4EQYA

Crystal structure of acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase from burkholderia thailandensis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
261
structure length
261
Chain Sequence
b'SRIHPTAIIEPGAQLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVQDAGVTTLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQAGGDGDAAVKALVDFVESSQRGIIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 105
structure length 261
sequence length 261
chains with identical sequence B, C, E, F, G
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 4eqyA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4eqyA01
1TDTA 2QIAA 2OEGA 2OI6A 1KK6A 1QRFA 1KRRA 3R5AA 3JQYA 1J2ZA 3ECTA 2V0KA 4KPZA 4M2AA 3I3AA 2ICXA 1QQ0A 1XATA 2XATA 2IU9A 1MR9A 1MR7A 3OTMA 3FTTA 2GGOA 3EG4A 3GVDA 4AAWA 4N6BA 4K6RA 3HSQA 3FSYA 4E1KA 2WLFA 4AC3A 3D8VA 4KQLA 2QIVX 2WLDA 4M99A 1V67A 1FXJA 3TK8A 3BSWA 2V0IA 3DJ4A 1KRUA 1LXAA 1HM9A 1MRLA 3FSBA 4HZDA 1FWYA 1KQAA 2OI7A 2W0VA 4N6AA 3VBMA 3I3XA 1V3WA 2P2OA 3EH0A 5E3RA 4DCLA 4MYOA 2OEFA 3R5BA 3GOSA 3OUPA 1OCXA 4J18A 2GGQA 3PMOA 3ST8A 5DEPA 5ADXU 2WLGA 2WLEA 1G95A 3F1XA 5F42A 4M9CA 4G3QA 2V0JA 4N27A 3IXCA 5AFUV 2AQ9A 3GUEA 3IGJA 4IHGA 1SSQA 4KPXA 3VBIA 3DK5A 3P47A 4EQYA 2VHEA 3SRTA 4R37A 1SSMA 1KK4A 1THJA 4M2BA 3R8YA 3FWWA 1SSTA 3BFPA 3VBLA 1HM8A 1KK5A 1Z90A 3R3RA 3VNPA 3FSCA 1YP3A 3MQHA 2TDTA 4R36A 3FOQA 4E6TA 4G3PA 4G87A 3SPTA 2VD4A 3P1BA 3VBKA 2NPOA 3R2WA 3FS8A 4HCQA 3TDTA 1HV9A 3HJJA 4MZUA 1KGTA 3R5DA 2RIJA 2Q4JA 4IHHA 3V4EA 3VBNA 4EA9A 4R7PA 5L6SA 2IC7A 3FSXA 5L6VA 3DHOA 4ISXA 4E6UA 1QREA 4M98A 4G3SA 3TWDA 1HM0A 4KNXA 3TV0A 4EA8A 4HZCA 4AA7A 2V0LA 1G97A 1KRVA 1YP4A 2V0HA 3BSYA 4H7OA 3VBPA 3MQGA 3BXYA 2FKOA 4HURA 4N69A 4EA7A 1YP2A 1KHRA 3KWEA 4M28A 4KNRA 4FCEA 5U2KA 2I5KA 2OI5A 3T57A 5E3QA 4E79A 2IUAA 5DG3A 1XHDA 3KWCA 3TIOA 3BSSA 3C8VA 3TISA 3R3IA 2IU8A 4MFGA 3OW5A 3NZ2A 4IHFA 1T3DA 5E3PA 2W0WA 2QKXA 1S80A 3KWDA 2WLCA 1KGQA 3OU9A 3VBJA 2JF3A 1QRGA 4J09A 5AFUU 4HUSA 3BRKX 2ICYA 3EEVA 4EAAA 3R1WA 4EGGA 3CJ8A 1QRMA 5DEMA 4E75A 3MC4A 3D98A 5ADXV 3OTZA 3Q1XA 1QRLA 2JF2A 3R0SA 4EABA 3R5CA
