4G3SA

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine and pyrophosphate snapshot 2
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
469
structure length
462
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Structural Snapshots of Glmu from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 175
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g3sA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g3sA01
3FSXA 1YP4A 2AM3A 2Y4JA 4HO4A 3R5CA 3BSYA 5E3PA 3R3RA 3K8DA 4HCQA 1J2ZA 4FCEA 4EGGA 1R82A 1KWSA 4AC3A 3PKPA 4GBPA 1XHBA 4YS8A 3OGZA 4D11C 1W57A 1TVYA 3P47A 3T57A 2P6WA 3ZLLA 5C1LA 3RSBA 2FYBA 3MC4A 4NANA 3EG4A 1G97A 4K6RA 3FSBA 4ECMA 3D8VA 3TK8A 4M99A 1HJLA 2Y7AA 1QRGA 4HO8A 3VBPA 1SSTA 1I52A 4EAAA 5IDTA 2Y4KA 4CJBA 3I0EA 3R5AA 4HO9A 2RJ0A 1H5SB 2AESA 1GQ9A 4Y7TA 4UEGA 4AA7A 2JF3A 2P73A 2AH9A 1QGSA 2VFZA 1SSQA 5C49A 1JVDA 2XMHA 4EQYA 4CJ8A 1ZIZA 4D0ZA 3ECTA 5C4DA 3N9WA 1FXJA 4FROA 5U2KA 3DHOA 3VBMA 4XWIA 2WLEA 3EH0A 1VGTA 4FREA 4Y6NA 4D48A 2IUAA 4P00A 4B2WA 5C4CA 2OEGA 4D11A 1ZI4A 3R2WA 3I0IX 1NQIB 3JUJA 5CQOA 2RJ6A 1T3DA 1O7OA 2BO6A 5CQNX 2O1FA 3V0MA 1G2VA 2RJ4A 1ZI5A 2GGQA 1S4PA 1WT1A 1O23B 2WLDA 2QKXA 1JYLA 1ON6A 2RJ5A 3KIAA 5CMFX 1ZJOA 2YQJA 3SPTA 4FRLA 4KT7A 5FU8A 1FR9A 1MR9A 1ZI1A 1XHDA 3TIOA 3TISA 4HZDA 2Q4JA 2O1GA 3TQDA 2DPWA 5CQMX 1R80A 4R7PA 3NGWA 4EE3A 1H7QA 2OI5A 4B2XA 1TDTA 4N69A 2VHEA 1IINA 1NWGB 1JVGA 4EEMA 1OMXA 4HZCA 2YQSA 5CQLX 1ZDGA 5DDTA 1QGQA 2TDTA 3BFPA 4EEOA 1HM0A 1W55A 4KQLA 3HSQA 2VSHA 1QRFA 1H3MA 3V0PA 3D98A 1G93A 3LW6A 1SSMA 2AE7A 1V83A 3E25A 5CMGX 4Y64A 5C3DA 2A8UA 1FG5N 2PGVA 1S4OA 2BO8A 2AQ9A 4FRHA 3U2WA 1KK4A 1LL3A 5CMJA 1H5TB 2VS4A 1R7XA 4R37A 1GX4A 3ZGGA 4M9CA 3T7NA 1KHRA 3OTMA 4FRQA 1MR7A 4FRAA 2FYDB 3HL3A 1FXOA 1LL2A 1INJA 4J18A 1O0RA 1K4VA 4J09A 2X65A 4KRVA 1R7UA 4Y6UA 1V3WA 5C38A 1KRUA 5FV9A 1KGQA 1H7EA 3V4EA 3CU0A 5C3AA 1PZTA 4EE4A 5C4EA 4EABA 4Y63A 4B5BA 1O7QA 5EJZA 3R0SA 2W0WA 2FY7A 2VS5A 3CGXA 4P02A 4AYJA 1KQAA 3ZF8A 1GWWA 5IFYA 3PMOA 2OEFA 1G3LA 1QG8A 4DECA 4KXOA 3F1CA 1GX0A 4B4MA 4IHHA 2XWMA 1Z90A 2P72A 1H5TA 2AGDA 4Y7FA 4MZUA 1ZCVA 4HO6A 3Q4SA 4KC4A 3I3AA 1ZDFA 4M2AA 4Y9XA 3GVDA 2YCMA 2MZBA 1H4CA 1VH3A 2AECA 1ON8A 1FGGA 2QGIA 2RIJA 3I0FA 3I0DA 2D7RA 5BXCA 1MP3A 4C2SA 1ZHJA 1FZWA 4Y62A 1WSZA 3E26A 5C1GA 2IU8A 4EA8A 4HOCA 3NZ2A 4HUSA 1VZTA 3ZLKA 3IGJA 3PNNA 3U2UA 5IDSA 4ARWA 1XZ6A 4JISA 3I0GA 3BCVA 2RIZA 2YESA 2GGOA 3KWCA 1G8OA 1FO9A 2PA4A 3JUKA 3MQHA 3RMVA 4EE5A 1JV3A 2ZU8A 4EVWA 5AFUV 2Y4MA 2NXVA 3F1XA 5F42A 1THJA 1VGZA 3VBLA 2ICYA 3Q1XA 2IU9A 4ISXA 1QRMA 3I0HA 1OMZA 2FYCB 2X5ZA 2I5EA 3TZTA 2A8WA 2V0HA 3FTTA 1HV9A 1LL0A 4B4BA 3EEVA 1R7YA 2WEEA 4H7OA 3IOHA 2YQHA 3T7OA 3USRA 5AFUU 4N27A 1G9RA 2JCKA 4NAKA 2RJ7A 1YP2A 2RITA 3C8VA 1VZXA 2AM5A 2ZU7A 3OH1A 3V0NA 2Z87A 3CKNA 3TV0A 3MQGA 5AJNA 5EJ1A 2V0KA 3SXDA 1VGUA 2I7BA 3SX8A 4DDZA 4KNXA 2E8BA 1NMMB 4FCUA 4G3SA 4D0TA 1TW1A 2RJ1A 3POLA 3V0QA 4BQHA 3EE5A 2XWNA 1R81A 3R1WA 3BSSA 5FTSA 4HO2A 1NF5B 3OH4A 4HO5A 1VH1A 4N6BA 5J49A 3BXYA 1KRRA 1ZCTA 2QIVX 2Y6PA 5CMIA 3SXCA 5AJOA 1H5RA 4KPZA 2O1HA 3Q7UA 1H7GA 2WVLA 3KWDA 1QRLA 4MYBA 5FTVA 3OW5A 3R3IA 1ZJ2A 3F1YA 5AJPA 4G3QA 3OH3A 1LZIA 3IXCA 4E75A 1ZCUA 3U0XA 1MP4A 4M2BA 4CJCA 1W77A 4NAIA 4CVHA 1E5KA 1QQ0A 3JTJA 2ICXA 1V84A 1V67A 4MNDA 2RIXA 1H4EA 4KC1A 4E6TA 2JCLA 2XWLA 3ST8A 3D5NA 3R5DA 3SX5A 2JF2A 5JQQA 4E79A 4KNRA 1VICA 3FWWA 5C4BA 3IOJA 4IRQA 1GA8A 5I1FA 3VBJA 1GWVA 2WGZA 2QH5A 1OCXA 1WT2A 4N6AA 2JCOA 5ADXV 3GOSA 4FRDA 3DK5A 5E3RA 1G0RA 3O3PA 4M4KA 5C4FA 2I5KA 3VNPA 3DJ4A 1HM8A 4L41C 3BSWA 3SXGA 1G1LA 3K8EA 2X60A 3V8YA 1PZYB 1WVCA 5CMHA 1KK6A 1LZ7A 3OTZA 1FO8A 2Z86A 2PGYA 2X5SA 2YC5A 1VM8A 3FSCA 3PKQA 2D0JA 1H7TA 2UX8A 3OC9A 3TWDA 5C3BA 3SRTA 4HG6A 1ZJ3A 2FYAA 5DDVA 4FRMA 1FWYA 3SX7A 5ADXU 3GUEA 1LZJA 1QREA 5C48A 2WVKA 3OH2A 3U0YA 5DEMA 4IRPA 2QIAA 1QWJA 1H7HA 4Y7VA 5C8RA 5EIYA 1FOAA 5C1HA 3JQYA 1ZJ1A 1KGTA 3Q80A 4G87A 4M98A 1JV1A 3USQA 1V82A 3U2VA 1NKHB 4B3UA 2BO4A 3BRKX 3OU9A 4FRBA 1H5SC 1XATA 4IHFA 1R7VA 1NHEB 3P1BA 5C47A 4ASYA 1G23A 3OKRA 2V0JA 3FSYA 2OI7A 2XMEA 1VPAA 3ZGFA 1ZJ0A 3OAMA 4G3PA 1VZUA 2WVMA 3I3XA 4DCLA 3RMWA 4AYLA 2VS3A 3R5BA 2VD4A 1YROB 2YC3A 4HO3A 3SXEA 1H5RB 1OQMB 2CU2A 5FU0A 1ZI3A 1H5SD 4KPXA 2VXMA 3CKJA 4DE7A 2WAWA 3FS8A 3SXBA 1FRWA 2VXLA 5FUHA 5DG3A 3V0LA 2RJ8A 2AM4A 3CJ8A 3I0CA 1IIMA 4MYOA 1TZFA 3I0KA 4R36A 4E1KA 1GQCA 1KRVA 3CKVA 2RIYA 2ZU9A 3I0JA 1INIA 2OI6A 4IHGA 4EEGA 1FGXA 2E3DA 3DUVA 1KK5A 1HM9A 3OUPA 3VBKA 1HJJA 1H5SA 1ZJPA 3CKQA 5FYEA 2WLFA 4FRPA 1MRLA 3V0OA 2D7IA 1TW5A 2XATA 4ZDQA 4LW3A 2APCA 1S4NA 3SXAA 1LZ0A 2YQCA 2FFUA 3V8ZA 1EYRA 1R7TA 4FQWA 2JCJA 1VGWA 1S80A 3CKOA 4KC2A 2RJ9A 4Y7GA 2WE9A 2Y4LA 1ZCYA 3VBIA 4E6UA 4BMAA 4EA7A 1LVWA 4M28A 4HO0A 3KWEA 4MFGA 3HJJA 2NPOA 4EA9A 3I0LA 4JD0A 4LW6A 3U2XA 2V0IA 1EZIA 5DEPA 3V90A 2WLGA 3VBNA 4ASJA 1WT0A 2FKOA 2IC7A 5HS2A 5C36A 1MC3A 3U2TA 4B4GA 3QVBA 3T7MA 1LXAA 5CQPA 3IOIA 2FFVA 4B42A 2BO7A 4AAWA 2PX7A 3OH0A 3V91A 1YP3A 3R8YA 2P2OA 2WLCA 1H7LA 5L6SA 1JYKA 5E3QA 4Y7UA 1FR8A 4EEAA 2V0LA 4NALA 5L6VA 2VSIA 2W0VA 3TDTA 1WT3A 3FOQA 4HURA 1H4DA 1H7FA 1SS9A 1G95A 3SX3A 1MP5A
