4EQYA

Crystal structure of acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase from burkholderia thailandensis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
261
structure length
261
Chain Sequence
SRIHPTAIIEPGAQLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVQDAGVTTLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQAGGDGDAAVKALVDFVESSQRGIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
total genus 105
structure length 261
sequence length 261
chains with identical sequence B, C, E, F, G
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 4eqyA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4eqyA01
2OI6A 4IHGA 3R0SA 1QREA 2IU9A 3HSQA 3R5AA 3VNPA 4DCLA 1V67A 3DJ4A 4E1KA 3CJ8A 4G3PA 1J2ZA 4R36A 3R5DA 4M28A 1KGTA 1KRVA 3VBNA 2GGQA 2OI7A 3R3IA 3VBIA 4IHFA 3OTZA 1HM0A 4EAAA 1S80A 2OEGA 5DEMA 2VD4A 4KPXA 1XATA 3MC4A 1QQ0A 4E75A 4EABA 3Q1XA 4MYOA 4R7PA 3TIOA 4HZDA 5L6VA 4MFGA 2GGOA 3FTTA 3SPTA 2W0WA 1YP3A 4EGGA 1KQAA 3NZ2A 3OUPA 2I5KA 3C8VA 2IUAA 3D98A 3P47A 3VBMA 3GVDA 2V0IA 5ADXU 3HJJA 4M2AA 2IU8A 3FSCA 2TDTA 4E79A 2JF3A 3TISA 3BSYA 2W0VA 4G3QA 1OCXA 4FCEA 4G87A 3TV0A 3ST8A 1V3WA 1MRLA 1SSQA 3PMOA 2WLDA 1QRGA 3OW5A 5AFUV 1SSTA 3EEVA 4IHHA 2FKOA 1HV9A 3R5BA 3TDTA 3VBKA 3OTMA 4AA7A 2ICXA 3KWDA 3DHOA 2QKXA 1KK4A 3BXYA 3D8VA 4H7OA 2V0KA 3FSYA 2XATA 4KQLA 4EA8A 3FSBA 3FS8A 3R1WA 4M98A 3VBPA 1YP4A 4J09A 4EA7A 4E6TA 1MR7A 3SRTA 4M9CA 5E3RA 1KHRA 3DK5A 3IXCA 3ECTA 5E3PA 5DG3A 1YP2A 4HUSA 3EG4A 2OI5A 5DEPA 5F42A 2WLGA 4E6UA 2Q4JA 1MR9A 1XHDA 4M2BA 2AQ9A 1KK6A 5ADXV 3BFPA 2ICYA 3MQHA 2V0LA 3TK8A 4J18A 1KRRA 1G95A 1THJA 4KNXA 3P1BA 5AFUU 2P2OA 2RIJA 3F1XA 4K6RA 1TDTA 2IC7A 4EQYA 3KWCA 3BSSA 1KRUA 1KGQA 2QIAA 2JF2A 3I3XA 5E3QA 4AAWA 3BSWA 3FOQA 3R2WA 2WLEA 4M99A 3V4EA 2NPOA 3VBLA 3GOSA 4G3SA 3T57A 3VBJA 3FSXA 3IGJA 3BRKX 3OU9A 3GUEA 3EH0A 4R37A 1G97A 3JQYA 4HCQA 4ISXA 4N69A 4AC3A 5L6SA 4KPZA 4MZUA 1FWYA 3I3AA 1Z90A 1HM9A 1QRFA 1T3DA 5U2KA 2WLFA 1SSMA 1LXAA 3KWEA 4KNRA 3MQGA 1FXJA 3TWDA 1KK5A 2WLCA 4N6AA 1QRMA 3FWWA 4N27A 2OEFA 2QIVX 4N6BA 1HM8A 3R8YA 4HZCA 3R3RA 3R5CA 2VHEA 4HURA 2V0HA 4EA9A 1QRLA 2V0JA
