5ADXV

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
SGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5adxV00
2V0IA 4HCQA 5L6SA 4MFGA 5L6VA 2W0VA 1QRGA 4N27A 4AC3A 2JF3A 1HV9A 3EG4A 3R3IA 2TDTA 3OW5A 5AFUV 3TISA 3TIOA 5ADXU 1KGTA 1YP2A 1QREA 3VBMA 4G87A 3VBKA 4EGGA 3BRKX 4E75A 3FS8A 1KRVA 1KGQA 2RIJA 1HM8A 4KPZA 4MYOA 3T57A 2ICYA 5E3QA 3HJJA 3BSSA 1QRLA 2NPOA 1HM0A 1THJA 1FXJA 2IUAA 3R5BA 3VNPA 4EABA 1LXAA 2XATA 3R5CA 2WLGA 4J09A 4HZCA 4N69A 3BSYA 2WLFA 1XATA 2OEGA 3FSCA 3IGJA 3OTMA 4MZUA 3EEVA 5DEMA 2AQ9A 2W0WA 3R5DA 4G3SA 3R8YA 2JF2A 4G3PA 5DG3A 2VD4A 4N6BA 4KPXA 4E79A 4E6UA 4EAAA 4J18A 2Q4JA 4HZDA 4KQLA 2GGOA 3V4EA 3I3AA 2WLCA 3F1XA 1G95A 4M98A 1XHDA 4M28A 1SSTA 2P2OA 4AA7A 3NZ2A 4M2BA 2V0KA 3MQGA 3VBNA 1QRFA 3DHOA 4IHHA 4EA7A 3BSWA 3OTZA 2VHEA 3R5AA 5E3PA 3MC4A 3P47A 2OI5A 3TK8A 1FWYA 2QKXA 1S80A 2IC7A 1MR7A 3DK5A 5AFUU 5E3RA 3VBIA 1V3WA 1KRUA 5F42A 1KK6A 3VBJA 3IXCA 2V0LA 4EA9A 3OUPA 2I5KA 2IU8A 3I3XA 4EA8A 4KNRA 1KQAA 1OCXA 4H7OA 4E6TA 1T3DA 1V67A 3SRTA 2V0JA 3FSYA 3FTTA 3BFPA 4IHGA 5ADXV 3Q1XA 1MR9A 4IHFA 3GUEA 3JQYA 4R36A 1SSQA 3BXYA 3ST8A 3DJ4A 3TDTA 1QRMA 3R1WA 2FKOA 4AAWA 4KNXA 3C8VA 3FSXA 3KWEA 3VBPA 2WLEA 4R37A 4FCEA 3OU9A 2OEFA 3CJ8A 3MQHA 4HURA 3VBLA 1YP4A 1J2ZA 4M99A 3D98A 2QIVX 3TWDA 2GGQA 3D8VA 4M9CA 3FWWA 3GOSA 1Z90A 3FOQA 3ECTA 5U2KA 3HSQA 3R2WA 1KK4A 1YP3A 2V0HA 2OI7A 2WLDA 1KHRA 1SSMA 3FSBA 4N6AA 3KWDA 2OI6A 3R0SA 3KWCA 4G3QA 2IU9A 1G97A 1KRRA 4ISXA 4K6RA 1HM9A 3EH0A 3R3RA 4E1KA 5DEPA 4EQYA 3SPTA 4DCLA 4M2AA 1MRLA 4R7PA 1KK5A 4HUSA 2ICXA 2QIAA 3PMOA 3GVDA 3TV0A 1QQ0A 1TDTA 3P1BA
chains in the Genus database with same CATH superfamily
2V0IA 4HCQA 5L6SA 4MFGA 5L6VA 2W0VA 1QRGA 4N27A 4AC3A 2JF3A 1HV9A 3EG4A 3R3IA 2TDTA 3OW5A 5AFUV 3TISA 3TIOA 5ADXU 1KGTA 1YP2A 1QREA 3VBMA 4G87A 3VBKA 4EGGA 3BRKX 1M8NA 3FS8A 4E75A 1KRVA 1KGQA 2RIJA 1HM8A 4KPZA 4MYOA 3T57A 2ICYA 5E3QA 3HJJA 3BSSA 1QRLA 2NPOA 1HM0A 1THJA 1FXJA 2IUAA 3R5BA 