4G3SA

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine and pyrophosphate snapshot 2
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Structural Snapshots of Glmu from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 175
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g3sA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g3sA01
1O7QA 3SPTA 3OU9A 5DEPA 5DG3A 1LXAA 3FSXA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3VNPA 2RJ0A 3RSBA 2RJ7A 2VS3A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 3CJ8A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4N69A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 3R5BA 2FYCB 2DPWA 1QWJA 3V0OA 1MRLA 3PMOA 2I5EA 2AM5A 2XWNA 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1G97A 1INJA 1VPAA 3U0YA 4M9CA 3MQGA 1YROB 4LW6A 3DHOA 1FR8A 1QRFA 4ISXA 4M98A 1R7XA 3JQYA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 1J2ZA 2I7BA 3HL3A 1INIA 4E75A 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 3Q1XA 4EVWA 3KWDA 4N6AA 4IHFA 4N27A 4NANA 3BXYA 3R5DA 4R37A 5AFUU 4HUSA 1S80A 2IUAA 3TDTA 3D8VA 1ZIZA 1HM8A 1KRRA 3FTTA 4EE3A 3TQDA 1KRUA 2OI7A 4HZDA 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 3FSYA 3OAMA 5BXCA 3FSCA 5L6SA 4B4MA 1QRLA 2YQHA 1V82A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 3OTZA 5JQQA 1XHBA 1ZCVA 4AC3A 1KGTA 2TDTA 2PA4A 1ZCTA 1LL0A 1SSQA 1FWYA 3CKVA 2JF3A 2XATA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1KHRA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 3E25A 3T7OA 1MR7A 3BSSA 3Q80A 3V0LA 1ZJ0A 5ADXV 1TW5A 5C1HA 4J18A 5DEMA 2VSIA 3IGJA 2Z86A 3CKQA 3I0JA 3OH4A 4HURA 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 4E6TA 1THJA 2NPOA 1G93A 1ZI4A 5C1GA 2WVLA 3HSQA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 3FSBA 3IXCA 1R82A 4EAAA 1JVDA 1ZJ1A 1R7UA 1ZI1A 3DK5A 2AE7A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 3R0SA 1FGXA 1H3MA 4EA7A 1KQAA 4MFGA 3SX8A 1GQ9A 2JF2A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 4R7PA 4KC1A 1XZ6A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 3VBNA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3KWCA 2QIAA 3V0PA 4E79A 5FU8A 1LZIA 1JV1A 3VBJA 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 3P47A 1ZCUA 1MP5A 3OKRA 3OUPA 1H5TB 2CU2A 2D7RA 4FRQA 1OCXA 3FWWA 3OH1A 3EH0A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3TISA 3TIOA 3RMWA 3V0QA 4AAWA 2OI6A 4AA7A 1TZFA 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3SRTA 3K8DA 4EA9A 1GQCA 4MZUA 1H5SA 3O3PA 2QIVX 3Q4SA 2ICXA 4KQLA 1V3WA 1WT1A 5U2KA 3JUKA 1H5SC 2RJ8A 2AH9A 1QQ0A 2JCKA 5AJPA 4UEGA 1ZHJA 3R3RA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 3BSWA 3BFPA 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 4HZCA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 5F42A 