chains in the Genus database with same CATH superfamily
2OI6A 4IHGA 3R0SA 1QREA 2IU9A 3HSQA 3R5AA 3VNPA 4DCLA 1V67A 3DJ4A 4E1KA 3CJ8A 4G3PA 1J2ZA 4R36A 1N4IA 3R5DA 4M28A 1KGTA 1KRVA 3VBNA 2GGQA 2OI7A 3R3IA 3VBIA 4IHFA 3OTZA 1HM0A 4EAAA 1S80A 2OEGA 5DEMA 2VD4A 4KPXA 1XATA 3MC4A 1QQ0A 4E75A 4EABA 3Q1XA 4MYOA 4R7PA 3TIOA 3GQ8A 4HZDA 5L6VA 4MFGA 2GGOA 3FTTA 1L0SA 3SPTA 2W0WA 1YP3A 4EGGA 3OH3A 1KQAA 3NZ2A 3OUPA 2I5KA 3C8VA 2IUAA 3D98A 3P47A 3VBMA 3GVDA 2V0IA 5ADXU 3HJJA 4M2AA 2IU8A 3FSCA 2TDTA 4E79A 2JF3A 3TISA 3BSYA 2W0VA 4G3QA 1OCXA 4FCEA 4G87A 3TV0A 3ST8A 1V3WA 1MRLA 1SSQA 3PMOA 2WLDA 1QRGA 3OW5A 5AFUV 1SSTA 3EEVA 4IHHA 2FKOA 1HV9A 3R5BA 3TDTA 3VBKA 3OTMA 4AA7A 2ICXA 3KWDA 3DHOA 2QKXA 1KK4A 3BXYA 3D8VA 4H7OA 2V0KA 3FSYA 2XATA 4KQLA 4EA8A 3FSBA 3FS8A 3OH1A 3R1WA 4M98A 3VBPA 1YP4A 4J09A 4EA7A 4E6TA 1MR7A 3SRTA 4M9CA 5E3RA 1KHRA 3DK5A 3OGZA 3IXCA 3ECTA 3OH4A 5E3PA 5DG3A 1YP2A 4HUSA 3EG4A 2OI5A 5DEPA 5F42A 2WLGA 4E6UA 2Q4JA 1MR9A 1XHDA 4M2BA 2AQ9A 1KK6A 3GQ7A 5ADXV 3BFPA 2ICYA 3MQHA 2V0LA 3TK8A 4J18A 1KRRA 1G95A 1THJA 3OH0A 4KNXA 3P1BA 5AFUU 2P2OA 2RIJA 3F1XA 3GQAA 4K6RA 1TDTA 2IC7A 4EQYA 3KWCA 3BSSA 1EWWA 1KRUA 1KGQA 2QIAA 2JF2A 3I3XA 5E3QA 4AAWA 3BSWA 3FOQA 3R2WA 3GQ9A 2WLEA 4M99A 3V4EA 2NPOA 3VBLA 3GOSA 4G3SA 3T57A 3VBJA 3FSXA 3IGJA 3BRKX 3OU9A 3GUEA 3EH0A 4R37A 1G97A 3JQYA 4HCQA 4ISXA 4N69A 4AC3A 5L6SA 4KPZA 4MZUA 1FWYA 3I3AA 1Z90A 1HM9A 1QRFA 1T3DA 5U2KA 2WLFA 1SSMA 1LXAA 3KWEA 3OH2A 3MQGA 1Z2FA 4KNRA 1FXJA 3TWDA 1KK5A 2WLCA 4N6AA 1QRMA 3FWWA 4N27A 1M8NA 2QIVX 2OEFA 4N6BA 1HM8A 3R8YA 4HZCA 3R3RA 3R5CA 3SUCA 2VHEA 4HURA 2V0HA 4EA9A 1QRLA 2V0JA
chains in the Genus database with same CATH topology