chains in the Genus database with same CATH superfamily
1TDTA 2QIAA 2OEGA 2OI6A 1KK6A 1QRFA 1KRRA 3R5AA 3JQYA 1J2ZA 3ECTA 2V0KA 4KPZA 4M2AA 3I3AA 2ICXA 1QQ0A 1XATA 2XATA 2IU9A 1MR9A 1MR7A 3OTMA 3FTTA 2GGOA 3EG4A 3GVDA 4AAWA 4N6BA 4K6RA 3HSQA 3FSYA 3SUCA 4E1KA 2WLFA 4AC3A 3D8VA 4KQLA 2QIVX 2WLDA 4M99A 1V67A 1FXJA 3TK8A 3BSWA 2V0IA 3DJ4A 1KRUA 1LXAA 1HM9A 1MRLA 3FSBA 4HZDA 1FWYA 1Z2FA 1KQAA 2OI7A 2W0VA 4N6AA 3VBMA 3I3XA 1V3WA 2P2OA 3EH0A 3OH3A 5E3RA 4MYOA 2OEFA 3R5BA 4DCLA 1EWWA 3GOSA 3OUPA 1OCXA 4J18A 2GGQA 3PMOA 3ST8A 5DEPA 5ADXU 2WLGA 2WLEA 1G95A 3F1XA 5F42A 4M9CA 4G3QA 2V0JA 4N27A 3IXCA 5AFUV 2AQ9A 3GUEA 3IGJA 4IHGA 1SSQA 4KPXA 3VBIA 3DK5A 3P47A 4EQYA 2VHEA 3SRTA 4R37A 1SSMA 1KK4A 1THJA 4M2BA 3R8YA 3FWWA 1N4IA 1SSTA 3BFPA 3VBLA 1HM8A 1KK5A 1M8NA 1Z90A 3OH1A 3R3RA 3VNPA 3FSCA 3OH4A 1YP3A 3MQHA 2TDTA 4R36A 3FOQA 4E6TA 4G3PA 4G87A 3SPTA 2VD4A 3P1BA 3VBKA 2NPOA 3R2WA 3FS8A 4HCQA 3TDTA 1HV9A 3HJJA 4MZUA 1KGTA 3GQAA 2RIJA 2Q4JA 3R5DA 4IHHA 3V4EA 3VBNA 4EA9A 4R7PA 5L6SA 3OH0A 2IC7A 3FSXA 5L6VA 3DHOA 4ISXA 4E6UA 1QREA 4M98A 4G3SA 3TWDA 1HM0A 4KNXA 3TV0A 4EA8A 4HZCA 1L0SA 3OGZA 4AA7A 2V0LA 1G97A 1KRVA 1YP4A 2V0HA 3BSYA 4H7OA 3VBPA 3MQGA 3BXYA 2FKOA 4HURA 4N69A 3OH2A 4EA7A 1YP2A 1KHRA 3KWEA 4M28A 4KNRA 4FCEA 5U2KA 2I5KA 2OI5A 3T57A 5E3QA 4E79A 2IUAA 5DG3A 1XHDA 3KWCA 3TIOA 3BSSA 3C8VA 3TISA 3R3IA 2IU8A 4MFGA 3OW5A 3NZ2A 4IHFA 1T3DA 3GQ9A 5E3PA 2W0WA 2QKXA 1S80A 3KWDA 2WLCA 1KGQA 3OU9A 3VBJA 2JF3A 1QRGA 4J09A 5AFUU 3GQ7A 4HUSA 3BRKX 2ICYA 3EEVA 4EAAA 3R1WA 4EGGA 3CJ8A 3GQ8A 1QRMA 5DEMA 4E75A 3MC4A 3D98A 5ADXV 3OTZA 3Q1XA 1QRLA 2JF2A 3R0SA 4EABA 3R5CA
chains in the Genus database with same CATH topology