chains in the Genus database with same CATH superfamily
3FSXA 1YP4A 2AM3A 2Y4JA 4HO4A 3R5CA 3BSYA 5E3PA 3R3RA 3K8DA 4HCQA 1J2ZA 4FCEA 4EGGA 1R82A 1KWSA 4AC3A 3PKPA 4GBPA 1XHBA 4YS8A 3OGZA 4D11C 1W57A 1TVYA 3P47A 3T57A 2P6WA 3ZLLA 5C1LA 3RSBA 2FYBA 3MC4A 4NANA 3EG4A 1G97A 4K6RA 3FSBA 4ECMA 3D8VA 3TK8A 4M99A 1HJLA 2Y7AA 1QRGA 4HO8A 3VBPA 1SSTA 1I52A 4EAAA 5IDTA 2Y4KA 4CJBA 3I0EA 3R5AA 4HO9A 2RJ0A 1H5SB 2AESA 1GQ9A 4Y7TA 4UEGA 4AA7A 2JF3A 2P73A 2AH9A 1QGSA 2VFZA 1SSQA 5C49A 1JVDA 2XMHA 4EQYA 4Q7CA 4CJ8A 1ZIZA 4D0ZA 3ECTA 5C4DA 3N9WA 1FXJA 4FROA 5U2KA 3DHOA 4FIXA 3VBMA 4XWIA 2WLEA 1L0SA 3EH0A 1VGTA 4FREA 4Y6NA 4D48A 2IUAA 4P00A 4B2WA 5C4CA 2OEGA 4D11A 1ZI4A 3R2WA 3I0IX 1NQIB 3JUJA 5CQOA 2RJ6A 1T3DA 1O7OA 2BO6A 5CQNX 2O1FA 3V0MA 1G2VA 2RJ4A 1ZI5A 2GGQA 1S4PA 1WT1A 1O23B 2WLDA 2QKXA 1JYLA 1ON6A 2RJ5A 3KIAA 5CMFX 1ZJOA 2YQJA 3SPTA 4FRLA 4KT7A 5FU8A 1FR9A 1MR9A 1ZI1A 1XHDA 3TIOA 3TISA 4HZDA 2Q4JA 2O1GA 3TQDA 2DPWA 5CQMX 1R80A 4R7PA 3NGWA 4EE3A 1H7QA 2OI5A 4B2XA 1TDTA 4N69A 2VHEA 1IINA 1NWGB 1JVGA 4EEMA 1OMXA 4HZCA 2YQSA 5CQLX 1ZDGA 5DDTA 1QGQA 2TDTA 3BFPA 4EEOA 1HM0A 1W55A 4KQLA 3HSQA 2VSHA 1QRFA 1H3MA 3V0PA 3D98A 1G93A 3LW6A 1SSMA 2AE7A 1V83A 3E25A 5CMGX 2VK9A 4Y64A 5C3DA 2A8UA 1FG5N 2PGVA 1S4OA 2BO8A 2AQ9A 4FRHA 3U2WA 1KK4A 1LL3A 5CMJA 1H5TB 2VS4A 1R7XA 4R37A 1GX4A 3ZGGA 4M9CA 3T7NA 1KHRA 3OTMA 4FRQA 1MR7A 4FRAA 2FYDB 3HL3A 1FXOA 1LL2A 1INJA 4J18A 1O0RA 1K4VA 4J09A 2X65A 4KRVA 1R7UA 4Y6UA 1V3WA 5C38A 1KRUA 5FV9A 1KGQA 1H7EA 3V4EA 3CU0A 5C3AA 1PZTA 4EE4A 4FIYA 5C4EA 4EABA 4Y63A 4B5BA 1O7QA 5EJZA 3R0SA 2W0WA 1EWWA 2FY7A 2VS5A 3CGXA 4P02A 4AYJA 1KQAA 3ZF8A 1GWWA 5IFYA 3PMOA 2OEFA 1G3LA 1QG8A 4DECA 4KXOA 3F1CA 1GX0A 4B4MA 4IHHA 2XWMA 1Z90A 2P72A 1H5TA 2AGDA 4Y7FA 4MZUA 1ZCVA 4HO6A 3Q4SA 4KC4A 3I3AA 1ZDFA 4M2AA 4Y9XA 3GVDA 2YCMA 2MZBA 1H4CA 1VH3A 2AECA 1ON8A 1FGGA 2QGIA 2RIJA 3I0FA 3I0DA 2D7RA 5BXCA 1MP3A 4C2SA 1ZHJA 1FZWA 4Y62A 1WSZA 3E26A 5C1GA 2IU8A 4EA8A 4HOCA 3NZ2A 4HUSA 1VZTA 3ZLKA 1N4IA 3IGJA 3PNNA 3U2UA 5IDSA 4ARWA 1XZ6A 4JISA 3GQ9A 3I0GA 3BCVA 2RIZA 2YESA 2GGOA 3KWCA 1G8OA 1FO9A 2PA4A 3JUKA 3MQHA 3RMVA 4EE5A 1JV3A 2ZU8A 4EVWA 5AFUV 2Y4MA 2NXVA 5D92A 3F1XA 5F42A 1THJA 1VGZA 3VBLA 2ICYA 3Q1XA 2IU9A 4ISXA 1QRMA 3I0HA 1OMZA 2FYCB 2X5ZA 2I5EA 3TZTA 2A8WA 2V0HA 3FTTA 1HV9A 1LL0A 4B4BA 3EEVA 1R7YA 2WEEA 4H7OA 3IOHA 2YQHA 3T7OA 3USRA 5AFUU 4N27A 1G9RA 2JCKA 2J0BA 4NAKA 2RJ7A 1YP2A 2RITA 3C8VA 1VZXA 3OH1A 2AM5A 2ZU7A 3V0NA 2Z87A 3CKNA 3TV0A 3MQGA 5AJNA 5EJ1A 2V0KA 3SXDA 1VGUA 2I7BA 3SX8A 4DDZA 4KNXA 2E8BA 1NMMB 4FCUA 4G3SA 4D0TA 1TW1A 2RJ1A 3POLA 3V0QA 4BQHA 3EE5A 2XWNA 1R81A 3R1WA 3BSSA 5FTSA 4HO2A 1NF5B 3OH4A 4HO5A 4MIXA 1VH1A 4N6BA 5J49A 3BXYA 1KRRA 1ZCTA 2QIVX 2Y6PA 5CMIA 3SXCA 5AJOA 1H5RA 3GQAA 4KPZA 2O1HA 3Q7UA 1H7GA 2WVLA 3KWDA 1QRLA 4MYBA 5FTVA 3OW5A 3R3IA 1ZJ2A 3F1YA 5AJPA 4G3QA 3OH3A 1LZIA 3IXCA 4E75A 1ZCUA 3U0XA 1MP4A 4M2BA 4CJCA 1W77A 4NAIA 4CVHA 1E5KA 1QQ0A 3JTJA 2ICXA 1V84A 1V67A 4MNDA 2RIXA 1H4EA 4KC1A 4E6TA 2JCLA 2XWLA 3ST8A 3D5NA 3R5DA 3SX5A 2JF2A 5JQQA 4E79A 4KNRA 1VICA 3FWWA 5C4BA 3IOJA 4IRQA 1GA8A 3GQ8A 3VBJA 5I1FA 1GWVA 2WGZA 2QH5A 1OCXA 1WT2A 4N6AA 2JCOA 5ADXV 3GOSA 4FRDA 3DK5A 5E3RA 1G0RA 3O3PA 4M4KA 5C4FA 3VNPA 2I5KA 3DJ4A 1HM8A 4L41C 3BSWA 3SXGA 1G1LA 3K8EA 2X60A 3V8YA 1PZYB 1WVCA 5CMHA 1KK6A 1LZ7A 3OTZA 2J0AA 1FO8A 2Z86A 2PGYA 2X5SA 2YC5A 1VM8A 3FSCA 3PKQA 2D0JA 1H7TA 2UX8A 3OC9A 3TWDA 5C3BA 3SRTA 4HG6A 1ZJ3A 2FYAA 5DDVA 4FRMA 1FWYA 3SX7A 5ADXU 3GUEA 1LZJA 1QREA 5C48A 2WVKA 3OH2A 3U0YA 5DEMA 4IRPA 2QIAA 1QWJA 1H7HA 4Y7VA 5C8RA 5EIYA 1FOAA 5C1HA 3JQYA 1ZJ1A 1KGTA 3Q80A 3GQ7A 4G87A 4M98A 1JV1A 3USQA 1V82A 3U2VA 1NKHB 4B3UA 2BO4A 3BRKX 3OU9A 4FRBA 1H5SC 1XATA 4IHFA 1R7VA 1NHEB 3P1BA 5C47A 4ASYA 1G23A 3OKRA 2V0JA 3FSYA 2OI7A 2XMEA 1VPAA 3ZGFA 1ZJ0A 3OAMA 4G3PA 1VZUA 2WVMA 3I3XA 2C0NA 4DCLA 3RMWA 4AYLA 2VS3A 3R5BA 2VD4A 1YROB 2YC3A 4HO3A 3SXEA 1H5RB 1OQMB 2CU2A 3SUCA 1ZI3A 5FU0A 1H5SD 4KPXA 2VXMA 3CKJA 