3VNPA 4EABA 1LXAA 2XATA 3R5CA 2WLGA 4J09A 4HZCA 4N69A 3BSYA 2WLFA 1XATA 2OEGA 3FSCA 3IGJA 3OTMA 4MZUA 3EEVA 5DEMA 2AQ9A 2W0WA 3R5DA 3OH4A 4G3SA 3R8YA 2JF2A 4G3PA 5DG3A 2VD4A 4N6BA 4KPXA 4E79A 4E6UA 4EAAA 3GQ8A 4J18A 2Q4JA 4HZDA 4KQLA 1EWWA 2GGOA 3V4EA 3I3AA 2WLCA 3F1XA 1G95A 4M98A 1XHDA 4M28A 1SSTA 2P2OA 3OH3A 4AA7A 3GQ7A 3NZ2A 4M2BA 2V0KA 3MQGA 3VBNA 1QRFA 3DHOA 4IHHA 4EA7A 3BSWA 3OTZA 2VHEA 3R5AA 5E3PA 3MC4A 3OH1A 3P47A 2OI5A 3TK8A 1FWYA 2QKXA 1S80A 2IC7A 1MR7A 3DK5A 5AFUU 5E3RA 3VBIA 1V3WA 1KRUA 5F42A 1KK6A 3VBJA 3IXCA 2V0LA 4EA9A 3OUPA 2I5KA 2IU8A 3I3XA 4EA8A 4KNRA 1KQAA 1OCXA 4H7OA 4E6TA 1T3DA 1V67A 3SRTA 2V0JA 3FSYA 3FTTA 3BFPA 4IHGA 5ADXV 3Q1XA 1MR9A 4IHFA 3GUEA 3JQYA 4R36A 1SSQA 3BXYA 3ST8A 3DJ4A 3TDTA 1QRMA 3R1WA 2FKOA 4AAWA 4KNXA 3C8VA 3FSXA 3KWEA 3VBPA 2WLEA 4R37A 4FCEA 3OU9A 2OEFA 3CJ8A 3MQHA 3OGZA 4HURA 3VBLA 1YP4A 1J2ZA 4M99A 3D98A 2QIVX 3TWDA 2GGQA 3D8VA 4M9CA 3GQ9A 3OH2A 3FWWA 1Z2FA 3GOSA 1Z90A 3FOQA 3ECTA 5U2KA 3HSQA 3R2WA 1KK4A 1YP3A 2V0HA 2OI7A 2WLDA 1KHRA 1SSMA 3FSBA 3SUCA 4N6AA 3KWDA 2OI6A 3R0SA 3KWCA 4G3QA 2IU9A 1G97A 1KRRA 1L0SA 4ISXA 1HM9A 3EH0A 3R3RA 4K6RA 4E1KA 3GQAA 5DEPA 4EQYA 3SPTA 4DCLA 4M2AA 1MRLA 4R7PA 1KK5A 4HUSA 2ICXA 2QIAA 3PMOA 3GVDA 1N4IA 1QQ0A 1TDTA 3TV0A 3OH0A 3P1BA
chains in the Genus database with same CATH topology
2V0IA 4HCQA 5L6SA 4MFGA 5L6VA 2W0VA 1QRGA 4N27A 4AC3A 2JF3A 1HV9A 3EG4A 3R3IA 2TDTA 3OW5A 5AFUV 3TISA 3TIOA 5ADXU 1KGTA 1YP2A 1QREA 3VBMA 4G87A 3VBKA 4EGGA 3BRKX 4E75A 3FS8A 1KRVA 1KGQA 2RIJA 1HM8A 4KPZA 4MYOA 3T57A 2ICYA 5E3QA 3HJJA 3BSSA 1QRLA 2NPOA 1HM0A 1THJA 1FXJA 2IUAA 3R5BA 3VNPA 4EABA 1LXAA 2XATA 3R5CA 2WLGA 4J09A 4HZCA 4N69A 3BSYA 2WLFA 1XATA 2OEGA 3FSCA 3IGJA 3OTMA 4MZUA 3EEVA 5DEMA 2AQ9A 2W0WA 3R5DA 4G3SA 3R8YA 2JF2A 4G3PA 5DG3A 2VD4A 4N6BA 4KPXA 4E79A 4E6UA 4EAAA 4J18A 2Q4JA 4HZDA 4KQLA 2GGOA 3V4EA 3I3AA 2WLCA 3F1XA 1G95A 4M98A 1XHDA 4M28A 1SSTA 2P2OA 4AA7A 3NZ2A 4M2BA 2V0KA 3MQGA 3VBNA 