1TDTA 2QIAA 2OEGA 2OI6A 1KK6A 1QRFA 1KRRA 3R5AA 3JQYA 1J2ZA 3ECTA 2V0KA 4KPZA 4M2AA 3I3AA 2ICXA 1QQ0A 1XATA 2XATA 2IU9A 1MR9A 1MR7A 3OTMA 3FTTA 2GGOA 3EG4A 3GVDA 4AAWA 4N6BA 4K6RA 3HSQA 3FSYA 4E1KA 2WLFA 4AC3A 3D8VA 4KQLA 2QIVX 2WLDA 4M99A 1V67A 1FXJA 3TK8A 3BSWA 2V0IA 3DJ4A 1KRUA 1LXAA 1HM9A 1MRLA 3FSBA 4HZDA 1FWYA 1KQAA 2OI7A 2W0VA 4N6AA 3VBMA 3I3XA 1V3WA 2P2OA 3EH0A 5E3RA 4DCLA 4MYOA 2OEFA 3R5BA 3GOSA 3OUPA 1OCXA 4J18A 2GGQA 3PMOA 3ST8A 5DEPA 5ADXU 2WLGA 2WLEA 1G95A 3F1XA 5F42A 4M9CA 4G3QA 2V0JA 4N27A 3IXCA 5AFUV 2AQ9A 3GUEA 3IGJA 4IHGA 1SSQA 4KPXA 3VBIA 3DK5A 3P47A 4EQYA 2VHEA 3SRTA 4R37A 1SSMA 1KK4A 1THJA 4M2BA 3R8YA 3FWWA 1SSTA 3BFPA 3VBLA 1HM8A 1KK5A 1Z90A 3R3RA 3VNPA 3FSCA 1YP3A 3MQHA 2TDTA 4R36A 3FOQA 4E6TA 4G3PA 4G87A 3SPTA 2VD4A 3P1BA 3VBKA 2NPOA 3R2WA 3FS8A 4HCQA 3TDTA 1HV9A 3HJJA 4MZUA 1KGTA 3R5DA 2RIJA 2Q4JA 4IHHA 3V4EA 3VBNA 4EA9A 4R7PA 5L6SA 2IC7A 3FSXA 5L6VA 3DHOA 4ISXA 4E6UA 1QREA 4M98A 4G3SA 3TWDA 1HM0A 4KNXA 3TV0A 4EA8A 4HZCA 4AA7A 2V0LA 1G97A 1KRVA 1YP4A 2V0HA 3BSYA 4H7OA 3VBPA 3MQGA 3BXYA 2FKOA 4HURA 4N69A 4EA7A 1YP2A 1KHRA 3KWEA 4M28A 4KNRA 4FCEA 5U2KA 2I5KA 2OI5A 3T57A 5E3QA 4E79A 2IUAA 5DG3A 1XHDA 3KWCA 3TIOA 3BSSA 3C8VA 3TISA 3R3IA 2IU8A 4MFGA 3OW5A 3NZ2A 4IHFA 1T3DA 5E3PA 2W0WA 2QKXA 1S80A 3KWDA 2WLCA 1KGQA 3OU9A 3VBJA 2JF3A 1QRGA 4J09A 5AFUU 4HUSA 3BRKX 2ICYA 3EEVA 4EAAA 3R1WA 4EGGA 3CJ8A 1QRMA 5DEMA 4E75A 3MC4A 3D98A 5ADXV 3OTZA 3Q1XA 1QRLA 2JF2A 3R0SA 4EABA 3R5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDT A;  2QIA A;  2OEG A;  2OI6 A;  1KK6 A;  1QRF A;  1KRR A;  3R5A A;  3JQY A;  1J2Z A;  3ECT A;  2V0K A;  4KPZ A;  4M2A A;  3I3A A;  2ICX A;  1QQ0 A;  1XAT A;  2XAT A;  2IU9 A;  1MR9 A;  1MR7 A;  3OTM A;  3FTT A;  2GGO A;  3EG4 A;  3GVD A;  4AAW A;  4N6B A;  4K6R A;  3HSQ A;  3FSY A;  4E1K A;  2WLF A;  4AC3 A;  3D8V A;  4KQL A;  2QIV X;  2WLD A;  4M99 A;  1V67 A;  1FXJ A;  3TK8 A;  3BSW A;  2V0I A;  3DJ4 A;  1KRU A;  1LXA A;  1HM9 A;  1MRL A;  3FSB A;  4HZD A;  1FWY A;  1KQA A;  2OI7 A;  2W0V A;  4N6A A;  3VBM A;  3I3X A;  1V3W A;  2P2O A;  3EH0 A;  5E3R A;  4DCL A;  4MYO A;  2OEF A;  3R5B A;  3GOS A;  3OUP A;  1OCX A;  4J18 A;  2GGQ A;  3PMO A;  3ST8 A;  5DEP A;  5ADX U;  2WLG A;  2WLE A;  1G95 A;  3F1X A;  5F42 A;  4M9C A;  4G3Q A;  2V0J A;  4N27 A;  3IXC