2OI6A 4IHGA 3R0SA 1QREA 2IU9A 3HSQA 3R5AA 3VNPA 4DCLA 1V67A 3DJ4A 4E1KA 3CJ8A 4G3PA 1J2ZA 4R36A 3R5DA 4M28A 1KGTA 1KRVA 3VBNA 2GGQA 2OI7A 3R3IA 3VBIA 4IHFA 3OTZA 1HM0A 4EAAA 1S80A 2OEGA 5DEMA 2VD4A 4KPXA 1XATA 3MC4A 1QQ0A 4E75A 4EABA 3Q1XA 4MYOA 4R7PA 3TIOA 4HZDA 5L6VA 4MFGA 2GGOA 3FTTA 3SPTA 2W0WA 1YP3A 4EGGA 1KQAA 3NZ2A 3OUPA 2I5KA 3C8VA 2IUAA 3D98A 3P47A 3VBMA 3GVDA 2V0IA 5ADXU 3HJJA 4M2AA 2IU8A 3FSCA 2TDTA 4E79A 2JF3A 3TISA 3BSYA 2W0VA 4G3QA 1OCXA 4FCEA 4G87A 3TV0A 3ST8A 1V3WA 1MRLA 1SSQA 3PMOA 2WLDA 1QRGA 3OW5A 5AFUV 1SSTA 3EEVA 4IHHA 2FKOA 1HV9A 3R5BA 3TDTA 3VBKA 3OTMA 4AA7A 2ICXA 3KWDA 3DHOA 2QKXA 1KK4A 3BXYA 3D8VA 4H7OA 2V0KA 3FSYA 2XATA 4KQLA 4EA8A 3FSBA 3FS8A 3R1WA 4M98A 3VBPA 1YP4A 4J09A 4EA7A 4E6TA 1MR7A 3SRTA 4M9CA 5E3RA 1KHRA 3DK5A 3IXCA 3ECTA 5E3PA 5DG3A 1YP2A 4HUSA 3EG4A 2OI5A 5DEPA 5F42A 2WLGA 4E6UA 2Q4JA 1MR9A 1XHDA 4M2BA 2AQ9A 1KK6A 5ADXV 3BFPA 2ICYA 3MQHA 2V0LA 3TK8A 4J18A 1KRRA 1G95A 1THJA 4KNXA 3P1BA 5AFUU 2P2OA 2RIJA 3F1XA 4K6RA 1TDTA 2IC7A 4EQYA 3KWCA 3BSSA 1KRUA 1KGQA 2QIAA 2JF2A 3I3XA 5E3QA 4AAWA 3BSWA 3FOQA 3R2WA 2WLEA 4M99A 3V4EA 2NPOA 3VBLA 3GOSA 4G3SA 3T57A 3VBJA 3FSXA 3IGJA 3BRKX 3OU9A 3GUEA 3EH0A 4R37A 1G97A 3JQYA 4HCQA 4ISXA 4N69A 4AC3A 5L6SA 4KPZA 4MZUA 1FWYA 3I3AA 1Z90A 1HM9A 1QRFA 1T3DA 5U2KA 2WLFA 1SSMA 1LXAA 3KWEA 4KNRA 3MQGA 1FXJA 3TWDA 1KK5A 2WLCA 4N6AA 1QRMA 3FWWA 4N27A 2OEFA 2QIVX 4N6BA 1HM8A 3R8YA 4HZCA 3R3RA 3R5CA 2VHEA 4HURA 2V0HA 4EA9A 1QRLA 2V0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI6 A;  4IHG A;  3R0S A;  1QRE A;  2IU9 A;  3HSQ A;  3R5A A;  3VNP A;  4DCL A;  1V67 A;  3DJ4 A;  4E1K A;  3CJ8 A;  4G3P A;  1J2Z A;  4R36 A;  3R5D A;  4M28 A;  1KGT A;  1KRV A;  3VBN A;  2GGQ A;  2OI7 A;  3R3I A;  3VBI A;  4IHF A;  3OTZ A;  1HM0 A;  4EAA A;  1S80 A;  2OEG A;  5DEM A;  2VD4 A;  4KPX A;  1XAT A;  3MC4 A;  1QQ0 A;  4E75 A;  4EAB A;  3Q1X A;  4MYO A;  4R7P A;  3TIO A;  4HZD A;  5L6V A;  4MFG A;  2GGO A;  3FTT A;  3SPT A;  2W0W A;  1YP3 A;  4EGG A;  1KQA A;  3NZ2 A;  3OUP A;  2I5K A;  3C8V A;  2IUA A;  3D98 A;  3P47 A;  3VBM A;  3GVD A;  2V0I A;  5ADX U;  3HJJ A;  4M2A A;  2IU8 A;  3FSC A;  2TDT A;  4E79 A;  2JF3 A;  3TIS A;  3BSY A;  2W0V A;  4G3Q A;  1OCX A;  4FCE A;  4G87 A;  3TV0 A;  3ST8 A;  1V3W A;  1MRL A;  1SSQ A;  3PMO A;  2WLD A;  