1M8NA

Choristoneura fumiferana (spruce budworm) antifreeze protein isoform 501
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
120
structure length
120
Chain Sequence
GTCVNTNSQITANSQCVKSTATNCYIDNSQLVDTSICTRSQYSDANVKKSVTTDCNIDKSQVYLTTCTGSQYNGIYIRSSTTTGTSISGPGCSISTCTITRGVATPAAACKISGCSLSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A beta-helical antifreeze protein isoform with increased activity: structural and functional insights
pubmed doi rcsb
source organism Choristoneura fumiferana
molecule tags Antifreeze protein
molecule keywords Antifreeze protein isoform 501
total genus 55
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1m8nA00
1EWWA 3GQ7A 3GQ9A 3GQ8A 1M8NA 1N4IA 1Z2FA 3SUCA 1L0SA 3GQAA
chains in the Genus database with same CATH superfamily
1KRVA 1QRLA 2OEGA 5AFUV 3VBMA 2RIJA 3D98A 1KGTA 2OI6A 4MYOA 3OH4A 3KWDA 2QKXA 3OW5A 3P1BA 3R5AA 3R5BA 1YP2A 1MR7A 4HCQA 3SPTA 4KPXA 1TDTA 3FSCA 4G3QA 3R0SA 3BRKX 4E6TA 1QRMA 3ECTA 1LXAA 3R2WA 2V0LA 2WLDA 1THJA 2GGQA 3FWWA 1YP3A 3GUEA 3OH0A 4IHGA 3I3XA 4MFGA 4HUSA 3OH1A 3OH2A 3IGJA 4EA9A 4N6AA 1KQAA 4EAAA 2JF3A 2NPOA 4EQYA 4KQLA 1N4IA 3FS8A 3R5DA 3VBJA 3D8VA 5L6SA 2IC7A 4E6UA 3SRTA 2OI5A 3R5CA 1MRLA 1QREA 4M99A 3FSYA 4N27A 1XHDA 5AFUU 3IXCA 3PMOA 1G97A 1Z2FA 2OEFA 3SUCA 3HJJA 5ADXU 1HV9A 3GQAA 2IUAA 1KRUA 4IHFA 4M98A 3VNPA 3JQYA 1T3DA 1QQ0A 2ICYA 4M2AA 2IU9A 1SSTA 4E79A 3OH3A 3MC4A 5DEPA 4G87A 3EG4A 3KWEA 4EA7A 5ADXV 1SSMA 3DHOA 3GQ8A 1M8NA 4J18A 1FWYA 2IU8A 1QRFA 5U2KA 2WLCA 3CJ8A 4G3SA 4R7PA 4AAWA 4M2BA 1L0SA 2V0JA 3ST8A 2ICXA 4E1KA 2WLGA 3TISA 5DG3A 3FSXA 1SSQA 3GQ9A 2XATA 5L6VA 4KNRA 5F42A 1J2ZA 2AQ9A 2Q4JA 4HZCA 3I3AA 1V3WA 3MQGA 4HZDA 3R1WA 3R3RA 3TWDA 3DJ4A 4EGGA 3VBNA 3R3IA 1KK6A 4KPZA 3VBKA 1MR9A 3EH0A 1KK4A 3TK8A 4K6RA 2V0KA 3GVDA 2JF2A 4M28A 1Z90A 3HSQA 2P2OA 1V67A 3EEVA 1QRGA 3GOSA 4N69A 3TIOA 2TDTA 2W0WA 5DEMA 3R8YA 5E3PA 3VBIA 2GGOA 4N6BA 4AC3A 1KK5A 2OI7A 3BSSA 1KRRA 1KGQA 3T57A 3OU9A 4FCEA 3GQ7A 4EA8A 3MQHA 1OCXA 4G3PA 1FXJA 1HM9A 2V0HA 3BXYA 2VD4A 3FTTA 2WLFA 4AA7A 1G95A 3F1XA 4R36A 4DCLA 3BFPA 3KWCA 2VHEA 4M9CA 3V4EA 1YP4A 3FOQA 2FKOA 3OUPA 3C8VA 3OGZA 2QIAA 4ISXA 4KNXA 2V0IA 4R37A 1XATA 5E3RA 3DK5A 3FSBA 3TV0A 3NZ2A 1EWWA 3Q1XA 4HURA 4E75A 3P47A 3OTZA 3BSWA 3VBLA 1S80A 3VBPA 3BSYA 1HM8A 2WLEA 2I5KA 1HM0A 4J09A 5E3QA 2QIVX 4H7OA 4MZUA 3TDTA 4EABA 4IHHA 3OTMA 2W0VA 1KHRA
chains in the Genus database with same CATH topology
1EWWA 3GQ7A 3GQ9A 3GQ8A 1M8NA 1N4IA 1EZGA 1Z2FA 3SUCA 1L0SA 3GQAA 1L1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWW A;  3GQ7 A;  3GQ9 A;  3GQ8 A;  1M8N A;  1N4I A;  1Z2F A;  3SUC A;  1L0S A;  3GQA A; 