A;  5AFU V;  2AQ9 A;  3GUE A;  3IGJ A;  4IHG A;  1SSQ A;  4KPX A;  3VBI A;  3DK5 A;  3P47 A;  4EQY A;  2VHE A;  3SRT A;  4R37 A;  1SSM A;  1KK4 A;  1THJ A;  4M2B A;  3R8Y A;  3FWW A;  1SST A;  3BFP A;  3VBL A;  1HM8 A;  1KK5 A;  1Z90 A;  3R3R A;  3VNP A;  3FSC A;  1YP3 A;  3MQH A;  2TDT A;  4R36 A;  3FOQ A;  4E6T A;  4G3P A;  4G87 A;  3SPT A;  2VD4 A;  3P1B A;  3VBK A;  2NPO A;  3R2W A;  3FS8 A;  4HCQ A;  3TDT A;  1HV9 A;  3HJJ A;  4MZU A;  1KGT A;  3R5D A;  2RIJ A;  2Q4J A;  4IHH A;  3V4E A;  3VBN A;  4EA9 A;  4R7P A;  5L6S A;  2IC7 A;  3FSX A;  5L6V A;  3DHO A;  4ISX A;  4E6U A;  1QRE A;  4M98 A;  4G3S A;  3TWD A;  1HM0 A;  4KNX A;  3TV0 A;  4EA8 A;  4HZC A;  4AA7 A;  2V0L A;  1G97 A;  1KRV A;  1YP4 A;  2V0H A;  3BSY A;  4H7O A;  3VBP A;  3MQG A;  3BXY A;  2FKO A;  4HUR A;  4N69 A;  4EA7 A;  1YP2 A;  1KHR A;  3KWE A;  4M28 A;  4KNR A;  4FCE A;  5U2K A;  2I5K A;  2OI5 A;  3T57 A;  5E3Q A;  4E79 A;  2IUA A;  5DG3 A;  1XHD A;  3KWC A;  3TIO A;  3BSS A;  3C8V A;  3TIS A;  3R3I A;  2IU8 A;  4MFG A;  3OW5 A;  3NZ2 A;  4IHF A;  1T3D A;  5E3P A;  2W0W A;  2QKX A;  1S80 A;  3KWD A;  2WLC A;  1KGQ A;  3OU9 A;  3VBJ A;  2JF3 A;  1QRG A;  4J09 A;  5AFU U;  4HUS A;  3BRK X;  2ICY A;  3EEV A;  4EAA A;  3R1W A;  4EGG A;  3CJ8 A;  1QRM A;  5DEM A;  4E75 A;  3MC4 A;  3D98 A;  5ADX V;  3OTZ A;  3Q1X A;  1QRL A;  2JF2 A;  3R0S A;  4EAB A;  3R5C A; 
#chains in the Genus database with same CATH topology
 1TDT A;  2QIA A;  2OEG A;  2OI6 A;  1KK6 A;  1QRF A;  1KRR A;  3R5A A;  3JQY A;  1J2Z A;  3ECT A;  2V0K A;  4KPZ A;  4M2A A;  3I3A A;  2ICX A;  1QQ0 A;  1XAT A;  2XAT A;  2IU9 A;  1MR9 A;  1MR7 A;  3OTM A;  3FTT A;  2GGO A;  3EG4 A;  3GVD A;  4AAW A;  4N6B A;  4K6R A;  3HSQ A;  3FSY A;  3SUC A;  4E1K A;  2WLF A;  4AC3 A;  3D8V A;  4KQL A;  2QIV X;  2WLD A;  4M99 A;  1V67 A;  1FXJ A;  3TK8 A;  3BSW A;  2V0I A;  3DJ4 A;  1KRU A;  1LXA A;  1HM9 A;  1MRL A;  3FSB A;  4HZD A;  1FWY A;  1Z2F A;  1KQA A;  2OI7 A;  2W0V A;  4N6A A;  3VBM A;  3I3X A;  1V3W A;  