4DE7A 2WAWA 3FS8A 3SXBA 1FRWA 2VXLA 5FUHA 5DG3A 3V0LA 2RJ8A 2AM4A 3CJ8A 3I0CA 1IIMA 4MYOA 1TZFA 3I0KA 4R36A 4E1KA 1GQCA 1KRVA 3CKVA 2RIYA 2ZU9A 3I0JA 1INIA 2OI6A 4IHGA 4EEGA 1FGXA 2E3DA 3DUVA 1KK5A 1HM9A 3OUPA 3VBKA 1HJJA 1H5SA 1ZJPA 3CKQA 5FYEA 4O6MA 2WLFA 4FRPA 1MRLA 3V0OA 2D7IA 1TW5A 2XATA 4ZDQA 4LW3A 2APCA 1S4NA 3SXAA 1LZ0A 2YQCA 2FFUA 3V8ZA 1EYRA 1R7TA 4FQWA 2JCJA 1VGWA 1S80A 3CKOA 4KC2A 2RJ9A 4Y7GA 2WE9A 2Y4LA 4O6NA 1ZCYA 3VBIA 1Z2FA 4E6UA 4BMAA 4EA7A 1LVWA 4M28A 5D91A 4HO0A 3KWEA 4MFGA 3HJJA 2NPOA 4EA9A 3I0LA 4JD0A 4LW6A 3U2XA 2V0IA 1EZIA 5DEPA 3V90A 1M8NA 2WLGA 3VBNA 4ASJA 1WT0A 2FKOA 2IC7A 5HS2A 5C36A 1MC3A 3U2TA 4B4GA 3QVBA 3T7MA 1LXAA 5CQPA 3IOIA 2FFVA 4B42A 2BO7A 4AAWA 3OH0A 2PX7A 3V91A 1YP3A 3R8YA 2P2OA 2WLCA 1H7LA 5L6SA 1JYKA 5E3QA 4Y7UA 1FR8A 4EEAA 2V0LA 4NALA 5L6VA 2VSIA 2W0VA 3TDTA 1WT3A 3FOQA 4HURA 1H4DA 1H7FA 1SS9A 1G95A 3SX3A 1MP5A
chains in the Genus database with same CATH topology
3FSXA 1YP4A 2AM3A 2Y4JA 4HO4A 3R5CA 3BSYA 5E3PA 3R3RA 3K8DA 4HCQA 1J2ZA 4FCEA 4EGGA 1R82A 1KWSA 4AC3A 3PKPA 4GBPA 1XHBA 4YS8A 3OGZA 4D11C 1W57A 1TVYA 3P47A 3T57A 2P6WA 3ZLLA 5C1LA 3RSBA 2FYBA 3MC4A 4NANA 3EG4A 1G97A 4K6RA 3FSBA 4ECMA 3D8VA 3TK8A 4M99A 1HJLA 2Y7AA 1QRGA 4HO8A 3VBPA 1SSTA 1I52A 4EAAA 5IDTA 2Y4KA 4CJBA 3I0EA 3R5AA 4HO9A 2RJ0A 1H5SB 2AESA 1GQ9A 4Y7TA 4UEGA 4AA7A 2JF3A 2P73A 2AH9A 1QGSA 2VFZA 1SSQA 5C49A 1JVDA 2XMHA 4EQYA 4Q7CA 4CJ8A 1ZIZA 4D0ZA 3ECTA 5C4DA 3N9WA 1FXJA 4FROA 5U2KA 3DHOA 4FIXA 3VBMA 4XWIA 2WLEA 3EH0A 1VGTA 4FREA 4Y6NA 4D48A 2IUAA 4P00A 4B2WA 5C4CA 2OEGA 4D11A 1ZI4A 3R2WA 3I0IX 1NQIB 3JUJA 5CQOA 2RJ6A 1T3DA 1O7OA 2BO6A 5CQNX 2O1FA 3V0MA 1G2VA 2RJ4A 1ZI5A 2GGQA 1S4PA 1WT1A 1O23B 2WLDA 2QKXA 1JYLA 1ON6A 2RJ5A 3KIAA 5CMFX 1ZJOA 2YQJA 3SPTA 4FRLA 4KT7A 5FU8A 1FR9A 1MR9A 1ZI1A 1XHDA 3TIOA 3TISA 4HZDA 2Q4JA 2O1GA 3TQDA 2DPWA 5CQMX 1R80A 4R7PA 3NGWA 4EE3A 1H7QA 2OI5A 4B2XA 1TDTA 4N69A 2VHEA 1IINA 1NWGB 1JVGA 4EEMA 1OMXA 4HZCA 2YQSA 5CQLX 1ZDGA 5DDTA 1QGQA 2TDTA 3BFPA 4EEOA 1HM0A 1W55A 4KQLA 3HSQA 2VSHA 1QRFA 1H3MA 3V0PA 3D98A 1G93A 3LW6A 1SSMA 2AE7A 1V83A 3E25A 5CMGX 2VK9A 4Y64A 5C3DA 2A8UA 1FG5N 2PGVA 1S4OA 2BO8A 2AQ9A 4FRHA 3U2WA 1KK4A 1LL3A 5CMJA 1H5TB 2VS4A 1R7XA 4R37A 1GX4A 3ZGGA 4M9CA 3T7NA 1KHRA 3OTMA 4FRQA 1MR7A 4FRAA 2FYDB 3HL3A 1FXOA 1LL2A 1INJA 4J18A 1O0RA 1K4VA 4J09A 2X65A 4KRVA 1R7UA 4Y6UA 1V3WA 5C38A 1KRUA 5FV9A 1KGQA 1H7EA 3V4EA 3CU0A 5C3AA 1PZTA 4EE4A 4FIYA 5C4EA 4EABA 4Y63A 4B5BA 1O7QA 5EJZA 3R0SA 2W0WA 2FY7A 2VS5A 3CGXA 4P02A 4AYJA 1KQAA 3ZF8A 1GWWA 5IFYA 3PMOA 2OEFA 1G3LA 1QG8A 4DECA 4KXOA 3F1CA 1GX0A 4B4MA 4IHHA 2XWMA 1Z90A 2P72A 1H5TA 2AGDA 4Y7FA 4MZUA 1ZCVA 4HO6A 3Q4SA 4KC4A 3I3AA 1ZDFA 4M2AA 4Y9XA 3GVDA 2YCMA 2MZBA 1H4CA 1VH3A 2AECA 1ON8A 1FGGA 2QGIA 2RIJA 3I0FA 3I0DA 2D7RA 5BXCA 1MP3A 4C2SA 1ZHJA 1FZWA 4Y62A 1WSZA 3E26A 5C1GA 2IU8A 4EA8A 4HOCA 3NZ2A 4HUSA 1VZTA 3ZLKA 3IGJA 3PNNA 3U2UA 5IDSA 4ARWA 1XZ6A 4JISA 3I0GA 3BCVA 2RIZA 2YESA 2GGOA 3KWCA 1G8OA 1FO9A 2PA4A 3JUKA 3MQHA 3RMVA 4EE5A 1JV3A 2ZU8A 4EVWA 5AFUV 2Y4MA 2NXVA 5D92A 3F1XA 5F42A 1THJA 1VGZA 3VBLA 2ICYA 3Q1XA 2IU9A 4ISXA 1QRMA 3I0HA 1OMZA 2FYCB 2X5ZA 2I5EA 3TZTA 2A8WA 2V0HA 3FTTA 1HV9A 1LL0A 4B4BA 3EEVA 1R7YA 2WEEA 4H7OA 3IOHA 2YQHA 3T7OA 3USRA 5AFUU 4N27A 1G9RA 2JCKA 2J0BA 4NAKA 2RJ7A 1YP2A 2RITA 3C8VA 1VZXA 2AM5A 2ZU7A 3OH1A 3V0NA 2Z87A 3CKNA 3TV0A 3MQGA 5AJNA 5EJ1A 2V0KA 3SXDA 1VGUA 2I7BA 3SX8A 4DDZA 4KNXA 2E8BA 1NMMB 4FCUA 4G3SA 4D0TA 1TW1A 2RJ1A 3POLA 3V0QA 4BQHA 3EE5A 2XWNA 1R81A 3R1WA 3BSSA 5FTSA 4HO2A 1NF5B 3OH4A 4HO5A 4MIXA 1VH1A 4N6BA 5J49A 3BXYA 1KRRA 1ZCTA 2QIVX 2Y6PA 5CMIA 3SXCA 5AJOA 1H5RA 4KPZA 2O1HA 3Q7UA 1H7GA 2WVLA 3KWDA 1QRLA 4MYBA 5FTVA 3OW5A 3R3IA 1ZJ2A 3F1YA 5AJPA 4G3QA 3OH3A 1LZIA 3IXCA 4E75A 1ZCUA 3U0XA 1MP4A 4M2BA 4CJCA 1W77A 4NAIA 4CVHA 1E5KA 1QQ0A 3JTJA 2ICXA 1V84A 1V67A 4MNDA 2RIXA 1H4EA 4KC1A 4E6TA 2JCLA 2XWLA 3ST8A 3D5NA 3R5DA 3SX5A 2JF2A 5JQQA 4E79A 4KNRA 1VICA 3FWWA 5C4BA 3IOJA 4IRQA 1GA8A 5I1FA 3VBJA 1GWVA 2WGZA 2QH5A 1OCXA 1WT2A 4N6AA 2JCOA 5ADXV 3GOSA 4FRDA 3DK5A 5E3RA 1G0RA 3O3PA 4M4KA 5C4FA 2I5KA 3VNPA 3DJ4A 1HM8A 4L41C 3BSWA 3SXGA 1G1LA 3K8EA 2X60A 3V8YA 1PZYB 1WVCA 5CMHA 1KK6A 1LZ7A 3OTZA 2J0AA 1FO8A 2Z86A 2PGYA 2X5SA 2YC5A 1VM8A 3FSCA 3PKQA 2D0JA 1H7TA 2UX8A 3OC9A 3TWDA 5C3BA 3SRTA 4HG6A 1ZJ3A 2FYAA 5DDVA 4FRMA 1FWYA 3SX7A 5ADXU 3GUEA 1LZJA 1QREA 5C48A 2WVKA 3OH2A 3U0YA 5DEMA 4IRPA 2QIAA 1QWJA 1H7HA 4Y7VA 5C8RA 5EIYA 1FOAA 5C1HA 3JQYA 1ZJ1A 1KGTA 3Q80A 4G87A 4M98A 1JV1A 3USQA 1V82A 3U2VA 1NKHB 4B3UA 2BO4A 3BRKX 3OU9A 