1TVYA 2BO8A 4EGGA 4CJ8A 5C3DA 1XHDA 1NWGB 4EEMA 1H7TA 1V83A 2RIJA 1WT0A 3TV0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 1GA8A 1QGSA 2RIXA 5C8RA 3T57A 4XWIA 3OC9A 3I3AA 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 4FCEA 2BO7A 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 5ADXU 3GVDA 2WLCA 3I0EA 3U2TA 2A8WA 3GOSA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 3I3XA 1OMZA 4IHGA 4B4GA 4KPXA 1MP4A 5L6VA 1O0RA 2I5KA 3IOIA 4FRBA 3RMVA 1KK5A 5E3PA 5E3QA 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 3VBIA 5FTVA 2AECA 3VBKA 3HJJA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 3VBMA 2AM3A 4AYJA 3R5AA 5FUHA 4DCLA 3SXAA 2QGIA 1YP2A 2RJ4A 1MR9A 2WLGA 4HCQA 1QREA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 1QRGA 4EEOA 4E6UA 1NMMB 1T3DA 2X65A 1GWVA 4KNRA 3ZLKA 2WLEA 2JCOA 2WLDA 2D7IA 4KNXA 3Q7UA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 1XATA 3NZ2A 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 1IINA 3D5NA 4Y6UA 4G3SA 2P2OA 3KWEA 1H4CA 3F1YA 1H5TA 4N6BA 5DDTA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 1KK4A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 2IU8A 1R81A 3ZGFA 3BSYA 2X5ZA 4KXOA 3FS8A 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 3V4EA 4Y7TA 5AFUV 3R1WA 3OTMA 1LVWA 2IU9A 3QVBA 1VGTA 1GWWA 3CGXA 5C1LA 5CQPA 4M28A 2WE9A 1TDTA 3ST8A 1LZ7A 3OGZA 3VBPA 1ZDGA 4ASJA 5C4DA 1QRMA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EA8A 2BO4A 1ON8A 4EE4A 1ZJOA 2ICYA 1MC3A 4M2AA 5C47A 2VHEA 1SSTA 5EJZA 1VZXA 1SSMA 3U2XA 2BO6A 2YCMA 3F1XA 2A8UA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 4M99A 1KGQA 1HM9A 3C8VA 3CU0A 1KRVA 4HO5A 4Y63A 4R36A 3MQHA 1PZTA 2O1GA 2VD4A 3EEVA 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2IC7A 2XMHA 3TWDA 1NHEB 4J09A 2WAWA 4E1KA 3ECTA 3ZGGA 2Y4MA 5E3RA 5C4FA 2YC5A 3V8YA 1GX0A 5I1FA 4G87A 3R5CA 4H7OA 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 3R8YA 1PZYB 4HO9A 1QGQA 3EG4A 4KPZA 1ZCYA 3TK8A 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 4MYOA 4EABA 3VBLA 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3P1BA 4EQYA 3R3IA 1R80A 1KK6A 2W0WA 1O23B 1H4EA 3MC4A 2AQ9A 1FR9A 2WLFA 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 1FO8A 5CQNX 4IHHA 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 1V67A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 2FKOA 1FXOA 1ZJPA 2FFVA 3OW5A 1HJJA 3SXCA
chains in the Genus database with same CATH superfamily