#chains in the Genus database with same CATH topology
 1KRV A;  1QRL A;  2OEG A;  5AFU V;  3VBM A;  2RIJ A;  3D98 A;  1KGT A;  2OI6 A;  4MYO A;  3OH4 A;  3KWD A;  2QKX A;  3OW5 A;  3P1B A;  3R5A A;  3R5B A;  1YP2 A;  1MR7 A;  4HCQ A;  3SPT A;  4KPX A;  1TDT A;  3FSC A;  4G3Q A;  3R0S A;  3BRK X;  4E6T A;  1QRM A;  3ECT A;  1LXA A;  3R2W A;  2V0L A;  2WLD A;  1THJ A;  2GGQ A;  3FWW A;  1YP3 A;  3GUE A;  3OH0 A;  4IHG A;  3I3X A;  4MFG A;  4HUS A;  3OH1 A;  3OH2 A;  3IGJ A;  4EA9 A;  4N6A A;  1KQA A;  4EAA A;  2JF3 A;  2NPO A;  4EQY A;  4KQL A;  1N4I A;  3FS8 A;  3R5D A;  3VBJ A;  3D8V A;  5L6S A;  2IC7 A;  4E6U A;  3SRT A;  2OI5 A;  3R5C A;  1MRL A;  1QRE A;  4M99 A;  3FSY A;  4N27 A;  1XHD A;  5AFU U;  3IXC A;  3PMO A;  1G97 A;  1Z2F A;  2OEF A;  3SUC A;  3HJJ A;  5ADX U;  1HV9 A;  3GQA A;  2IUA A;  1KRU A;  4IHF A;  4M98 A;  3VNP A;  3JQY A;  1T3D A;  1QQ0 A;  2ICY A;  4M2A A;  2IU9 A;  1SST A;  4E79 A;  3OH3 A;  3MC4 A;  5DEP A;  4G87 A;  3EG4 A;  3KWE A;  4EA7 A;  5ADX V;  1SSM A;  3DHO A;  3GQ8 A;  1M8N A;  4J18 A;  1FWY A;  2IU8 A;  1QRF A;  5U2K A;  2WLC A;  3CJ8 A;  4G3S A;  4R7P A;  4AAW A;  4M2B A;  1L0S A;  2V0J A;  3ST8 A;  2ICX A;  4E1K A;  2WLG A;  3TIS A;  5DG3 A;  3FSX A;  1SSQ A;  3GQ9 A;  2XAT A;  5L6V A;  4KNR A;  5F42 A;  1J2Z A;  2AQ9 A;  2Q4J A;  4HZC A;  3I3A A;  1V3W A;  3MQG A;  4HZD A;  3R1W A;  3R3R A;  3TWD A;  3DJ4 A;  4EGG A;  3VBN A;  3R3I A;  1KK6 A;  4KPZ A;  3VBK A;  1MR9 A;  3EH0 A;  1KK4 A;  3TK8 A;  4K6R A;  2V0K A;  3GVD A;  2JF2 A;  4M28 A;  1Z90 A;  3HSQ A;  2P2O A;  1V67 A;  3EEV A;  1QRG A;  3GOS A;  4N69 A;  3TIO A;  2TDT A;  2W0W A;  5DEM A;  3R8Y A;  5E3P A;  3VBI A;  2GGO A;  4N6B A;  4AC3 A;  1KK5 A;  2OI7 A;  3BSS A;  1KRR A;  1KGQ A;  3T57 A;  3OU9 A;  4FCE A;  3GQ7 A;  4EA8 A;  3MQH A;  1OCX A;  4G3P A;  1FXJ A;  1HM9 A;  2V0H A;  3BXY A;  2VD4 A;  3FTT A;  2WLF A;  4AA7 A;  1G95 A;  3F1X A;  4R36 A;  4DCL A;  3BFP A;  3KWC A;  2VHE A;  4M9C A;  3V4E A;  1YP4 A;  3FOQ A;  2FKO A;  3OUP A;  3C8V A;  3OGZ A;  2QIA A;  4ISX A;  4KNX A;  2V0I A;  4R37 A;  1XAT A;  5E3R A;  3DK5 A;  3FSB A;  3TV0 A;  3NZ2 A;  1EWW A;  3Q1X A;  4HUR A;  4E75 A;  3P47 A;  3OTZ A;  3BSW A;  3VBL A;  1S80 A;  3VBP A;  3BSY A;  1HM8 A;  2WLE A;  2I5K A;  1HM0 A;  4J09 A;  5E3Q A;  2QIV X;  4H7O A;  4MZU A;  3TDT A;  4EAB A;  4IHH A;  3OTM A;  2W0V A;  1KHR A; 
#chains in the Genus database with same CATH homology
 1EWW A;  3GQ7 A;  3GQ9 A;  3GQ8 A;  1M8N A;  1N4I A;  1EZG A;  1Z2F A;  3SUC A;  1L0S A;  3GQA A;  1L1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...