4FRBA 1H5SC 1XATA 4IHFA 1R7VA 1NHEB 3P1BA 5C47A 4ASYA 1G23A 3OKRA 2V0JA 3FSYA 2OI7A 2XMEA 1VPAA 3ZGFA 1ZJ0A 3OAMA 4G3PA 1VZUA 2WVMA 3I3XA 2C0NA 4DCLA 3RMWA 4AYLA 2VS3A 3R5BA 2VD4A 1YROB 2YC3A 4HO3A 3SXEA 1H5RB 1OQMB 2CU2A 5FU0A 1ZI3A 1H5SD 4KPXA 2VXMA 3CKJA 4DE7A 2WAWA 3FS8A 3SXBA 1FRWA 2VXLA 5FUHA 5DG3A 3V0LA 2RJ8A 2AM4A 3CJ8A 3I0CA 1IIMA 4MYOA 1TZFA 3I0KA 4R36A 4E1KA 1GQCA 1KRVA 3CKVA 2RIYA 2ZU9A 3I0JA 1INIA 2OI6A 4IHGA 4EEGA 1FGXA 2E3DA 3DUVA 1KK5A 1HM9A 3OUPA 3VBKA 1HJJA 1H5SA 1ZJPA 3CKQA 5FYEA 4O6MA 2WLFA 4FRPA 1MRLA 3V0OA 2D7IA 1TW5A 2XATA 4ZDQA 4LW3A 2APCA 1S4NA 3SXAA 1LZ0A 2YQCA 2FFUA 3V8ZA 1EYRA 1R7TA 4FQWA 2JCJA 1VGWA 1S80A 3CKOA 4KC2A 2RJ9A 4Y7GA 2WE9A 2Y4LA 4O6NA 1ZCYA 3VBIA 4E6UA 4BMAA 4EA7A 1LVWA 4M28A 5D91A 4HO0A 3KWEA 4MFGA 3HJJA 2NPOA 4EA9A 3I0LA 4JD0A 4LW6A 3U2XA 2V0IA 1EZIA 5DEPA 3V90A 2WLGA 3VBNA 4ASJA 1WT0A 2FKOA 2IC7A 5HS2A 5C36A 1MC3A 3U2TA 4B4GA 3QVBA 3T7MA 1LXAA 5CQPA 3IOIA 2FFVA 4B42A 2BO7A 4AAWA 2PX7A 3OH0A 3V91A 1YP3A 3R8YA 2P2OA 2WLCA 1H7LA 5L6SA 1JYKA 5E3QA 4Y7UA 1FR8A 4EEAA 2V0LA 4NALA 5L6VA 2VSIA 2W0VA 3TDTA 1WT3A 3FOQA 4HURA 1H4DA 1H7FA 1SS9A 1G95A 3SX3A 1MP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSX A;  1YP4 A;  2AM3 A;  2Y4J A;  4HO4 A;  3R5C A;  3BSY A;  5E3P A;  3R3R A;  3K8D A;  4HCQ A;  1J2Z A;  4FCE A;  4EGG A;  1R82 A;  1KWS A;  4AC3 A;  3PKP A;  4GBP A;  1XHB A;  4YS8 A;  3OGZ A;  4D11 C;  1W57 A;  1TVY A;  3P47 A;  3T57 A;  2P6W A;  3ZLL A;  5C1L A;  3RSB A;  2FYB A;  3MC4 A;  4NAN A;  3EG4 A;  1G97 A;  4K6R A;  3FSB A;  4ECM A;  3D8V A;  3TK8 A;  4M99 A;  1HJL A;  2Y7A A;  1QRG A;  4HO8 A;  3VBP A;  1SST A;  1I52 A;  4EAA A;  5IDT A;  2Y4K A;  4CJB A;  3I0E A;  3R5A A;  4HO9 A;  2RJ0 A;  1H5S B;  2AES A;  1GQ9 A;  4Y7T A;  4UEG A;  4AA7 A;  2JF3 A;  2P73 A;  2AH9 A;  1QGS A;  2VFZ A;  1SSQ A;  5C49 A;  1JVD A;  2XMH A;  4EQY A;  4CJ8 A;  1ZIZ A;  4D0Z A;  3ECT A;  5C4D A;  3N9W A;  1FXJ A;  4FRO A;  5U2K A;  3DHO A;  3VBM A;  4XWI A;  2WLE A;  3EH0 A;  1VGT A;  4FRE A;  4Y6N A;  4D48 A;  2IUA A;  4P00 A;  4B2W A;  5C4C A;  2OEG A;  4D11 A;  1ZI4 A;  3R2W A;  3I0I X;  1NQI B;  3JUJ A;  5CQO A;  2RJ6 A;  1T3D A;  1O7O A;  2BO6 A;  5CQN X;  2O1F A;  3V0M A;  1G2V A;  2RJ4 A;  1ZI5 A;  2GGQ A;  1S4P A;  1WT1 A;  1O23 B;  2WLD A;  2QKX A;  1JYL A;  1ON6 A;  2RJ5 A;  3KIA A;  5CMF X;  1ZJO A;  2YQJ A;  3SPT A;  4FRL A;  4KT7 A;  5FU8 A;  1FR9 A;  1MR9 A;  1ZI1 A;  1XHD A;  3TIO A;  3TIS A;  4HZD A;  2Q4J A;  2O1G A;  3TQD A;  2DPW A;  5CQM X;  1R80 A;  4R7P A;  3NGW A;  4EE3 A;  1H7Q A;  2OI5 A;  4B2X A;  1TDT A;  4N69 A;  2VHE A;  1IIN A;  1NWG B;  1JVG A;  4EEM A;  1OMX A;  4HZC A;  2YQS A;  5CQL X;  1ZDG A;  5DDT A;  1QGQ A;  2TDT A;  3BFP A;  4EEO A;  1HM0 A;  1W55 A;  4KQL A;  3HSQ A;  2VSH A;  1QRF A;  1H3M A;  3V0P A;  3D98 A;  1G93 A;  3LW6 A;  1SSM A;  2AE7 A;  1V83 A;  3E25 A;  5CMG X;  4Y64 A;  5C3D A;  2A8U A;  1FG5 N;  2PGV A;  1S4O A;  2BO8 A;  2AQ9 A;  4FRH A;  3U2W A;  1KK4 A;  1LL3 A;  5CMJ A;  1H5T B;  2VS4 A;  1R7X A;  4R37 A;  1GX4 A;  3ZGG A;  4M9C A;  3T7N A;  1KHR A;  3OTM A;  4FRQ A;  1MR7 A;  4FRA A;  2FYD B;  3HL3 A;  1FXO A;  1LL2 A;  1INJ A;  4J18 A;  1O0R A;  1K4V A;  4J09 A;  2X65 A;  4KRV A;  1R7U A;  4Y6U A;  1V3W A;  5C38 A;  1KRU A;  5FV9 A;  1KGQ A;  1H7E A;  3V4E A;  3CU0 A;  5C3A A;  1PZT A;  4EE4 A;  5C4E A;  4EAB A;  4Y63 A;  4B5B A;  1O7Q A;  5EJZ A;  3R0S A;  2W0W A;  2FY7 A;  2VS5 A;  3CGX A;  4P02 A;  4AYJ A;  1KQA A;  3ZF8 A;  1GWW A;  5IFY A;  3PMO A;  2OEF A;  1G3L A;  1QG8 A;  4DEC A;  4KXO A;  3F1C A;  1GX0 A;  4B4M A;  4IHH A;  2XWM A;  1Z90 A;  2P72 A;  1H5T A;  2AGD A;  4Y7F A;  4MZU A;  1ZCV A;  4HO6 A;  3Q4S A;  4KC4 A;  3I3A A;  1ZDF A;  4M2A A;  4Y9X A;  3GVD A;  2YCM A;  2MZB A;  1H4C A;  1VH3 A;  2AEC A;  1ON8 A;  1FGG A;  2QGI A;  2RIJ A;  3I0F A;  3I0D A;  2D7R A;  5BXC A;  1MP3 A;  4C2S A;  1ZHJ A;  1FZW A;  4Y62 A;  1WSZ A;  3E26 A;  5C1G A;  2IU8 A;  4EA8 A;  4HOC A;  3NZ2 A;  4HUS A;  1VZT A;  3ZLK A;  3IGJ A;  3PNN A;  3U2U A;  5IDS A;  4ARW A;  1XZ6 A;  4JIS A;  3I0G A;  3BCV A;  2RIZ A;  2YES A;  2GGO A;  3KWC A;  1G8O A;  1FO9 A;  2PA4 A;  3JUK A;  3MQH A;  3RMV A;  4EE5 A;  1JV3 A;  2ZU8 A;  4EVW A;  5AFU V;  2Y4M A;  2NXV A;  3F1X A;  5F42 A;  1THJ A;  1VGZ A;  3VBL A;  2ICY A;  3Q1X A;  2IU9 A;  4ISX A;  1QRM A;  3I0H A;  1OMZ A;  2FYC B;  2X5Z A;  2I5E A;  3TZT A;  2A8W A;  2V0H A;  3FTT A;  1HV9 A;  1LL0 A;  4B4B A;  3EEV A;  1R7Y A;  