1QRG A;  3OW5 A;  5AFU V;  1SST A;  3EEV A;  4IHH A;  2FKO A;  1HV9 A;  3R5B A;  3TDT A;  3VBK A;  3OTM A;  4AA7 A;  2ICX A;  3KWD A;  3DHO A;  2QKX A;  1KK4 A;  3BXY A;  3D8V A;  4H7O A;  2V0K A;  3FSY A;  2XAT A;  4KQL A;  4EA8 A;  3FSB A;  3FS8 A;  3R1W A;  4M98 A;  3VBP A;  1YP4 A;  4J09 A;  4EA7 A;  4E6T A;  1MR7 A;  3SRT A;  4M9C A;  5E3R A;  1KHR A;  3DK5 A;  3IXC A;  3ECT A;  5E3P A;  5DG3 A;  1YP2 A;  4HUS A;  3EG4 A;  2OI5 A;  5DEP A;  5F42 A;  2WLG A;  4E6U A;  2Q4J A;  1MR9 A;  1XHD A;  4M2B A;  2AQ9 A;  1KK6 A;  5ADX V;  3BFP A;  2ICY A;  3MQH A;  2V0L A;  3TK8 A;  4J18 A;  1KRR A;  1G95 A;  1THJ A;  4KNX A;  3P1B A;  5AFU U;  2P2O A;  2RIJ A;  3F1X A;  4K6R A;  1TDT A;  2IC7 A;  4EQY A;  3KWC A;  3BSS A;  1KRU A;  1KGQ A;  2QIA A;  2JF2 A;  3I3X A;  5E3Q A;  4AAW A;  3BSW A;  3FOQ A;  3R2W A;  2WLE A;  4M99 A;  3V4E A;  2NPO A;  3VBL A;  3GOS A;  4G3S A;  3T57 A;  3VBJ A;  3FSX A;  3IGJ A;  3BRK X;  3OU9 A;  3GUE A;  3EH0 A;  4R37 A;  1G97 A;  3JQY A;  4HCQ A;  4ISX A;  4N69 A;  4AC3 A;  5L6S A;  4KPZ A;  4MZU A;  1FWY A;  3I3A A;  1Z90 A;  1HM9 A;  1QRF A;  1T3D A;  5U2K A;  2WLF A;  1SSM A;  1LXA A;  3KWE A;  4KNR A;  3MQG A;  1FXJ A;  3TWD A;  1KK5 A;  2WLC A;  4N6A A;  1QRM A;  3FWW A;  4N27 A;  2OEF A;  2QIV X;  4N6B A;  1HM8 A;  3R8Y A;  4HZC A;  3R3R A;  3R5C A;  2VHE A;  4HUR A;  2V0H A;  4EA9 A;  1QRL A;  2V0J A; 
#chains in the Genus database with same CATH topology
 2OI6 A;  4IHG A;  3R0S A;  1QRE A;  2IU9 A;  3HSQ A;  3R5A A;  3VNP A;  4DCL A;  1V67 A;  3DJ4 A;  4E1K A;  3CJ8 A;  4G3P A;  1J2Z A;  4R36 A;  1N4I A;  3R5D A;  4M28 A;  1KGT A;  1KRV A;  3VBN A;  2GGQ A;  2OI7 A;  3R3I A;  3VBI A;  4IHF A;  3OTZ A;  1HM0 A;  4EAA A;  1S80 A;  2OEG A;  5DEM A;  2VD4 A;  4KPX A;  1XAT A;  3MC4 A;  1QQ0 A;  4E75 A;  4EAB A;  3Q1X A;  4MYO A;  4R7P A;  3TIO A;  3GQ8 A;  4HZD A;  5L6V A;  4MFG A;  2GGO A;  3FTT A;  1L0S A;  3SPT A;  2W0W A;  1YP3 A;  4EGG A;  3OH3 A;  1KQA A;  3NZ2 A;  3OUP A;  2I5K A;  3C8V A;  2IUA A;  