2P2O A;  3EH0 A;  3OH3 A;  5E3R A;  4MYO A;  2OEF A;  3R5B A;  4DCL A;  1EWW A;  3GOS A;  3OUP A;  1OCX A;  4J18 A;  2GGQ A;  3PMO A;  3ST8 A;  5DEP A;  5ADX U;  2WLG A;  2WLE A;  1G95 A;  3F1X A;  5F42 A;  4M9C A;  4G3Q A;  2V0J A;  4N27 A;  3IXC A;  5AFU V;  2AQ9 A;  3GUE A;  3IGJ A;  4IHG A;  1SSQ A;  4KPX A;  3VBI A;  3DK5 A;  3P47 A;  4EQY A;  2VHE A;  3SRT A;  4R37 A;  1SSM A;  1KK4 A;  1THJ A;  4M2B A;  3R8Y A;  3FWW A;  1N4I A;  1SST A;  3BFP A;  3VBL A;  1HM8 A;  1KK5 A;  1M8N A;  1Z90 A;  3OH1 A;  3R3R A;  3VNP A;  3FSC A;  3OH4 A;  1YP3 A;  3MQH A;  2TDT A;  4R36 A;  3FOQ A;  4E6T A;  4G3P A;  4G87 A;  3SPT A;  2VD4 A;  3P1B A;  3VBK A;  2NPO A;  3R2W A;  3FS8 A;  4HCQ A;  3TDT A;  1HV9 A;  3HJJ A;  4MZU A;  1KGT A;  3GQA A;  2RIJ A;  2Q4J A;  3R5D A;  4IHH A;  3V4E A;  3VBN A;  4EA9 A;  4R7P A;  5L6S A;  3OH0 A;  2IC7 A;  3FSX A;  5L6V A;  3DHO A;  4ISX A;  4E6U A;  1QRE A;  4M98 A;  4G3S A;  3TWD A;  1HM0 A;  4KNX A;  3TV0 A;  4EA8 A;  4HZC A;  1L0S A;  3OGZ A;  4AA7 A;  2V0L A;  1G97 A;  1KRV A;  1YP4 A;  2V0H A;  3BSY A;  4H7O A;  3VBP A;  3MQG A;  3BXY A;  2FKO A;  4HUR A;  4N69 A;  3OH2 A;  4EA7 A;  1YP2 A;  1KHR A;  3KWE A;  4M28 A;  4KNR A;  4FCE A;  5U2K A;  2I5K A;  2OI5 A;  3T57 A;  5E3Q A;  4E79 A;  2IUA A;  5DG3 A;  1XHD A;  3KWC A;  3TIO A;  3BSS A;  3C8V A;  3TIS A;  3R3I A;  2IU8 A;  4MFG A;  3OW5 A;  3NZ2 A;  4IHF A;  1T3D A;  3GQ9 A;  5E3P A;  2W0W A;  2QKX A;  1S80 A;  3KWD A;  2WLC A;  1KGQ A;  3OU9 A;  3VBJ A;  2JF3 A;  1QRG A;  4J09 A;  5AFU U;  3GQ7 A;  4HUS A;  3BRK X;  2ICY A;  3EEV A;  4EAA A;  3R1W A;  4EGG A;  3CJ8 A;  3GQ8 A;  1QRM A;  5DEM A;  4E75 A;  3MC4 A;  3D98 A;  5ADX V;  3OTZ A;  3Q1X A;  1QRL A;  2JF2 A;  3R0S A;  4EAB A;  3R5C A; 
#chains in the Genus database with same CATH homology