1O7QA 3SPTA 3OU9A 5DEPA 5DG3A 1LXAA 3FSXA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3VNPA 2RJ0A 3RSBA 2RJ7A 2VS3A 3GQ7A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 3CJ8A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4N69A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 3R5BA 2FYCB 2DPWA 1QWJA 3V0OA 1MRLA 3PMOA 2I5EA 2AM5A 2XWNA 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1G97A 1INJA 1VPAA 3U0YA 4M9CA 1Z2FA 3MQGA 1YROB 4LW6A 3DHOA 1FR8A 1QRFA 4ISXA 4M98A 1R7XA 3JQYA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 1J2ZA 2I7BA 3HL3A 1INIA 4E75A 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 3Q1XA 4EVWA 3KWDA 4N6AA 4IHFA 4N27A 4NANA 3BXYA 3R5DA 4R37A 5AFUU 4HUSA 1S80A 2IUAA 3TDTA 3D8VA 1ZIZA 1HM8A 1KRRA 3FTTA 4EE3A 4Q7CA 3TQDA 1KRUA 2OI7A 4HZDA 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 3FSYA 3OAMA 5BXCA 3FSCA 5L6SA 4B4MA 1QRLA 2YQHA 1V82A 3GQ8A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 3OTZA 5JQQA 1XHBA 1ZCVA 4AC3A 1KGTA 2TDTA 2PA4A 1ZCTA 1LL0A 1SSQA 1FWYA 3CKVA 2JF3A 2XATA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1KHRA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 2C0NA 3E25A 3T7OA 1MR7A 3BSSA 3Q80A 3V0LA 1ZJ0A 5ADXV 1TW5A 5C1HA 4J18A 5DEMA 2VSIA 3IGJA 2Z86A 3CKQA 3OH4A 3I0JA 4HURA 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 4E6TA 1THJA 2NPOA 1G93A 1ZI4A 5C1GA 2WVLA 3HSQA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 3FSBA 3IXCA 1R82A 4EAAA 1JVDA 1ZJ1A 1R7UA 1ZI1A 3DK5A 2AE7A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 3R0SA 1FGXA 1H3MA 4EA7A 1KQAA 4MFGA 3SX8A 1GQ9A 2JF2A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 1N4IA 4R7PA 1XZ6A 4KC1A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 4MIXA 3VBNA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3KWCA 2QIAA 3V0PA 4E79A 5FU8A 1LZIA 1JV1A 3VBJA 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 3P47A 1ZCUA 1MP5A 3OKRA 3OUPA 1H5TB 2CU2A 2D7RA 4FRQA 1OCXA 3FWWA 3OH1A 3EH0A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3TISA 3TIOA 3RMWA 3V0QA 4AAWA 2OI6A 4AA7A 1TZFA 3GQ9A 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3SRTA 3K8DA 4EA9A 1GQCA 4MZUA 1H5SA 3O3PA 2QIVX 3Q4SA 2ICXA 4KQLA 1V3WA 1WT1A 5U2KA 3JUKA 1H5SC 2RJ8A 2AH9A 1L0SA 1QQ0A 2JCKA 5AJPA 4UEGA 1ZHJA 1M8NA 3R3RA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 3BSWA 4FIXA 3BFPA 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 4HZCA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 5F42A 1TVYA 2BO8A 4EGGA 4CJ8A 5C3DA 1XHDA 1NWGB 4EEMA 1H7TA 3SUCA 1V83A 2RIJA 1WT0A 3TV0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 2J0BA 1GA8A 1QGSA 2RIXA 5C8RA 3T57A 4XWIA 3OC9A 3I3AA 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 4FCEA 2BO7A 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 5ADXU 2J0AA 3GVDA 2WLCA 3I0EA 3U2TA 2A8WA 3GOSA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 3I3XA 1OMZA 4IHGA 4B4GA 4KPXA 1MP4A 5L6VA 1O0RA 2I5KA 3IOIA 4FRBA 3RMVA 1KK5A 5E3PA 5D91A 5E3QA 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 3VBIA 5FTVA 2AECA 3VBKA 3HJJA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 