3D98 A;  3P47 A;  3VBM A;  3GVD A;  2V0I A;  5ADX U;  3HJJ A;  4M2A A;  2IU8 A;  3FSC A;  2TDT A;  4E79 A;  2JF3 A;  3TIS A;  3BSY A;  2W0V A;  4G3Q A;  1OCX A;  4FCE A;  4G87 A;  3TV0 A;  3ST8 A;  1V3W A;  1MRL A;  1SSQ A;  3PMO A;  2WLD A;  1QRG A;  3OW5 A;  5AFU V;  1SST A;  3EEV A;  4IHH A;  2FKO A;  1HV9 A;  3R5B A;  3TDT A;  3VBK A;  3OTM A;  4AA7 A;  2ICX A;  3KWD A;  3DHO A;  2QKX A;  1KK4 A;  3BXY A;  3D8V A;  4H7O A;  2V0K A;  3FSY A;  2XAT A;  4KQL A;  4EA8 A;  3FSB A;  3FS8 A;  3OH1 A;  3R1W A;  4M98 A;  3VBP A;  1YP4 A;  4J09 A;  4EA7 A;  4E6T A;  1MR7 A;  3SRT A;  4M9C A;  5E3R A;  1KHR A;  3DK5 A;  3OGZ A;  3IXC A;  3ECT A;  3OH4 A;  5E3P A;  5DG3 A;  1YP2 A;  4HUS A;  3EG4 A;  2OI5 A;  5DEP A;  5F42 A;  2WLG A;  4E6U A;  2Q4J A;  1MR9 A;  1XHD A;  4M2B A;  2AQ9 A;  1KK6 A;  3GQ7 A;  5ADX V;  3BFP A;  2ICY A;  3MQH A;  2V0L A;  3TK8 A;  4J18 A;  1KRR A;  1G95 A;  1THJ A;  3OH0 A;  4KNX A;  3P1B A;  5AFU U;  2P2O A;  2RIJ A;  3F1X A;  3GQA A;  4K6R A;  1TDT A;  2IC7 A;  4EQY A;  3KWC A;  3BSS A;  1EWW A;  1KRU A;  1KGQ A;  2QIA A;  2JF2 A;  3I3X A;  5E3Q A;  4AAW A;  3BSW A;  3FOQ A;  3R2W A;  3GQ9 A;  2WLE A;  4M99 A;  3V4E A;  2NPO A;  3VBL A;  3GOS A;  4G3S A;  3T57 A;  3VBJ A;  3FSX A;  3IGJ A;  3BRK X;  3OU9 A;  3GUE A;  3EH0 A;  4R37 A;  1G97 A;  3JQY A;  4HCQ A;  4ISX A;  4N69 A;  4AC3 A;  5L6S A;  4KPZ A;  4MZU A;  1FWY A;  3I3A A;  1Z90 A;  1HM9 A;  1QRF A;  1T3D A;  5U2K A;  2WLF A;  1SSM A;  1LXA A;  3KWE A;  3OH2 A;  3MQG A;  1Z2F A;  4KNR A;  1FXJ A;  3TWD A;  1KK5 A;  2WLC A;  4N6A A;  1QRM A;  3FWW A;  4N27 A;  1M8N A;  2QIV X;  2OEF A;  4N6B A;  1HM8 A;  3R8Y A;  4HZC A;  3R3R A;  3R5C A;  3SUC A;  2VHE A;  4HUR A;  2V0H A;  4EA9 A;  1QRL A;  2V0J A; 
#chains in the Genus database with same CATH homology