1QRFA 3DHOA 4IHHA 4EA7A 3BSWA 3OTZA 2VHEA 3R5AA 5E3PA 3MC4A 3P47A 2OI5A 3TK8A 1FWYA 2QKXA 1S80A 2IC7A 1MR7A 3DK5A 5AFUU 5E3RA 3VBIA 1V3WA 1KRUA 5F42A 1KK6A 3VBJA 3IXCA 2V0LA 4EA9A 3OUPA 2I5KA 2IU8A 3I3XA 4EA8A 4KNRA 1KQAA 1OCXA 4H7OA 4E6TA 1T3DA 1V67A 3SRTA 2V0JA 3FSYA 3FTTA 3BFPA 4IHGA 5ADXV 3Q1XA 1MR9A 4IHFA 3GUEA 3JQYA 4R36A 1SSQA 3BXYA 3ST8A 3DJ4A 3TDTA 1QRMA 3R1WA 2FKOA 4AAWA 4KNXA 3C8VA 3FSXA 3KWEA 3VBPA 2WLEA 4R37A 4FCEA 3OU9A 2OEFA 3CJ8A 3MQHA 4HURA 3VBLA 1YP4A 1J2ZA 4M99A 3D98A 2QIVX 3TWDA 2GGQA 3D8VA 4M9CA 3FWWA 3GOSA 1Z90A 3FOQA 3ECTA 5U2KA 3HSQA 3R2WA 1KK4A 1YP3A 2V0HA 2OI7A 2WLDA 1KHRA 1SSMA 3FSBA 4N6AA 3KWDA 2OI6A 3R0SA 3KWCA 4G3QA 2IU9A 1G97A 1KRRA 4ISXA 4K6RA 1HM9A 3EH0A 3R3RA 4E1KA 5DEPA 4EQYA 3SPTA 4DCLA 4M2AA 1MRLA 4R7PA 1KK5A 4HUSA 2ICXA 2QIAA 3PMOA 3GVDA 3TV0A 1QQ0A 1TDTA 3P1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0I A;  4HCQ A;  5L6S A;  4MFG A;  5L6V A;  2W0V A;  1QRG A;  4N27 A;  4AC3 A;  2JF3 A;  1HV9 A;  3EG4 A;  3R3I A;  2TDT A;  3OW5 A;  5AFU V;  3TIS A;  3TIO A;  5ADX U;  1KGT A;  1YP2 A;  1QRE A;  3VBM A;  4G87 A;  3VBK A;  4EGG A;  3BRK X;  4E75 A;  3FS8 A;  1KRV A;  1KGQ A;  2RIJ A;  1HM8 A;  4KPZ A;  4MYO A;  3T57 A;  2ICY A;  5E3Q A;  3HJJ A;  3BSS A;  1QRL A;  2NPO A;  1HM0 A;  1THJ A;  1FXJ A;  2IUA A;  3R5B A;  3VNP A;  4EAB A;  1LXA A;  2XAT A;  3R5C A;  2WLG A;  4J09 A;  4HZC A;  4N69 A;  3BSY A;  2WLF A;  1XAT A;  2OEG A;  3FSC A;  3IGJ A;  3OTM A;  4MZU A;  3EEV A;  5DEM A;  2AQ9 A;  2W0W A;  3R5D A;  4G3S A;  3R8Y A;  2JF2 A;  4G3P A;  5DG3 A;  2VD4 A;  4N6B A;  4KPX A;  4E79 A;  4E6U A;  4EAA A;  4J18 A;  2Q4J A;  4HZD A;  4KQL A;  2GGO A;  3V4E A;  3I3A A;  2WLC A;  3F1X A;  1G95 A;  4M98 A;  1XHD A;  4M28 A;  1SST A;  2P2O A;  4AA7 A;  3NZ2 A;  4M2B A;  2V0K A;  3MQG A;  3VBN A;  1QRF A;  3DHO A;  4IHH A;  4EA7 A;  3BSW A;  3OTZ A;  2VHE A;  3R5A A;  5E3P A;  3MC4 A;  3P47 A;  2OI5 A;  3TK8 A;  