3VBMA 2AM3A 4AYJA 3R5AA 4O6NA 5FUHA 4DCLA 3SXAA 3SXCA 2QGIA 1YP2A 2RJ4A 1MR9A 2WLGA 4HCQA 1QREA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 1QRGA 4EEOA 4E6UA 1NMMB 1T3DA 2X65A 1GWVA 4KNRA 3ZLKA 2WLEA 2JCOA 2WLDA 2D7IA 4KNXA 3Q7UA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 1XATA 3NZ2A 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 1IINA 3D5NA 4Y6UA 4G3SA 2P2OA 3KWEA 1H4CA 3F1YA 1H5TA 4N6BA 5DDTA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 1KK4A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 2IU8A 1R81A 3ZGFA 3BSYA 2X5ZA 3GQAA 4KXOA 3FS8A 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 3V4EA 4Y7TA 5AFUV 3R1WA 3OTMA 1LVWA 2IU9A 3QVBA 1VGTA 1GWWA 3CGXA 5C1LA 5CQPA 4M28A 2WE9A 1TDTA 3OGZA 3ST8A 1LZ7A 3VBPA 1ZDGA 4ASJA 5C4DA 1QRMA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EA8A 2BO4A 1ON8A 4EE4A 1ZJOA 2ICYA 1MC3A 4M2AA 5C47A 2VHEA 1SSTA 5EJZA 1VZXA 1SSMA 3U2XA 2BO6A 2YCMA 3F1XA 2A8UA 1EWWA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 4M99A 1KGQA 1HM9A 3C8VA 3CU0A 1KRVA 4HO5A 4Y63A 4R36A 3MQHA 1PZTA 2O1GA 2VD4A 3EEVA 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2IC7A 2XMHA 3TWDA 1NHEB 4J09A 2WAWA 4E1KA 3ECTA 3ZGGA 2Y4MA 5E3RA 5C4FA 2YC5A 3V8YA 1GX0A 5I1FA 4G87A 3R5CA 4H7OA 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 3R8YA 1PZYB 4HO9A 1QGQA 3EG4A 4KPZA 1ZCYA 4FIYA 3TK8A 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 4MYOA 4EABA 3VBLA 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3P1BA 4EQYA 3R3IA 1R80A 1KK6A 2W0WA 1O23B 5D92A 1H4EA 3MC4A 2AQ9A 1FR9A 2WLFA 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 2VK9A 1FO8A 5CQNX 4IHHA 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 1V67A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 2FKOA 1FXOA 1ZJPA 2FFVA 3OW5A 1HJJA 4O6MA
chains in the Genus database with same CATH topology
1O7QA 3SPTA 3OU9A 5DEPA 5DG3A 1LXAA 3FSXA 3POLA 2P72A 2V0LA 5C3AA 5C4BA 1H7LA 2RJ9A 3VNPA 2RJ0A 3RSBA 2RJ7A 2VS3A 4LW3A 2OI5A 2GGOA 4AYLA 5FYEA 4HO2A 3CJ8A 1G9RA 2XWMA 3ZLLA 3PKPA 2FY7A 4N69A 4Y9XA 4D48A 3SXBA 2PX7A 1FRWA 1H7EA 3R5BA 2FYCB 2DPWA 1QWJA 3V0OA 1MRLA 3PMOA 2I5EA 2AM5A 2XWNA 2O1FA 3CKJA 4P00A 1VGUA 3U2UA 1G97A 1INJA 1VPAA 3U0YA 4M9CA 3MQGA 1YROB 4LW6A 3DHOA 1FR8A 1QRFA 4ISXA 4M98A 1R7XA 3JQYA 5HS2A 4FQWA 1G0RA 2VFZA 1W57A 1J2ZA 2I7BA 3HL3A 1INIA 4E75A 4YS8A 1H7GA 1OQMB 2Y4JA 1YP4A 3OH3A 1LZJA 2X5SA 3Q1XA 4EVWA 3KWDA 4N6AA 4IHFA 4N27A 4NANA 3BXYA 3R5DA 4R37A 5AFUU 4HUSA 1S80A 2IUAA 3TDTA 3D8VA 1ZIZA 1HM8A 1KRRA 3FTTA 4EE3A 4Q7CA 3TQDA 1KRUA 2OI7A 4HZDA 4Y7UA 4D0TA 2XWLA 5CQOA 2FYAA 3FSYA 3OAMA 5BXCA 3FSCA 5L6SA 4B4MA 1QRLA 2YQHA 1V82A 1W55A 4NALA 2AGDA 3R2WA 2WGZA 3OTZA 5JQQA 1XHBA 1ZCVA 4AC3A 1KGTA 2TDTA 2PA4A 1ZCTA 1LL0A 1SSQA 1FWYA 3CKVA 2JF3A 2XATA 2P6WA 4FRAA 2RJ1A 4CVHA 5CMGX 2YESA 4Y6NA 