EAAA 2VHEA 3BSWA 3FSXA 4M28A 1KGQA 1HM0A 3CJ8A 2V0HA 3FSCA 2XATA 3BSYA 2QIVX 4N6BA 2QIAA 3I3XA 3EG4A 1Z90A 1YP2A 2RIJA 1V67A 3TDTA 3R5AA 1G97A 4FCEA 4N69A 4M2BA 3T57A 3I3AA 3BSSA 1SSTA 1KK4A 3MQHA 3R5DA 2WLDA 3C8VA 4J09A 1XATA 2QKXA 1KK5A 5AFUU 4MFGA 5ADXV 3SRTA 5U2KA 4E75A 2NPOA 3R1WA 4KQLA 4G3SA 4N6AA 3OUPA 4EABA 1T3DA 1QRLA 1TDTA 3TV0A 1QQ0A 4HUSA 3NZ2A 2TDTA 3OTMA 1KGTA 1KRUA 1OCXA 4M98A 5DEPA 4EA9A 2VD4A 3GOSA 4DCLA 2W0WA 5E3PA 1THJA 2JF2A 3VNPA 4J18A 1FWYA 4MZUA 3FOQA 3MQGA 3VBIA 4R37A 4HURA 4KNXA 3R5CA 1KRVA 1MR7A 2OEFA 2V0KA 3TWDA 3DJ4A 3BRKX 1KK6A 4HZCA 3OW5A 4MYOA 2V0JA 4E6UA 2OEGA 4E6TA 5ADXU 4G87A 1V3WA 2WLFA 3R3IA 4EA7A 5E3QA 3VBKA 3V4EA 4AC3A 3VBLA 3FS8A 4K6RA 4AA7A 2P2OA 4E1KA 2IU9A 3OTZA 4G3QA 1SSMA 4N27A 4KPXA 5F42A 3PMOA 4AAWA 3GUEA 4R36A 4M2AA 5L6SA 3SPTA 1YP4A 2W0VA 4IHGA 3TIOA 3R5BA 1HM8A 1XHDA 1YP3A 2ICYA 3BXYA 4IHFA 3KWEA 2WLEA 3R0SA 4IHHA 1J2ZA 1KHRA 1LXAA 4EGGA 4G3PA 1HM9A 2V0IA 4EA8A 1KRRA 1G95A 2IC7A 3R2WA 3VBPA 3GVDA 4M99A 1MRLA 2OI5A 5L6VA 3P1BA 3DK5A 2OI7A 2FKOA 2IU8A 3D98A 3TK8A 2V0LA 2GGQA 4E79A 2IUAA 3BFPA 1SSQA 3ECTA 4R7PA 1QRFA 3VBMA 5DG3A 4KPZA 3FTTA 3P47A 1KQAA 3KWDA 5DEMA 3EEVA 4H7OA 3HSQA 1FXJA 3ST8A 3VBJA 3R3RA 2JF3A 3Q1XA 1QREA 2ICXA 2OI6A 2I5KA 2WLGA 3FSYA 4HZDA 3TISA 3EH0A 3R8YA 3IGJA 1QRGA 4ISXA 2GGOA 4M9CA 5AFUV 5E3RA 4KNRA 1MR9A
chains in the Genus database with same CATH superfamily
4EQYA 1HV9A 1L0SA 1QRMA 3FWWA 2AQ9A 3MC4A 3IXCA 3DHOA 3FSBA 2WLCA 3D8VA 3VBNA 2Q4JA 3F1XA 3HJJA 3JQYA 3OU9A 4HCQA 3KWCA 3GQ7A 1S80A 4EAAA 2VHEA 3BSWA 3FSXA 4M28A 1KGQA 1HM0A 3CJ8A 2V0HA 3FSCA 2XATA 3BSYA 2QIVX 4N6BA 2QIAA 3I3XA 3EG4A 1Z90A 1YP2A 2RIJA 1V67A 3TDTA 3R5AA 1G97A 4FCEA 3OGZA 4N69A 3OH1A 4M2BA 3T57A 3I3AA 3BSSA 1SSTA 1KK4A 3MQHA 3R5DA 2WLDA 3C8VA 4J09A 2QKXA 1XATA 1KK5A 5AFUU 4MFGA 5ADXV 3SRTA 5U2KA 4E75A 2NPOA 3R1WA 4KQLA 4G3SA 4N6AA 3OUPA 4EABA 1T3DA 1QRLA 1TDTA 3TV0A 1EWWA 