1FWY A;  2QKX A;  1S80 A;  2IC7 A;  1MR7 A;  3DK5 A;  5AFU U;  5E3R A;  3VBI A;  1V3W A;  1KRU A;  5F42 A;  1KK6 A;  3VBJ A;  3IXC A;  2V0L A;  4EA9 A;  3OUP A;  2I5K A;  2IU8 A;  3I3X A;  4EA8 A;  4KNR A;  1KQA A;  1OCX A;  4H7O A;  4E6T A;  1T3D A;  1V67 A;  3SRT A;  2V0J A;  3FSY A;  3FTT A;  3BFP A;  4IHG A;  5ADX V;  3Q1X A;  1MR9 A;  4IHF A;  3GUE A;  3JQY A;  4R36 A;  1SSQ A;  3BXY A;  3ST8 A;  3DJ4 A;  3TDT A;  1QRM A;  3R1W A;  2FKO A;  4AAW A;  4KNX A;  3C8V A;  3FSX A;  3KWE A;  3VBP A;  2WLE A;  4R37 A;  4FCE A;  3OU9 A;  2OEF A;  3CJ8 A;  3MQH A;  4HUR A;  3VBL A;  1YP4 A;  1J2Z A;  4M99 A;  3D98 A;  2QIV X;  3TWD A;  2GGQ A;  3D8V A;  4M9C A;  3FWW A;  3GOS A;  1Z90 A;  3FOQ A;  3ECT A;  5U2K A;  3HSQ A;  3R2W A;  1KK4 A;  1YP3 A;  2V0H A;  2OI7 A;  2WLD A;  1KHR A;  1SSM A;  3FSB A;  4N6A A;  3KWD A;  2OI6 A;  3R0S A;  3KWC A;  4G3Q A;  2IU9 A;  1G97 A;  1KRR A;  4ISX A;  4K6R A;  1HM9 A;  3EH0 A;  3R3R A;  4E1K A;  5DEP A;  4EQY A;  3SPT A;  4DCL A;  4M2A A;  1MRL A;  4R7P A;  1KK5 A;  4HUS A;  2ICX A;  2QIA A;  3PMO A;  3GVD A;  3TV0 A;  1QQ0 A;  1TDT A;  3P1B A; 
#chains in the Genus database with same CATH topology
 2V0I A;  4HCQ A;  5L6S A;  4MFG A;  5L6V A;  2W0V A;  1QRG A;  4N27 A;  4AC3 A;  2JF3 A;  1HV9 A;  3EG4 A;  3R3I A;  2TDT A;  3OW5 A;  5AFU V;  3TIS A;  3TIO A;  5ADX U;  1KGT A;  1YP2 A;  1QRE A;  3VBM A;  4G87 A;  3VBK A;  4EGG A;  3BRK X;  1M8N A;  3FS8 A;  4E75 A;  1KRV A;  1KGQ A;  2RIJ A;  1HM8 A;  4KPZ A;  4MYO A;  3T57 A;  2ICY A;  5E3Q A;  3HJJ A;  3BSS A;  1QRL A;  2NPO A;  1HM0 A;  1THJ A;  1FXJ A;  2IUA A;  3R5B A;  3VNP A;  4EAB A;  1LXA A;  2XAT A;  3R5C A;  2WLG A;  4J09 A;  4HZC A;  4N69 A;  3BSY A;  2WLF A;  1XAT A;  2OEG A;  3FSC A;  3IGJ A;  3OTM A;  4MZU A;  3EEV A;  5DEM A;  2AQ9 A;  2W0W A;  3R5D A;  3OH4 A;  4G3S A;  3R8Y A;  2JF2 A;  4G3P A;  5DG3 A;  2VD4 A;  4N6B A;  4KPX A;  4E79 A;  4E6U A;  