 1TDT A;  2QIA A;  2OEG A;  2OI6 A;  1KK6 A;  1QRF A;  1KRR A;  3R5A A;  3JQY A;  1J2Z A;  3ECT A;  2V0K A;  4KPZ A;  4M2A A;  3I3A A;  2ICX A;  1QQ0 A;  1XAT A;  2XAT A;  2IU9 A;  1MR9 A;  1MR7 A;  3OTM A;  3FTT A;  2GGO A;  3EG4 A;  3GVD A;  4AAW A;  4N6B A;  4K6R A;  3HSQ A;  3FSY A;  4E1K A;  2WLF A;  4AC3 A;  3D8V A;  4KQL A;  2QIV X;  2WLD A;  4M99 A;  1V67 A;  1FXJ A;  3TK8 A;  3BSW A;  2V0I A;  3DJ4 A;  1KRU A;  1LXA A;  1HM9 A;  1MRL A;  3FSB A;  4HZD A;  1FWY A;  1KQA A;  2OI7 A;  2W0V A;  4N6A A;  3VBM A;  3I3X A;  1V3W A;  2P2O A;  3EH0 A;  5E3R A;  4DCL A;  4MYO A;  2OEF A;  3R5B A;  3GOS A;  3OUP A;  1OCX A;  4J18 A;  2GGQ A;  3PMO A;  3ST8 A;  5DEP A;  5ADX U;  2WLG A;  2WLE A;  1G95 A;  3F1X A;  5F42 A;  4M9C A;  4G3Q A;  2V0J A;  4N27 A;  3IXC A;  5AFU V;  2AQ9 A;  3GUE A;  3IGJ A;  4IHG A;  1SSQ A;  4KPX A;  3VBI A;  3DK5 A;  3P47 A;  4EQY A;  2VHE A;  3SRT A;  4R37 A;  1SSM A;  1KK4 A;  1THJ A;  4M2B A;  3R8Y A;  3FWW A;  1SST A;  3BFP A;  3VBL A;  1HM8 A;  1KK5 A;  1Z90 A;  3R3R A;  3VNP A;  3FSC A;  1YP3 A;  3MQH A;  2TDT A;  4R36 A;  3FOQ A;  4E6T A;  4G3P A;  4G87 A;  3SPT A;  2VD4 A;  3P1B A;  3VBK A;  2NPO A;  3R2W A;  3FS8 A;  4HCQ A;  3TDT A;  1HV9 A;  3HJJ A;  4MZU A;  1KGT A;  3R5D A;  2RIJ A;  2Q4J A;  4IHH A;  3V4E A;  3VBN A;  4EA9 A;  4R7P A;  5L6S A;  2IC7 A;  3FSX A;  5L6V A;  3DHO A;  4ISX A;  4E6U A;  1QRE A;  4M98 A;  4G3S A;  3TWD A;  1HM0 A;  4KNX A;  3TV0 A;  4EA8 A;  4HZC A;  4AA7 A;  2V0L A;  1G97 A;  1KRV A;  1YP4 A;  2V0H A;  3BSY A;  4H7O A;  3VBP A;  3MQG A;  3BXY A;  2FKO A;  4HUR A;  4N69 A;  4EA7 A;  1YP2 A;  1KHR A;  3KWE A;  4M28 A;  4KNR A;  4FCE A;  5U2K A;  2I5K A;  2OI5 A;  3T57 A;  5E3Q A;  4E79 A;  2IUA A;  5DG3 A;  1XHD A;  3KWC A;  3TIO A;  3BSS A;  3C8V A;  3TIS A;  3R3I A;  2IU8 A;  4MFG A;  3OW5 A;  3NZ2 A;  4IHF A;  1T3D A;  5E3P A;  2W0W A;  2QKX A;  1S80 A;  3KWD A;  2WLC A;  1KGQ A;  3OU9 A;  3VBJ A;  2JF3 A;  1QRG A;  4J09 A;  5AFU U;  4HUS A;  3BRK X;  2ICY A;  3EEV A;  4EAA A;  3R1W A;  4EGG A;  3CJ8 A;  1QRM A;  5DEM A;  4E75 A;  3MC4 A;  3D98 A;  5ADX V;  3OTZ A;  3Q1X A;  1QRL A;  2JF2 A;  3R0S A;  4EAB A;  3R5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...