1QQ0A 4HUSA 3NZ2A 2TDTA 3OTMA 1KGTA 1KRUA 1OCXA 4M98A 5DEPA 3SUCA 4EA9A 2VD4A 3GOSA 4DCLA 2W0WA 3OH2A 5E3PA 1THJA 2JF2A 3VNPA 4J18A 1FWYA 4MZUA 3OH4A 3FOQA 3MQGA 1N4IA 4R37A 3VBIA 4HURA 4KNXA 3R5CA 1KRVA 1MR7A 2OEFA 2V0KA 3TWDA 3DJ4A 3BRKX 1KK6A 4HZCA 3OW5A 4MYOA 2V0JA 4E6UA 2OEGA 4E6TA 5ADXU 4G87A 1V3WA 2WLFA 3R3IA 3GQ8A 4EA7A 5E3QA 3VBKA 3V4EA 4AC3A 3VBLA 3FS8A 3GQ9A 4K6RA 4AA7A 2P2OA 4E1KA 2IU9A 3OTZA 4G3QA 1SSMA 4N27A 4KPXA 5F42A 3PMOA 4AAWA 3GUEA 3OH3A 4M2AA 4R36A 5L6SA 3SPTA 1YP4A 2W0VA 4IHGA 3TIOA 3R5BA 1HM8A 1XHDA 1YP3A 2ICYA 3BXYA 4IHFA 3KWEA 2WLEA 3R0SA 4IHHA 1J2ZA 1KHRA 1LXAA 4EGGA 4G3PA 1HM9A 2V0IA 4EA8A 1KRRA 1G95A 2IC7A 3R2WA 3VBPA 3GVDA 4M99A 1MRLA 2OI5A 5L6VA 3P1BA 3GQAA 3DK5A 2OI7A 2FKOA 2IU8A 3D98A 3TK8A 2V0LA 2GGQA 4E79A 2IUAA 3BFPA 1SSQA 1M8NA 3ECTA 4R7PA 1QRFA 3VBMA 5DG3A 4KPZA 3FTTA 3P47A 1KQAA 3KWDA 5DEMA 3EEVA 4H7OA 3HSQA 1FXJA 3ST8A 3VBJA 3R3RA 2JF3A 3Q1XA 1QREA 2ICXA 2OI6A 3OH0A 2I5KA 2WLGA 3FSYA 4HZDA 3TISA 3EH0A 3R8YA 3IGJA 1Z2FA 1QRGA 4ISXA 2GGOA 4M9CA 5AFUV 5E3RA 4KNRA 1MR9A
chains in the Genus database with same CATH topology
4EQYA 1HV9A 1QRMA 3FWWA 2AQ9A 3MC4A 3IXCA 3DHOA 3FSBA 2WLCA 3D8VA 3VBNA 2Q4JA 3F1XA 3HJJA 3JQYA 3OU9A 4HCQA 3KWCA 1S80A 4EAAA 2VHEA 3BSWA 3FSXA 4M28A 1KGQA 1HM0A 3CJ8A 2V0HA 3FSCA 2XATA 3BSYA 2QIVX 4N6BA 2QIAA 3I3XA 3EG4A 1Z90A 1YP2A 2RIJA 1V67A 3TDTA 3R5AA 1G97A 4FCEA 4N69A 4M2BA 3T57A 3I3AA 3BSSA 1SSTA 1KK4A 3MQHA 3R5DA 2WLDA 3C8VA 4J09A 1XATA 2QKXA 1KK5A 5AFUU 4MFGA 5ADXV 3SRTA 5U2KA 4E75A 2NPOA 3R1WA 4KQLA 4G3SA 4N6AA 3OUPA 4EABA 1T3DA 1QRLA 1TDTA 3TV0A 1QQ0A 4HUSA 3NZ2A 2TDTA 3OTMA 1KGTA 1KRUA 1OCXA 4M98A 5DEPA 4EA9A 2VD4A 3GOSA 4DCLA 2W0WA 5E3PA 1THJA 2JF2A 3VNPA 4J18A 1FWYA 4MZUA 3FOQA 3MQGA 3VBIA 4R37A 4HURA 4KNXA 3R5CA 1KRVA 1MR7A 2OEFA 2V0KA 3TWDA 3DJ4A 3BRKX 1KK6A 4HZCA 3OW5A 4MYOA 2V0JA 4E6UA 2OEGA 4E6TA 5ADXU 4G87A 1V3WA 2WLFA 3R3IA 4EA7A 5E3QA 