4EAA A;  3GQ8 A;  4J18 A;  2Q4J A;  4HZD A;  4KQL A;  1EWW A;  2GGO A;  3V4E A;  3I3A A;  2WLC A;  3F1X A;  1G95 A;  4M98 A;  1XHD A;  4M28 A;  1SST A;  2P2O A;  3OH3 A;  4AA7 A;  3GQ7 A;  3NZ2 A;  4M2B A;  2V0K A;  3MQG A;  3VBN A;  1QRF A;  3DHO A;  4IHH A;  4EA7 A;  3BSW A;  3OTZ A;  2VHE A;  3R5A A;  5E3P A;  3MC4 A;  3OH1 A;  3P47 A;  2OI5 A;  3TK8 A;  1FWY A;  2QKX A;  1S80 A;  2IC7 A;  1MR7 A;  3DK5 A;  5AFU U;  5E3R A;  3VBI A;  1V3W A;  1KRU A;  5F42 A;  1KK6 A;  3VBJ A;  3IXC A;  2V0L A;  4EA9 A;  3OUP A;  2I5K A;  2IU8 A;  3I3X A;  4EA8 A;  4KNR A;  1KQA A;  1OCX A;  4H7O A;  4E6T A;  1T3D A;  1V67 A;  3SRT A;  2V0J A;  3FSY A;  3FTT A;  3BFP A;  4IHG A;  5ADX V;  3Q1X A;  1MR9 A;  4IHF A;  3GUE A;  3JQY A;  4R36 A;  1SSQ A;  3BXY A;  3ST8 A;  3DJ4 A;  3TDT A;  1QRM A;  3R1W A;  2FKO A;  4AAW A;  4KNX A;  3C8V A;  3FSX A;  3KWE A;  3VBP A;  2WLE A;  4R37 A;  4FCE A;  3OU9 A;  2OEF A;  3CJ8 A;  3MQH A;  3OGZ A;  4HUR A;  3VBL A;  1YP4 A;  1J2Z A;  4M99 A;  3D98 A;  2QIV X;  3TWD A;  2GGQ A;  3D8V A;  4M9C A;  3GQ9 A;  3OH2 A;  3FWW A;  1Z2F A;  3GOS A;  1Z90 A;  3FOQ A;  3ECT A;  5U2K A;  3HSQ A;  3R2W A;  1KK4 A;  1YP3 A;  2V0H A;  2OI7 A;  2WLD A;  1KHR A;  1SSM A;  3FSB A;  3SUC A;  4N6A A;  3KWD A;  2OI6 A;  3R0S A;  3KWC A;  4G3Q A;  2IU9 A;  1G97 A;  1KRR A;  1L0S A;  4ISX A;  1HM9 A;  3EH0 A;  3R3R A;  4K6R A;  4E1K A;  3GQA A;  5DEP A;  4EQY A;  3SPT A;  4DCL A;  4M2A A;  1MRL A;  4R7P A;  1KK5 A;  4HUS A;  2ICX A;  2QIA A;  3PMO A;  3GVD A;  1N4I A;  1QQ0 A;  1TDT A;  3TV0 A;  3OH0 A;  3P1B A; 
#chains in the Genus database with same CATH homology
 2V0I A;  4HCQ A;  5L6S A;  4MFG A;  5L6V A;  2W0V A;  1QRG A;  4N27 A;  4AC3 A;  2JF3 A;  1HV9 A;  3EG4 A;  3R3I A;  2TDT A;  3OW5 A;  5AFU V;  3TIS A;  3TIO A;  5ADX U;  1KGT A;  1YP2 A;  1QRE A;  3VBM A;  4G87 A;  3VBK A;  4EGG A;  3BRK X;  4E75 A;  3FS8 A;  1KRV A;  1KGQ A;  2RIJ A;  