2WEE A;  4H7O A;  3IOH A;  2YQH A;  3T7O A;  3USR A;  5AFU U;  4N27 A;  1G9R A;  2JCK A;  4NAK A;  2RJ7 A;  1YP2 A;  2RIT A;  3C8V A;  1VZX A;  2AM5 A;  2ZU7 A;  3OH1 A;  3V0N A;  2Z87 A;  3CKN A;  3TV0 A;  3MQG A;  5AJN A;  5EJ1 A;  2V0K A;  3SXD A;  1VGU A;  2I7B A;  3SX8 A;  4DDZ A;  4KNX A;  2E8B A;  1NMM B;  4FCU A;  4G3S A;  4D0T A;  1TW1 A;  2RJ1 A;  3POL A;  3V0Q A;  4BQH A;  3EE5 A;  2XWN A;  1R81 A;  3R1W A;  3BSS A;  5FTS A;  4HO2 A;  1NF5 B;  3OH4 A;  4HO5 A;  1VH1 A;  4N6B A;  5J49 A;  3BXY A;  1KRR A;  1ZCT A;  2QIV X;  2Y6P A;  5CMI A;  3SXC A;  5AJO A;  1H5R A;  4KPZ A;  2O1H A;  3Q7U A;  1H7G A;  2WVL A;  3KWD A;  1QRL A;  4MYB A;  5FTV A;  3OW5 A;  3R3I A;  1ZJ2 A;  3F1Y A;  5AJP A;  4G3Q A;  3OH3 A;  1LZI A;  3IXC A;  4E75 A;  1ZCU A;  3U0X A;  1MP4 A;  4M2B A;  4CJC A;  1W77 A;  4NAI A;  4CVH A;  1E5K A;  1QQ0 A;  3JTJ A;  2ICX A;  1V84 A;  1V67 A;  4MND A;  2RIX A;  1H4E A;  4KC1 A;  4E6T A;  2JCL A;  2XWL A;  3ST8 A;  3D5N A;  3R5D A;  3SX5 A;  2JF2 A;  5JQQ A;  4E79 A;  4KNR A;  1VIC A;  3FWW A;  5C4B A;  3IOJ A;  4IRQ A;  1GA8 A;  5I1F A;  3VBJ A;  1GWV A;  2WGZ A;  2QH5 A;  1OCX A;  1WT2 A;  4N6A A;  2JCO A;  5ADX V;  3GOS A;  4FRD A;  3DK5 A;  5E3R A;  1G0R A;  3O3P A;  4M4K A;  5C4F A;  2I5K A;  3VNP A;  3DJ4 A;  1HM8 A;  4L41 C;  3BSW A;  3SXG A;  1G1L A;  3K8E A;  2X60 A;  3V8Y A;  1PZY B;  1WVC A;  5CMH A;  1KK6 A;  1LZ7 A;  3OTZ A;  1FO8 A;  2Z86 A;  2PGY A;  2X5S A;  2YC5 A;  1VM8 A;  3FSC A;  3PKQ A;  2D0J A;  1H7T A;  2UX8 A;  3OC9 A;  3TWD A;  5C3B A;  3SRT A;  4HG6 A;  1ZJ3 A;  2FYA A;  5DDV A;  4FRM A;  1FWY A;  3SX7 A;  5ADX U;  3GUE A;  1LZJ A;  1QRE A;  5C48 A;  2WVK A;  3OH2 A;  3U0Y A;  5DEM A;  4IRP A;  2QIA A;  1QWJ A;  1H7H A;  4Y7V A;  5C8R A;  5EIY A;  1FOA A;  5C1H A;  3JQY A;  1ZJ1 A;  1KGT A;  3Q80 A;  4G87 A;  4M98 A;  1JV1 A;  3USQ A;  1V82 A;  3U2V A;  1NKH B;  4B3U A;  2BO4 A;  3BRK X;  3OU9 A;  4FRB A;  1H5S C;  1XAT A;  4IHF A;  1R7V A;  1NHE B;  3P1B A;  5C47 A;  4ASY A;  1G23 A;  3OKR A;  2V0J A;  3FSY A;  2OI7 A;  2XME A;  1VPA A;  3ZGF A;  1ZJ0 A;  3OAM A;  4G3P A;  1VZU A;  2WVM A;  3I3X A;  4DCL A;  3RMW A;  4AYL A;  2VS3 A;  3R5B A;  2VD4 A;  1YRO B;  2YC3 A;  4HO3 A;  3SXE A;  1H5R B;  1OQM B;  2CU2 A;  5FU0 A;  1ZI3 A;  1H5S D;  4KPX A;  2VXM A;  3CKJ A;  4DE7 A;  2WAW A;  3FS8 A;  3SXB A;  1FRW A;  2VXL A;  5FUH A;  5DG3 A;  3V0L A;  2RJ8 A;  2AM4 A;  3CJ8 A;  3I0C A;  1IIM A;  4MYO A;  1TZF A;  3I0K A;  4R36 A;  4E1K A;  1GQC A;  1KRV A;  3CKV A;  2RIY A;  2ZU9 A;  3I0J A;  1INI A;  2OI6 A;  4IHG A;  4EEG A;  1FGX A;  2E3D A;  3DUV A;  1KK5 A;  1HM9 A;  3OUP A;  3VBK A;  1HJJ A;  1H5S A;  1ZJP A;  3CKQ A;  5FYE A;  2WLF A;  4FRP A;  1MRL A;  3V0O A;  2D7I A;  1TW5 A;  2XAT A;  4ZDQ A;  4LW3 A;  2APC A;  1S4N A;  3SXA A;  1LZ0 A;  2YQC A;  2FFU A;  3V8Z A;  1EYR A;  1R7T A;  4FQW A;  2JCJ A;  1VGW A;  1S80 A;  3CKO A;  4KC2 A;  2RJ9 A;  4Y7G A;  2WE9 A;  2Y4L A;  1ZCY A;  3VBI A;  4E6U A;  4BMA A;  4EA7 A;  1LVW A;  4M28 A;  4HO0 A;  3KWE A;  4MFG A;  3HJJ A;  2NPO A;  4EA9 A;  3I0L A;  4JD0 A;  4LW6 A;  3U2X A;  2V0I A;  1EZI A;  5DEP A;  3V90 A;  2WLG A;  3VBN A;  4ASJ A;  1WT0 A;  2FKO A;  2IC7 A;  5HS2 A;  5C36 A;  1MC3 A;  3U2T A;  4B4G A;  3QVB A;  3T7M A;  1LXA A;  5CQP A;  3IOI A;  2FFV A;  4B42 A;  2BO7 A;  4AAW A;  2PX7 A;  3OH0 A;  3V91 A;  1YP3 A;  3R8Y A;  2P2O A;  2WLC A;  1H7L A;  5L6S A;  1JYK A;  5E3Q A;  4Y7U A;  1FR8 A;  4EEA A;  2V0L A;  4NAL A;  5L6V A;  2VSI A;  2W0V A;  3TDT A;  1WT3 A;  3FOQ A;  4HUR A;  1H4D A;  1H7F A;  1SS9 A;  1G95 A;  3SX3 A;  1MP5 A; 
#chains in the Genus database with same CATH topology
 3FSX A;  1YP4 A;  2AM3 A;  2Y4J A;  4HO4 A;  3R5C A;  3BSY A;  5E3P A;  3R3R A;  3K8D A;  4HCQ A;  1J2Z A;  4FCE A;  4EGG A;  1R82 A;  1KWS A;  4AC3 A;  3PKP A;  4GBP A;  1XHB A;  4YS8 A;  3OGZ A;  4D11 C;  1W57 A;  1TVY A;  3P47 A;  3T57 A;  2P6W A;  3ZLL A;  5C1L A;  3RSB A;  2FYB A;  3MC4 A;  4NAN A;  3EG4 A;  1G97 A;  4K6R A;  3FSB A;  4ECM A;  3D8V A;  3TK8 A;  4M99 A;  1HJL A;  2Y7A A;  1QRG A;  4HO8 A;  3VBP A;  1SST A;  1I52 A;  4EAA A;  5IDT A;  2Y4K A;  4CJB A;  3I0E A;  3R5A A;  4HO9 A;  2RJ0 A;  1H5S B;  2AES A;  1GQ9 A;  4Y7T A;  4UEG A;  4AA7 A;  2JF3 A;  2P73 A;  2AH9 A;  1QGS A;  2VFZ A;  1SSQ A;  5C49 A;  1JVD A;  2XMH A;  4EQY A;  4Q7C A;  4CJ8 A;  1ZIZ A;  4D0Z A;  3ECT A;  5C4D A;  3N9W A;  1FXJ A;  4FRO A;  5U2K A;  3DHO A;  4FIX A;  3VBM A;  