3VBKA 3V4EA 4AC3A 3VBLA 3FS8A 4K6RA 4AA7A 2P2OA 4E1KA 2IU9A 3OTZA 4G3QA 1SSMA 4N27A 4KPXA 5F42A 3PMOA 4AAWA 3GUEA 4R36A 4M2AA 5L6SA 3SPTA 1YP4A 2W0VA 4IHGA 3TIOA 3R5BA 1HM8A 1XHDA 1YP3A 2ICYA 3BXYA 4IHFA 3KWEA 2WLEA 3R0SA 4IHHA 1J2ZA 1KHRA 1LXAA 4EGGA 4G3PA 1HM9A 2V0IA 4EA8A 1KRRA 1G95A 2IC7A 3R2WA 3VBPA 3GVDA 4M99A 1MRLA 2OI5A 5L6VA 3P1BA 3DK5A 2OI7A 2FKOA 2IU8A 3D98A 3TK8A 2V0LA 2GGQA 4E79A 2IUAA 3BFPA 1SSQA 3ECTA 4R7PA 1QRFA 3VBMA 5DG3A 4KPZA 3FTTA 3P47A 1KQAA 3KWDA 5DEMA 3EEVA 4H7OA 3HSQA 1FXJA 3ST8A 3VBJA 3R3RA 2JF3A 3Q1XA 1QREA 2ICXA 2OI6A 2I5KA 2WLGA 3FSYA 4HZDA 3TISA 3EH0A 3R8YA 3IGJA 1QRGA 4ISXA 2GGOA 4M9CA 5AFUV 5E3RA 4KNRA 1MR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQY A;  1HV9 A;  1QRM A;  3FWW A;  2AQ9 A;  3MC4 A;  3IXC A;  3DHO A;  3FSB A;  2WLC A;  3D8V A;  3VBN A;  2Q4J A;  3F1X A;  3HJJ A;  3JQY A;  3OU9 A;  4HCQ A;  3KWC A;  1S80 A;  4EAA A;  2VHE A;  3BSW A;  3FSX A;  4M28 A;  1KGQ A;  1HM0 A;  3CJ8 A;  2V0H A;  3FSC A;  2XAT A;  3BSY A;  2QIV X;  4N6B A;  2QIA A;  3I3X A;  3EG4 A;  1Z90 A;  1YP2 A;  2RIJ A;  1V67 A;  3TDT A;  3R5A A;  1G97 A;  4FCE A;  4N69 A;  4M2B A;  3T57 A;  3I3A A;  3BSS A;  1SST A;  1KK4 A;  3MQH A;  3R5D A;  2WLD A;  3C8V A;  4J09 A;  1XAT A;  2QKX A;  1KK5 A;  5AFU U;  4MFG A;  5ADX V;  3SRT A;  5U2K A;  4E75 A;  2NPO A;  3R1W A;  4KQL A;  4G3S A;  4N6A A;  3OUP A;  4EAB A;  1T3D A;  1QRL A;  1TDT A;  3TV0 A;  1QQ0 A;  4HUS A;  3NZ2 A;  2TDT A;  3OTM A;  1KGT A;  1KRU A;  1OCX A;  4M98 A;  5DEP A;  4EA9 A;  2VD4 A;  3GOS A;  4DCL A;  2W0W A;  5E3P A;  1THJ A;  2JF2 A;  3VNP A;  4J18 A;  1FWY A;  4MZU A;  3FOQ A;  3MQG A;  3VBI A;  4R37 A;  4HUR A;  4KNX A;  3R5C A;  1KRV A;  1MR7 A;  2OEF A;  2V0K A;  3TWD A;  3DJ4 A;  3BRK X;  1KK6 A;  4HZC A;  3OW5 A;  4MYO A;  2V0J A;  4E6U A;  2OEG A;  4E6T A;  5ADX U;  4G87 A;  1V3W A;  2WLF A;  3R3I A;  4EA7 A;  5E3Q