 2OI6 A;  4IHG A;  3R0S A;  1QRE A;  2IU9 A;  3HSQ A;  3R5A A;  3VNP A;  4DCL A;  1V67 A;  3DJ4 A;  4E1K A;  3CJ8 A;  4G3P A;  1J2Z A;  4R36 A;  3R5D A;  4M28 A;  1KGT A;  1KRV A;  3VBN A;  2GGQ A;  2OI7 A;  3R3I A;  3VBI A;  4IHF A;  3OTZ A;  1HM0 A;  4EAA A;  1S80 A;  2OEG A;  5DEM A;  2VD4 A;  4KPX A;  1XAT A;  3MC4 A;  1QQ0 A;  4E75 A;  4EAB A;  3Q1X A;  4MYO A;  4R7P A;  3TIO A;  4HZD A;  5L6V A;  4MFG A;  2GGO A;  3FTT A;  3SPT A;  2W0W A;  1YP3 A;  4EGG A;  1KQA A;  3NZ2 A;  3OUP A;  2I5K A;  3C8V A;  2IUA A;  3D98 A;  3P47 A;  3VBM A;  3GVD A;  2V0I A;  5ADX U;  3HJJ A;  4M2A A;  2IU8 A;  3FSC A;  2TDT A;  4E79 A;  2JF3 A;  3TIS A;  3BSY A;  2W0V A;  4G3Q A;  1OCX A;  4FCE A;  4G87 A;  3TV0 A;  3ST8 A;  1V3W A;  1MRL A;  1SSQ A;  3PMO A;  2WLD A;  1QRG A;  3OW5 A;  5AFU V;  1SST A;  3EEV A;  4IHH A;  2FKO A;  1HV9 A;  3R5B A;  3TDT A;  3VBK A;  3OTM A;  4AA7 A;  2ICX A;  3KWD A;  3DHO A;  2QKX A;  1KK4 A;  3BXY A;  3D8V A;  4H7O A;  2V0K A;  3FSY A;  2XAT A;  4KQL A;  4EA8 A;  3FSB A;  3FS8 A;  3R1W A;  4M98 A;  3VBP A;  1YP4 A;  4J09 A;  4EA7 A;  4E6T A;  1MR7 A;  3SRT A;  4M9C A;  5E3R A;  1KHR A;  3DK5 A;  3IXC A;  3ECT A;  5E3P A;  5DG3 A;  1YP2 A;  4HUS A;  3EG4 A;  2OI5 A;  5DEP A;  5F42 A;  2WLG A;  4E6U A;  2Q4J A;  1MR9 A;  1XHD A;  4M2B A;  2AQ9 A;  1KK6 A;  5ADX V;  3BFP A;  2ICY A;  3MQH A;  2V0L A;  3TK8 A;  4J18 A;  1KRR A;  1G95 A;  1THJ A;  4KNX A;  3P1B A;  5AFU U;  2P2O A;  2RIJ A;  3F1X A;  4K6R A;  1TDT A;  2IC7 A;  4EQY A;  3KWC A;  3BSS A;  1KRU A;  1KGQ A;  2QIA A;  2JF2 A;  3I3X A;  5E3Q A;  4AAW A;  3BSW A;  3FOQ A;  3R2W A;  2WLE A;  4M99 A;  3V4E A;  2NPO A;  3VBL A;  3GOS A;  4G3S A;  3T57 A;  3VBJ A;  3FSX A;  3IGJ A;  3BRK X;  3OU9 A;  3GUE A;  3EH0 A;  4R37 A;  1G97 A;  3JQY A;  4HCQ A;  4ISX A;  4N69 A;  4AC3 A;  5L6S A;  4KPZ A;  4MZU A;  1FWY A;  3I3A A;  1Z90 A;  1HM9 A;  1QRF A;  1T3D A;  5U2K A;  2WLF A;  1SSM A;  1LXA A;  3KWE A;  4KNR A;  3MQG A;  1FXJ A;  3TWD A;  1KK5 A;  2WLC A;  4N6A A;  1QRM A;  3FWW A;  4N27 A;  2OEF A;  2QIV X;  4N6B A;  1HM8 A;  3R8Y A;  4HZC A;  3R3R A;  3R5C A;  2VHE A;  4HUR A;  2V0H A;  4EA9 A;  1QRL A;  2V0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...