4XWI A;  2WLE A;  1L0S A;  3EH0 A;  1VGT A;  4FRE A;  4Y6N A;  4D48 A;  2IUA A;  4P00 A;  4B2W A;  5C4C A;  2OEG A;  4D11 A;  1ZI4 A;  3R2W A;  3I0I X;  1NQI B;  3JUJ A;  5CQO A;  2RJ6 A;  1T3D A;  1O7O A;  2BO6 A;  5CQN X;  2O1F A;  3V0M A;  1G2V A;  2RJ4 A;  1ZI5 A;  2GGQ A;  1S4P A;  1WT1 A;  1O23 B;  2WLD A;  2QKX A;  1JYL A;  1ON6 A;  2RJ5 A;  3KIA A;  5CMF X;  1ZJO A;  2YQJ A;  3SPT A;  4FRL A;  4KT7 A;  5FU8 A;  1FR9 A;  1MR9 A;  1ZI1 A;  1XHD A;  3TIO A;  3TIS A;  4HZD A;  2Q4J A;  2O1G A;  3TQD A;  2DPW A;  5CQM X;  1R80 A;  4R7P A;  3NGW A;  4EE3 A;  1H7Q A;  2OI5 A;  4B2X A;  1TDT A;  4N69 A;  2VHE A;  1IIN A;  1NWG B;  1JVG A;  4EEM A;  1OMX A;  4HZC A;  2YQS A;  5CQL X;  1ZDG A;  5DDT A;  1QGQ A;  2TDT A;  3BFP A;  4EEO A;  1HM0 A;  1W55 A;  4KQL A;  3HSQ A;  2VSH A;  1QRF A;  1H3M A;  3V0P A;  3D98 A;  1G93 A;  3LW6 A;  1SSM A;  2AE7 A;  1V83 A;  3E25 A;  5CMG X;  2VK9 A;  4Y64 A;  5C3D A;  2A8U A;  1FG5 N;  2PGV A;  1S4O A;  2BO8 A;  2AQ9 A;  4FRH A;  3U2W A;  1KK4 A;  1LL3 A;  5CMJ A;  1H5T B;  2VS4 A;  1R7X A;  4R37 A;  1GX4 A;  3ZGG A;  4M9C A;  3T7N A;  1KHR A;  3OTM A;  4FRQ A;  1MR7 A;  4FRA A;  2FYD B;  3HL3 A;  1FXO A;  1LL2 A;  1INJ A;  4J18 A;  1O0R A;  1K4V A;  4J09 A;  2X65 A;  4KRV A;  1R7U A;  4Y6U A;  1V3W A;  5C38 A;  1KRU A;  5FV9 A;  1KGQ A;  1H7E A;  3V4E A;  3CU0 A;  5C3A A;  1PZT A;  4EE4 A;  4FIY A;  5C4E A;  4EAB A;  4Y63 A;  4B5B A;  1O7Q A;  5EJZ A;  3R0S A;  2W0W A;  1EWW A;  2FY7 A;  2VS5 A;  3CGX A;  4P02 A;  4AYJ A;  1KQA A;  3ZF8 A;  1GWW A;  5IFY A;  3PMO A;  2OEF A;  1G3L A;  1QG8 A;  4DEC A;  4KXO A;  3F1C A;  1GX0 A;  4B4M A;  4IHH A;  2XWM A;  1Z90 A;  2P72 A;  1H5T A;  2AGD A;  4Y7F A;  4MZU A;  1ZCV A;  4HO6 A;  3Q4S A;  4KC4 A;  3I3A A;  1ZDF A;  4M2A A;  4Y9X A;  3GVD A;  2YCM A;  2MZB A;  1H4C A;  1VH3 A;  2AEC A;  1ON8 A;  1FGG A;  2QGI A;  2RIJ A;  3I0F A;  3I0D A;  2D7R A;  5BXC A;  1MP3 A;  4C2S A;  1ZHJ A;  1FZW A;  4Y62 A;  1WSZ A;  3E26 A;  5C1G A;  2IU8 A;  4EA8 A;  4HOC A;  3NZ2 A;  4HUS A;  1VZT A;  3ZLK A;  1N4I A;  3IGJ A;  3PNN A;  3U2U A;  5IDS A;  4ARW A;  1XZ6 A;  4JIS A;  3GQ9 A;  3I0G A;  3BCV A;  2RIZ A;  2YES A;  2GGO A;  3KWC A;  1G8O A;  1FO9 A;  2PA4 A;  3JUK A;  3MQH A;  3RMV A;  4EE5 A;  1JV3 A;  2ZU8 A;  4EVW A;  5AFU V;  2Y4M A;  2NXV A;  5D92 A;  3F1X A;  5F42 A;  1THJ A;  1VGZ A;  3VBL A;  2ICY A;  3Q1X A;  2IU9 A;  4ISX A;  1QRM A;  3I0H A;  1OMZ A;  2FYC B;  2X5Z A;  2I5E A;  3TZT A;  2A8W A;  2V0H A;  3FTT A;  1HV9 A;  1LL0 A;  4B4B A;  3EEV A;  1R7Y A;  2WEE A;  4H7O A;  3IOH A;  2YQH A;  3T7O A;  3USR A;  5AFU U;  4N27 A;  1G9R A;  2JCK A;  2J0B A;  4NAK A;  2RJ7 A;  1YP2 A;  2RIT A;  3C8V A;  1VZX A;  3OH1 A;  2AM5 A;  2ZU7 A;  3V0N A;  2Z87 A;  3CKN A;  3TV0 A;  3MQG A;  5AJN A;  5EJ1 A;  2V0K A;  3SXD A;  1VGU A;  2I7B A;  3SX8 A;  4DDZ A;  4KNX A;  2E8B A;  1NMM B;  4FCU A;  4G3S A;  4D0T A;  1TW1 A;  2RJ1 A;  3POL A;  3V0Q A;  4BQH A;  3EE5 A;  2XWN A;  1R81 A;  3R1W A;  3BSS A;  5FTS A;  4HO2 A;  1NF5 B;  3OH4 A;  4HO5 A;  4MIX A;  1VH1 A;  4N6B A;  5J49 A;  3BXY A;  1KRR A;  1ZCT A;  2QIV X;  2Y6P A;  5CMI A;  3SXC A;  5AJO A;  1H5R A;  3GQA A;  4KPZ A;  2O1H A;  3Q7U A;  1H7G A;  2WVL A;  3KWD A;  1QRL A;  4MYB A;  5FTV A;  3OW5 A;  3R3I A;  1ZJ2 A;  3F1Y A;  5AJP A;  4G3Q A;  3OH3 A;  1LZI A;  3IXC A;  4E75 A;  1ZCU A;  3U0X A;  1MP4 A;  4M2B A;  4CJC A;  1W77 A;  4NAI A;  4CVH A;  1E5K A;  1QQ0 A;  3JTJ A;  2ICX A;  1V84 A;  1V67 A;  4MND A;  2RIX A;  1H4E A;  4KC1 A;  4E6T A;  2JCL A;  2XWL A;  3ST8 A;  3D5N A;  3R5D A;  3SX5 A;  2JF2 A;  5JQQ A;  4E79 A;  4KNR A;  1VIC A;  3FWW A;  5C4B A;  3IOJ A;  4IRQ A;  1GA8 A;  3GQ8 A;  3VBJ A;  5I1F A;  1GWV A;  2WGZ A;  2QH5 A;  1OCX A;  1WT2 A;  4N6A A;  2JCO A;  5ADX V;  3GOS A;  4FRD A;  3DK5 A;  5E3R A;  1G0R A;  3O3P A;  4M4K A;  5C4F A;  3VNP A;  2I5K A;  3DJ4 A;  1HM8 A;  4L41 C;  3BSW A;  3SXG A;  1G1L A;  3K8E A;  2X60 A;  3V8Y A;  1PZY B;  1WVC A;  5CMH A;  1KK6 A;  1LZ7 A;  3OTZ A;  2J0A A;  1FO8 A;  2Z86 A;  2PGY A;  2X5S A;  2YC5 A;  1VM8 A;  3FSC A;  3PKQ A;  2D0J A;  1H7T A;  2UX8 A;  3OC9 A;  3TWD A;  5C3B A;  3SRT A;  4HG6 A;  1ZJ3 A;  2FYA A;  5DDV A;  4FRM A;  1FWY A;  3SX7 A;  5ADX U;  3GUE A;  1LZJ A;  1QRE A;  5C48 A;  2WVK A;  3OH2 A;  3U0Y A;  5DEM A;  4IRP A;  2QIA A;  1QWJ A;  1H7H A;  4Y7V A;  5C8R A;  5EIY A;  1FOA A;  5C1H A;  3JQY A;  1ZJ1 A;  1KGT A;  3Q80 A;  3GQ7 A;  4G87 A;  4M98 A;  