A;  3VBK A;  3V4E A;  4AC3 A;  3VBL A;  3FS8 A;  4K6R A;  4AA7 A;  2P2O A;  4E1K A;  2IU9 A;  3OTZ A;  4G3Q A;  1SSM A;  4N27 A;  4KPX A;  5F42 A;  3PMO A;  4AAW A;  3GUE A;  4R36 A;  4M2A A;  5L6S A;  3SPT A;  1YP4 A;  2W0V A;  4IHG A;  3TIO A;  3R5B A;  1HM8 A;  1XHD A;  1YP3 A;  2ICY A;  3BXY A;  4IHF A;  3KWE A;  2WLE A;  3R0S A;  4IHH A;  1J2Z A;  1KHR A;  1LXA A;  4EGG A;  4G3P A;  1HM9 A;  2V0I A;  4EA8 A;  1KRR A;  1G95 A;  2IC7 A;  3R2W A;  3VBP A;  3GVD A;  4M99 A;  1MRL A;  2OI5 A;  5L6V A;  3P1B A;  3DK5 A;  2OI7 A;  2FKO A;  2IU8 A;  3D98 A;  3TK8 A;  2V0L A;  2GGQ A;  4E79 A;  2IUA A;  3BFP A;  1SSQ A;  3ECT A;  4R7P A;  1QRF A;  3VBM A;  5DG3 A;  4KPZ A;  3FTT A;  3P47 A;  1KQA A;  3KWD A;  5DEM A;  3EEV A;  4H7O A;  3HSQ A;  1FXJ A;  3ST8 A;  3VBJ A;  3R3R A;  2JF3 A;  3Q1X A;  1QRE A;  2ICX A;  2OI6 A;  2I5K A;  2WLG A;  3FSY A;  4HZD A;  3TIS A;  3EH0 A;  3R8Y A;  3IGJ A;  1QRG A;  4ISX A;  2GGO A;  4M9C A;  5AFU V;  5E3R A;  4KNR A;  1MR9 A; 
#chains in the Genus database with same CATH topology
 4EQY A;  1HV9 A;  1L0S A;  1QRM A;  3FWW A;  2AQ9 A;  3MC4 A;  3IXC A;  3DHO A;  3FSB A;  2WLC A;  3D8V A;  3VBN A;  2Q4J A;  3F1X A;  3HJJ A;  3JQY A;  3OU9 A;  4HCQ A;  3KWC A;  3GQ7 A;  1S80 A;  4EAA A;  2VHE A;  3BSW A;  3FSX A;  4M28 A;  1KGQ A;  1HM0 A;  3CJ8 A;  2V0H A;  3FSC A;  2XAT A;  3BSY A;  2QIV X;  4N6B A;  2QIA A;  3I3X A;  3EG4 A;  1Z90 A;  1YP2 A;  2RIJ A;  1V67 A;  3TDT A;  3R5A A;  1G97 A;  4FCE A;  3OGZ A;  4N69 A;  3OH1 A;  4M2B A;  3T57 A;  3I3A A;  3BSS A;  1SST A;  1KK4 A;  3MQH A;  3R5D A;  2WLD A;  3C8V A;  4J09 A;  2QKX A;  1XAT A;  1KK5 A;  5AFU U;  4MFG A;  5ADX V;  3SRT A;  5U2K A;  4E75 A;  2NPO A;  3R1W A;  4KQL A;  4G3S A;  4N6A A;  3OUP A;  4EAB A;  1T3D A;  1QRL A;  1TDT A;  3TV0 A;  1EWW A;  1QQ0 A;  4HUS A;  3NZ2 A;  2TDT A;  3OTM A;  1KGT A;  1KRU A;  1OCX A;  