1HM8 A;  4KPZ A;  4MYO A;  3T57 A;  2ICY A;  5E3Q A;  3HJJ A;  3BSS A;  1QRL A;  2NPO A;  1HM0 A;  1THJ A;  1FXJ A;  2IUA A;  3R5B A;  3VNP A;  4EAB A;  1LXA A;  2XAT A;  3R5C A;  2WLG A;  4J09 A;  4HZC A;  4N69 A;  3BSY A;  2WLF A;  1XAT A;  2OEG A;  3FSC A;  3IGJ A;  3OTM A;  4MZU A;  3EEV A;  5DEM A;  2AQ9 A;  2W0W A;  3R5D A;  4G3S A;  3R8Y A;  2JF2 A;  4G3P A;  5DG3 A;  2VD4 A;  4N6B A;  4KPX A;  4E79 A;  4E6U A;  4EAA A;  4J18 A;  2Q4J A;  4HZD A;  4KQL A;  2GGO A;  3V4E A;  3I3A A;  2WLC A;  3F1X A;  1G95 A;  4M98 A;  1XHD A;  4M28 A;  1SST A;  2P2O A;  4AA7 A;  3NZ2 A;  4M2B A;  2V0K A;  3MQG A;  3VBN A;  1QRF A;  3DHO A;  4IHH A;  4EA7 A;  3BSW A;  3OTZ A;  2VHE A;  3R5A A;  5E3P A;  3MC4 A;  3P47 A;  2OI5 A;  3TK8 A;  1FWY A;  2QKX A;  1S80 A;  2IC7 A;  1MR7 A;  3DK5 A;  5AFU U;  5E3R A;  3VBI A;  1V3W A;  1KRU A;  5F42 A;  1KK6 A;  3VBJ A;  3IXC A;  2V0L A;  4EA9 A;  3OUP A;  2I5K A;  2IU8 A;  3I3X A;  4EA8 A;  4KNR A;  1KQA A;  1OCX A;  4H7O A;  4E6T A;  1T3D A;  1V67 A;  3SRT A;  2V0J A;  3FSY A;  3FTT A;  3BFP A;  4IHG A;  5ADX V;  3Q1X A;  1MR9 A;  4IHF A;  3GUE A;  3JQY A;  4R36 A;  1SSQ A;  3BXY A;  3ST8 A;  3DJ4 A;  3TDT A;  1QRM A;  3R1W A;  2FKO A;  4AAW A;  4KNX A;  3C8V A;  3FSX A;  3KWE A;  3VBP A;  2WLE A;  4R37 A;  4FCE A;  3OU9 A;  2OEF A;  3CJ8 A;  3MQH A;  4HUR A;  3VBL A;  1YP4 A;  1J2Z A;  4M99 A;  3D98 A;  2QIV X;  3TWD A;  2GGQ A;  3D8V A;  4M9C A;  3FWW A;  3GOS A;  1Z90 A;  3FOQ A;  3ECT A;  5U2K A;  3HSQ A;  3R2W A;  1KK4 A;  1YP3 A;  2V0H A;  2OI7 A;  2WLD A;  1KHR A;  1SSM A;  3FSB A;  4N6A A;  3KWD A;  2OI6 A;  3R0S A;  3KWC A;  4G3Q A;  2IU9 A;  1G97 A;  1KRR A;  4ISX A;  4K6R A;  1HM9 A;  3EH0 A;  3R3R A;  4E1K A;  5DEP A;  4EQY A;  3SPT A;  4DCL A;  4M2A A;  1MRL A;  4R7P A;  1KK5 A;  4HUS A;  2ICX A;  2QIA A;  3PMO A;  3GVD A;  3TV0 A;  1QQ0 A;  1TDT A;  3P1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...