1JV1 A;  3USQ A;  1V82 A;  3U2V A;  1NKH B;  4B3U A;  2BO4 A;  3BRK X;  3OU9 A;  4FRB A;  1H5S C;  1XAT A;  4IHF A;  1R7V A;  1NHE B;  3P1B A;  5C47 A;  4ASY A;  1G23 A;  3OKR A;  2V0J A;  3FSY A;  2OI7 A;  2XME A;  1VPA A;  3ZGF A;  1ZJ0 A;  3OAM A;  4G3P A;  1VZU A;  2WVM A;  3I3X A;  2C0N A;  4DCL A;  3RMW A;  4AYL A;  2VS3 A;  3R5B A;  2VD4 A;  1YRO B;  2YC3 A;  4HO3 A;  3SXE A;  1H5R B;  1OQM B;  2CU2 A;  3SUC A;  1ZI3 A;  5FU0 A;  1H5S D;  4KPX A;  2VXM A;  3CKJ A;  4DE7 A;  2WAW A;  3FS8 A;  3SXB A;  1FRW A;  2VXL A;  5FUH A;  5DG3 A;  3V0L A;  2RJ8 A;  2AM4 A;  3CJ8 A;  3I0C A;  1IIM A;  4MYO A;  1TZF A;  3I0K A;  4R36 A;  4E1K A;  1GQC A;  1KRV A;  3CKV A;  2RIY A;  2ZU9 A;  3I0J A;  1INI A;  2OI6 A;  4IHG A;  4EEG A;  1FGX A;  2E3D A;  3DUV A;  1KK5 A;  1HM9 A;  3OUP A;  3VBK A;  1HJJ A;  1H5S A;  1ZJP A;  3CKQ A;  5FYE A;  4O6M A;  2WLF A;  4FRP A;  1MRL A;  3V0O A;  2D7I A;  1TW5 A;  2XAT A;  4ZDQ A;  4LW3 A;  2APC A;  1S4N A;  3SXA A;  1LZ0 A;  2YQC A;  2FFU A;  3V8Z A;  1EYR A;  1R7T A;  4FQW A;  2JCJ A;  1VGW A;  1S80 A;  3CKO A;  4KC2 A;  2RJ9 A;  4Y7G A;  2WE9 A;  2Y4L A;  4O6N A;  1ZCY A;  3VBI A;  1Z2F A;  4E6U A;  4BMA A;  4EA7 A;  1LVW A;  4M28 A;  5D91 A;  4HO0 A;  3KWE A;  4MFG A;  3HJJ A;  2NPO A;  4EA9 A;  3I0L A;  4JD0 A;  4LW6 A;  3U2X A;  2V0I A;  1EZI A;  5DEP A;  3V90 A;  1M8N A;  2WLG A;  3VBN A;  4ASJ A;  1WT0 A;  2FKO A;  2IC7 A;  5HS2 A;  5C36 A;  1MC3 A;  3U2T A;  4B4G A;  3QVB A;  3T7M A;  1LXA A;  5CQP A;  3IOI A;  2FFV A;  4B42 A;  2BO7 A;  4AAW A;  3OH0 A;  2PX7 A;  3V91 A;  1YP3 A;  3R8Y A;  2P2O A;  2WLC A;  1H7L A;  5L6S A;  1JYK A;  5E3Q A;  4Y7U A;  1FR8 A;  4EEA A;  2V0L A;  4NAL A;  5L6V A;  2VSI A;  2W0V A;  3TDT A;  1WT3 A;  3FOQ A;  4HUR A;  1H4D A;  1H7F A;  1SS9 A;  1G95 A;  3SX3 A;  1MP5 A; 
#chains in the Genus database with same CATH homology
 3FSX A;  1YP4 A;  2AM3 A;  2Y4J A;  4HO4 A;  3R5C A;  3BSY A;  5E3P A;  3R3R A;  3K8D A;  4HCQ A;  1J2Z A;  4FCE A;  4EGG A;  1R82 A;  1KWS A;  4AC3 A;  3PKP A;  4GBP A;  1XHB A;  4YS8 A;  3OGZ A;  4D11 C;  1W57 A;  1TVY A;  3P47 A;  3T57 A;  2P6W A;  3ZLL A;  5C1L A;  3RSB A;  2FYB A;  3MC4 A;  4NAN A;  3EG4 A;  1G97 A;  4K6R A;  3FSB A;  4ECM A;  3D8V A;  3TK8 A;  4M99 A;  1HJL A;  2Y7A A;  1QRG A;  4HO8 A;  3VBP A;  1SST A;  1I52 A;  4EAA A;  5IDT A;  2Y4K A;  4CJB A;  3I0E A;  3R5A A;  4HO9 A;  2RJ0 A;  1H5S B;  2AES A;  1GQ9 A;  4Y7T A;  4UEG A;  4AA7 A;  2JF3 A;  2P73 A;  2AH9 A;  1QGS A;  2VFZ A;  1SSQ A;  5C49 A;  1JVD A;  2XMH A;  4EQY A;  4Q7C A;  4CJ8 A;  1ZIZ A;  4D0Z A;  3ECT A;  5C4D A;  3N9W A;  1FXJ A;  4FRO A;  5U2K A;  3DHO A;  4FIX A;  3VBM A;  4XWI A;  2WLE A;  3EH0 A;  1VGT A;  4FRE A;  4Y6N A;  4D48 A;  2IUA A;  4P00 A;  4B2W A;  5C4C A;  2OEG A;  4D11 A;  1ZI4 A;  3R2W A;  3I0I X;  1NQI B;  3JUJ A;  5CQO A;  2RJ6 A;  1T3D A;  1O7O A;  2BO6 A;  5CQN X;  2O1F A;  3V0M A;  1G2V A;  2RJ4 A;  1ZI5 A;  2GGQ A;  1S4P A;  1WT1 A;  1O23 B;  2WLD A;  2QKX A;  1JYL A;  1ON6 A;  2RJ5 A;  3KIA A;  5CMF X;  1ZJO A;  2YQJ A;  3SPT A;  4FRL A;  4KT7 A;  5FU8 A;  1FR9 A;  1MR9 A;  1ZI1 A;  1XHD A;  3TIO A;  3TIS A;  4HZD A;  2Q4J A;  2O1G A;  3TQD A;  2DPW A;  5CQM X;  1R80 A;  4R7P A;  3NGW A;  4EE3 A;  1H7Q A;  2OI5 A;  4B2X A;  1TDT A;  4N69 A;  2VHE A;  1IIN A;  1NWG B;  1JVG A;  4EEM A;  1OMX A;  4HZC A;  2YQS A;  5CQL X;  1ZDG A;  5DDT A;  1QGQ A;  2TDT A;  3BFP A;  4EEO A;  1HM0 A;  1W55 A;  4KQL A;  3HSQ A;  2VSH A;  1QRF A;  1H3M A;  3V0P A;  3D98 A;  1G93 A;  3LW6 A;  1SSM A;  2AE7 A;  1V83 A;  3E25 A;  5CMG X;  2VK9 A;  4Y64 A;  5C3D A;  2A8U A;  1FG5 N;  2PGV A;  1S4O A;  2BO8 A;  2AQ9 A;  4FRH A;  3U2W A;  1KK4 A;  1LL3 A;  5CMJ A;  1H5T B;  2VS4 A;  1R7X A;  4R37 A;  1GX4 A;  3ZGG A;  4M9C A;  3T7N A;  1KHR A;  3OTM A;  4FRQ A;  1MR7 A;  4FRA A;  2FYD B;  3HL3 A;  1FXO A;  1LL2 A;  1INJ A;  4J18 A;  1O0R A;  1K4V A;  4J09 A;  2X65 A;  4KRV A;  1R7U A;  4Y6U A;  1V3W A;  5C38 A;  1KRU A;  5FV9 A;  1KGQ A;  1H7E A;  3V4E A;  3CU0 A;  5C3A A;  1PZT A;  4EE4 A;  4FIY A;  5C4E A;  4EAB A;  4Y63 A;  4B5B A;  1O7Q A;  5EJZ A;  3R0S A;  2W0W A;  2FY7 A;  2VS5 A;  3CGX A;  4P02 A;  4AYJ A;  1KQA A;  3ZF8 A;  1GWW A;  5IFY A;  3PMO A;  2OEF A;  1G3L A;  1QG8 A;  4DEC A;  4KXO A;  3F1C A;  1GX0 A;  4B4M A;  4IHH A;  2XWM A;  1Z90 A;  2P72 A;  1H5T A;  2AGD A;  4Y7F A;  4MZU A;  1ZCV A;  4HO6 A;  3Q4S A;  4KC4 A;  3I3A A;  1ZDF A;  4M2A A;  4Y9X A;  3GVD