4M98 A;  5DEP A;  3SUC A;  4EA9 A;  2VD4 A;  3GOS A;  4DCL A;  2W0W A;  3OH2 A;  5E3P A;  1THJ A;  2JF2 A;  3VNP A;  4J18 A;  1FWY A;  4MZU A;  3OH4 A;  3FOQ A;  3MQG A;  1N4I A;  4R37 A;  3VBI A;  4HUR A;  4KNX A;  3R5C A;  1KRV A;  1MR7 A;  2OEF A;  2V0K A;  3TWD A;  3DJ4 A;  3BRK X;  1KK6 A;  4HZC A;  3OW5 A;  4MYO A;  2V0J A;  4E6U A;  2OEG A;  4E6T A;  5ADX U;  4G87 A;  1V3W A;  2WLF A;  3R3I A;  3GQ8 A;  4EA7 A;  5E3Q A;  3VBK A;  3V4E A;  4AC3 A;  3VBL A;  3FS8 A;  3GQ9 A;  4K6R A;  4AA7 A;  2P2O A;  4E1K A;  2IU9 A;  3OTZ A;  4G3Q A;  1SSM A;  4N27 A;  4KPX A;  5F42 A;  3PMO A;  4AAW A;  3GUE A;  3OH3 A;  4M2A A;  4R36 A;  5L6S A;  3SPT A;  1YP4 A;  2W0V A;  4IHG A;  3TIO A;  3R5B A;  1HM8 A;  1XHD A;  1YP3 A;  2ICY A;  3BXY A;  4IHF A;  3KWE A;  2WLE A;  3R0S A;  4IHH A;  1J2Z A;  1KHR A;  1LXA A;  4EGG A;  4G3P A;  1HM9 A;  2V0I A;  4EA8 A;  1KRR A;  1G95 A;  2IC7 A;  3R2W A;  3VBP A;  3GVD A;  4M99 A;  1MRL A;  2OI5 A;  5L6V A;  3P1B A;  3GQA A;  3DK5 A;  2OI7 A;  2FKO A;  2IU8 A;  3D98 A;  3TK8 A;  2V0L A;  2GGQ A;  4E79 A;  2IUA A;  3BFP A;  1SSQ A;  1M8N A;  3ECT A;  4R7P A;  1QRF A;  3VBM A;  5DG3 A;  4KPZ A;  3FTT A;  3P47 A;  1KQA A;  3KWD A;  5DEM A;  3EEV A;  4H7O A;  3HSQ A;  1FXJ A;  3ST8 A;  3VBJ A;  3R3R A;  2JF3 A;  3Q1X A;  1QRE A;  2ICX A;  2OI6 A;  3OH0 A;  2I5K A;  2WLG A;  3FSY A;  4HZD A;  3TIS A;  3EH0 A;  3R8Y A;  3IGJ A;  1Z2F A;  1QRG A;  4ISX A;  2GGO A;  4M9C A;  5AFU V;  5E3R A;  4KNR A;  1MR9 A; 
#chains in the Genus database with same CATH homology
 4EQY A;  1HV9 A;  1QRM A;  3FWW A;  2AQ9 A;  3MC4 A;  3IXC A;  3DHO A;  3FSB A;  2WLC A;  3D8V A;  3VBN A;  2Q4J A;  3F1X A;  3HJJ A;  3JQY A;  3OU9 A;  4HCQ A;  3KWC A;  1S80 A;  4EAA A;  2VHE A;  3BSW A;  3FSX A;  4M28 A;  1KGQ A;  1HM0 A;  3CJ8 A;  2V0H A;  3FSC A;  2XAT A;  3BSY A;  2QIV X;  4N6B A;  2QIA A;  3I3X A;  3EG4 A;  1Z90 A;  1YP2 A;  2RIJ A;  1V67 A;  3TDT A;  3R5A A;  1G97 A;  4FCE A;  4N69 A;  4M2B A;  3T57 A;  3I3A A;  3BSS A;  1SST A;  1KK4 A;  3MQH A;  3R5D A;  2WLD A;  3C8V A;  4J09 A;  1XAT A;  2QKX A;  1KK5 A;  5AFU U;  4MFG A;  5ADX V;  3SRT A;  5U2K A;  4E75 A;  2NPO A;  3R1W A;  4KQL A;  4G3S A;  4N6A A;  3OUP A;  4EAB A;  1T3D A;  1QRL A;  1TDT A;  3TV0 A;  1QQ0 A;  4HUS A;  3NZ2 A;  2TDT A;  3OTM A;  1KGT A;  1KRU A;  1OCX A;  4M98 A;  5DEP A;  4EA9 A;  2VD4 A;  3GOS A;  4DCL A;  2W0W A;  5E3P A;  1THJ A;  2JF2 A;  3VNP A;  4J18 A;  1FWY A;  4MZU A;  3FOQ A;  3MQG A;  3VBI A;  4R37 A;  4HUR A;  4KNX A;  3R5C A;  1KRV A;  1MR7 A;  2OEF A;  2V0K A;  3TWD A;  3DJ4 A;  3BRK X;  1KK6 A;  4HZC A;  3OW5 A;  4MYO A;  2V0J A;  4E6U A;  2OEG A;  4E6T A;  5ADX U;  4G87 A;  1V3W A;  2WLF A;  3R3I A;  4EA7 A;  5E3Q A;  3VBK A;  3V4E A;  4AC3 A;  3VBL A;  3FS8 A;  4K6R A;  4AA7 A;  2P2O A;  4E1K A;  2IU9 A;  3OTZ A;  4G3Q A;  1SSM A;  4N27 A;  4KPX A;  5F42 A;  3PMO A;  4AAW A;  3GUE A;  4R36 A;  4M2A A;  5L6S A;  3SPT A;  1YP4 A;  2W0V A;  4IHG A;  3TIO A;  3R5B A;  1HM8 A;  1XHD A;  1YP3 A;  2ICY A;  3BXY A;  4IHF A;  3KWE A;  2WLE A;  3R0S A;  4IHH A;  1J2Z A;  1KHR A;  1LXA A;  4EGG A;  4G3P A;  1HM9 A;  2V0I A;  4EA8 A;  1KRR A;  1G95 A;  2IC7 A;  3R2W A;  3VBP A;  3GVD A;  4M99 A;  1MRL A;  2OI5 A;  5L6V A;  3P1B A;  3DK5 A;  2OI7 A;  2FKO A;  2IU8 A;  3D98 A;  3TK8 A;  2V0L A;  2GGQ A;  4E79 A;  2IUA A;  3BFP A;  1SSQ A;  3ECT A;  4R7P A;  1QRF A;  3VBM A;  5DG3 A;  4KPZ A;  3FTT A;  3P47 A;  1KQA A;  3KWD A;  5DEM A;  3EEV A;  4H7O A;  3HSQ A;  1FXJ A;  3ST8 A;  3VBJ A;  3R3R A;  2JF3 A;  3Q1X A;  1QRE A;  2ICX A;  2OI6 A;  2I5K A;  2WLG A;  3FSY A;  4HZD A;  3TIS A;  3EH0 A;  3R8Y A;  3IGJ A;  1QRG A;  4ISX A;  2GGO A;  4M9C A;  5AFU V;  5E3R A;  4KNR A;  1MR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...