A;  2YCM A;  2MZB A;  1H4C A;  1VH3 A;  2AEC A;  1ON8 A;  1FGG A;  2QGI A;  2RIJ A;  3I0F A;  3I0D A;  2D7R A;  5BXC A;  1MP3 A;  4C2S A;  1ZHJ A;  1FZW A;  4Y62 A;  1WSZ A;  3E26 A;  5C1G A;  2IU8 A;  4EA8 A;  4HOC A;  3NZ2 A;  4HUS A;  1VZT A;  3ZLK A;  3IGJ A;  3PNN A;  3U2U A;  5IDS A;  4ARW A;  1XZ6 A;  4JIS A;  3I0G A;  3BCV A;  2RIZ A;  2YES A;  2GGO A;  3KWC A;  1G8O A;  1FO9 A;  2PA4 A;  3JUK A;  3MQH A;  3RMV A;  4EE5 A;  1JV3 A;  2ZU8 A;  4EVW A;  5AFU V;  2Y4M A;  2NXV A;  5D92 A;  3F1X A;  5F42 A;  1THJ A;  1VGZ A;  3VBL A;  2ICY A;  3Q1X A;  2IU9 A;  4ISX A;  1QRM A;  3I0H A;  1OMZ A;  2FYC B;  2X5Z A;  2I5E A;  3TZT A;  2A8W A;  2V0H A;  3FTT A;  1HV9 A;  1LL0 A;  4B4B A;  3EEV A;  1R7Y A;  2WEE A;  4H7O A;  3IOH A;  2YQH A;  3T7O A;  3USR A;  5AFU U;  4N27 A;  1G9R A;  2JCK A;  2J0B A;  4NAK A;  2RJ7 A;  1YP2 A;  2RIT A;  3C8V A;  1VZX A;  2AM5 A;  2ZU7 A;  3OH1 A;  3V0N A;  2Z87 A;  3CKN A;  3TV0 A;  3MQG A;  5AJN A;  5EJ1 A;  2V0K A;  3SXD A;  1VGU A;  2I7B A;  3SX8 A;  4DDZ A;  4KNX A;  2E8B A;  1NMM B;  4FCU A;  4G3S A;  4D0T A;  1TW1 A;  2RJ1 A;  3POL A;  3V0Q A;  4BQH A;  3EE5 A;  2XWN A;  1R81 A;  3R1W A;  3BSS A;  5FTS A;  4HO2 A;  1NF5 B;  3OH4 A;  4HO5 A;  4MIX A;  1VH1 A;  4N6B A;  5J49 A;  3BXY A;  1KRR A;  1ZCT A;  2QIV X;  2Y6P A;  5CMI A;  3SXC A;  5AJO A;  1H5R A;  4KPZ A;  2O1H A;  3Q7U A;  1H7G A;  2WVL A;  3KWD A;  1QRL A;  4MYB A;  5FTV A;  3OW5 A;  3R3I A;  1ZJ2 A;  3F1Y A;  5AJP A;  4G3Q A;  3OH3 A;  1LZI A;  3IXC A;  4E75 A;  1ZCU A;  3U0X A;  1MP4 A;  4M2B A;  4CJC A;  1W77 A;  4NAI A;  4CVH A;  1E5K A;  1QQ0 A;  3JTJ A;  2ICX A;  1V84 A;  1V67 A;  4MND A;  2RIX A;  1H4E A;  4KC1 A;  4E6T A;  2JCL A;  2XWL A;  3ST8 A;  3D5N A;  3R5D A;  3SX5 A;  2JF2 A;  5JQQ A;  4E79 A;  4KNR A;  1VIC A;  3FWW A;  5C4B A;  3IOJ A;  4IRQ A;  1GA8 A;  5I1F A;  3VBJ A;  1GWV A;  2WGZ A;  2QH5 A;  1OCX A;  1WT2 A;  4N6A A;  2JCO A;  5ADX V;  3GOS A;  4FRD A;  3DK5 A;  5E3R A;  1G0R A;  3O3P A;  4M4K A;  5C4F A;  2I5K A;  3VNP A;  3DJ4 A;  1HM8 A;  4L41 C;  3BSW A;  3SXG A;  1G1L A;  3K8E A;  2X60 A;  3V8Y A;  1PZY B;  1WVC A;  5CMH A;  1KK6 A;  1LZ7 A;  3OTZ A;  2J0A A;  1FO8 A;  2Z86 A;  2PGY A;  2X5S A;  2YC5 A;  1VM8 A;  3FSC A;  3PKQ A;  2D0J A;  1H7T A;  2UX8 A;  3OC9 A;  3TWD A;  5C3B A;  3SRT A;  4HG6 A;  1ZJ3 A;  2FYA A;  5DDV A;  4FRM A;  1FWY A;  3SX7 A;  5ADX U;  3GUE A;  1LZJ A;  1QRE A;  5C48 A;  2WVK A;  3OH2 A;  3U0Y A;  5DEM A;  4IRP A;  2QIA A;  1QWJ A;  1H7H A;  4Y7V A;  5C8R A;  5EIY A;  1FOA A;  5C1H A;  3JQY A;  1ZJ1 A;  1KGT A;  3Q80 A;  4G87 A;  4M98 A;  1JV1 A;  3USQ A;  1V82 A;  3U2V A;  1NKH B;  4B3U A;  2BO4 A;  3BRK X;  3OU9 A;  4FRB A;  1H5S C;  1XAT A;  4IHF A;  1R7V A;  1NHE B;  3P1B A;  5C47 A;  4ASY A;  1G23 A;  3OKR A;  2V0J A;  3FSY A;  2OI7 A;  2XME A;  1VPA A;  3ZGF A;  1ZJ0 A;  3OAM A;  4G3P A;  1VZU A;  2WVM A;  3I3X A;  2C0N A;  4DCL A;  3RMW A;  4AYL A;  2VS3 A;  3R5B A;  2VD4 A;  1YRO B;  2YC3 A;  4HO3 A;  3SXE A;  1H5R B;  1OQM B;  2CU2 A;  5FU0 A;  1ZI3 A;  1H5S D;  4KPX A;  2VXM A;  3CKJ A;  4DE7 A;  2WAW A;  3FS8 A;  3SXB A;  1FRW A;  2VXL A;  5FUH A;  5DG3 A;  3V0L A;  2RJ8 A;  2AM4 A;  3CJ8 A;  3I0C A;  1IIM A;  4MYO A;  1TZF A;  3I0K A;  4R36 A;  4E1K A;  1GQC A;  1KRV A;  3CKV A;  2RIY A;  2ZU9 A;  3I0J A;  1INI A;  2OI6 A;  4IHG A;  4EEG A;  1FGX A;  2E3D A;  3DUV A;  1KK5 A;  1HM9 A;  3OUP A;  3VBK A;  1HJJ A;  1H5S A;  1ZJP A;  3CKQ A;  5FYE A;  4O6M A;  2WLF A;  4FRP A;  1MRL A;  3V0O A;  2D7I A;  1TW5 A;  2XAT A;  4ZDQ A;  4LW3 A;  2APC A;  1S4N A;  3SXA A;  1LZ0 A;  2YQC A;  2FFU A;  3V8Z A;  1EYR A;  1R7T A;  4FQW A;  2JCJ A;  1VGW A;  1S80 A;  3CKO A;  4KC2 A;  2RJ9 A;  4Y7G A;  2WE9 A;  2Y4L A;  4O6N A;  1ZCY A;  3VBI A;  4E6U A;  4BMA A;  4EA7 A;  1LVW A;  4M28 A;  5D91 A;  4HO0 A;  3KWE A;  4MFG A;  3HJJ A;  2NPO A;  4EA9 A;  3I0L A;  4JD0 A;  4LW6 A;  3U2X A;  2V0I A;  1EZI A;  5DEP A;  3V90 A;  2WLG A;  3VBN A;  4ASJ A;  1WT0 A;  2FKO A;  2IC7 A;  5HS2 A;  5C36 A;  1MC3 A;  3U2T A;  4B4G A;  3QVB A;  3T7M A;  1LXA A;  5CQP A;  3IOI A;  2FFV A;  4B42 A;  2BO7 A;  4AAW A;  2PX7 A;  3OH0 A;  3V91 A;  1YP3 A;  3R8Y A;  2P2O A;  2WLC A;  1H7L A;  5L6S A;  1JYK A;  5E3Q A;  4Y7U A;  1FR8 A;  4EEA A;  2V0L A;  4NAL A;  5L6V A;  2VSI A;  2W0V A;  3TDT A;  1WT3 A;  3FOQ A;  4HUR A;  1H4D A;  1H7F A;  1SS9 A;  1G95 A;  3SX3 A;  1MP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...