2QKXA 1G95A 4Y64A 3I0HA 1KHRA 1FO9A 1KWSA 4M4KA 1MP3A 3K8EA 2C0NA 3E25A 3T7OA 1MR7A 3BSSA 3Q80A 3V0LA 1ZJ0A 5ADXV 1TW5A 5C1HA 4J18A 5DEMA 2VSIA 3IGJA 2Z86A 3CKQA 3I0JA 3OH4A 4HURA 4ZDQA 4Y62A 1FGGA 1R7YA 3IOHA 1WSZA 1EYRA 1S4NA 1H5SD 4E6TA 1THJA 2NPOA 1G93A 1ZI4A 5C1GA 2WVLA 3HSQA 1S4PA 1SS9A 3PNNA 2Q4JA 1FOAA 1EZIA 4JD0A 1FZWA 4HG6A 4BMAA 4D11A 1VH1A 4MNDA 4KC2A 4D11C 1ZDFA 3FSBA 3IXCA 1R82A 4EAAA 1JVDA 1ZJ1A 1R7UA 1ZI1A 3DK5A 2AE7A 3E26A 2YC3A 3SX5A 4DE7A 4HOCA 3R0SA 1FGXA 1H3MA 4EA7A 1KQAA 4MFGA 3SX8A 1GQ9A 2JF2A 4MYBA 3I0KA 3I0FA 4CJBA 2JCLA 3SXEA 3V90A 4R7PA 4KC1A 1XZ6A 4FREA 3ZF8A 3V0NA 3U0XA 3F1CA 4FCUA 4MIXA 3VBNA 1E5KA 5IFYA 3KIAA 3PKQA 3SX7A 3SXGA 4CJCA 2VSHA 1JYLA 3KWCA 2QIAA 3V0PA 4E79A 5FU8A 1LZIA 1JV1A 3VBJA 2V0JA 4P02A 5CQLX 2VS5A 2RJ6A 3EE5A 4B5BA 2Z87A 5FU0A 3P47A 1ZCUA 1MP5A 3OKRA 3OUPA 1H5TB 2CU2A 2D7RA 4FRQA 1OCXA 3FWWA 3OH1A 3EH0A 2E3DA 3T7MA 1VH3A 2YQSA 2RIZA 1NF5B 3TISA 3TIOA 3RMWA 3V0QA 4AAWA 2OI6A 4AA7A 1TZFA 3V91A 1O7OA 1H5SB 1VZUA 3USRA 3SRTA 3K8DA 4EA9A 1GQCA 4MZUA 1H5SA 3O3PA 2QIVX 3Q4SA 2ICXA 4KQLA 1V3WA 1WT1A 5U2KA 3JUKA 1H5SC 2RJ8A 2AH9A 1QQ0A 2JCKA 5AJPA 4UEGA 1ZHJA 3R3RA 5C4CA 1JVGA 5IDSA 2XMEA 1ON6A 3BSWA 4FIXA 3BFPA 2MZBA 1VGWA 1YP3A 3U2VA 1G23A 3BCVA 4EEGA 2FYBA 4HZCA 5C49A 3I0CA 4D0ZA 1W77A 3SXDA 5EJ1A 5IDTA 2RITA 2WVKA 2Y4KA 3BRKX 2Y6PA 1HJLA 2Y7AA 5F42A 1TVYA 2BO8A 4EGGA 4CJ8A 5C3DA 1XHDA 1NWGB 4EEMA 1H7TA 1V83A 2RIJA 1WT0A 3TV0A 3JUJA 2RIYA 3USQA 3NGWA 4B3UA 3I0IX 1G3LA 5CMHA 4G3QA 4FRLA 2J0BA 1GA8A 1QGSA 2RIXA 5C8RA 3T57A 4XWIA 3OC9A 3I3AA 1G2VA 3U2WA 2ZU9A 2UX8A 3IOJA 3JTJA 4NAKA 1HM0A 2X60A 4FCEA 2BO7A 4G3PA 2YQCA 4B2XA 4KC4A 4Y7FA 5ADXU 2J0AA 3GVDA 2WLCA 3I0EA 3U2TA 2A8WA 3GOSA 4B4BA 1GX4A 1K4VA 1JYKA 3GUEA 4L41C 1FXJA 2WEEA 2FFUA 5C36A 3I0GA 4HO8A 3OH0A 1H4DA 2OEGA 1H7QA 5AJOA 4Y7VA 2QH5A 4IRPA 4B2WA 1I52A 3I3XA 1OMZA 4IHGA 4B4GA 4KPXA 1MP4A 5L6VA 1O0RA 2I5KA 3IOIA 4FRBA 3RMVA 1KK5A 5E3PA 5D91A 5E3QA 3V8ZA 1R7TA 1VICA 1H7HA 2ZU7A 2APCA 1S4OA 1HV9A 3VBIA 5FTVA 2AECA 3VBKA 3HJJA 1G8OA 1H5RB 1TW1A 2VXMA 1H5RA 1NKHB 2OEFA 4FRMA 3VBMA 2AM3A 4AYJA 3R5AA 4O6NA 5FUHA 4DCLA 3SXAA 3SXCA 2QGIA 1YP2A 2RJ4A 1MR9A 2WLGA 4HCQA 1QREA 3I0LA 4K6RA 4FROA 3V0MA 4BQHA 1QRGA 4EEOA 4E6UA 1NMMB 1T3DA 2X65A 1GWVA 4KNRA 3ZLKA 2WLEA 2JCOA 2WLDA 2D7IA 4KNXA 3Q7UA 3I0DA 4GBPA 5C48A 5CMJA 2AESA 3DUVA 1XATA 3NZ2A 4Y7GA 4HO3A 1H7FA 1V84A 2P73A 3TZTA 1IINA 3D5NA 4Y6UA 4G3SA 2P2OA 3KWEA 1H4CA 3F1YA 1H5TA 4N6BA 5DDTA 2AM4A 2V0KA 4M2BA 5DDVA 2WVMA 4DDZA 1WT2A 5CQMX 1WT3A 2V0IA 4HO6A 1LZ0A 1KK4A 5FTSA 1ZI5A 4EE5A 2Y4LA 3FOQA 1VM8A 2IU8A 1R81A 3ZGFA 3BSYA 2X5ZA 4KXOA 3FS8A 4KT7A 1IIMA 2ZU8A 5AJNA 3SX3A 2JCJA 2O1HA 3V4EA 4Y7TA 5AFUV 3R1WA 3OTMA 1LVWA 2IU9A 3QVBA 1VGTA 1GWWA 3CGXA 5C1LA 5CQPA 4M28A 2WE9A 1TDTA 3ST8A 1LZ7A 3OGZA 3VBPA 1ZDGA 4ASJA 5C4DA 1QRMA 2PGYA 2W0VA 2GGQA 4IRQA 5EIYA 4HO4A 4NAIA 1JV3A 1NQIB 4EA8A 2BO4A 1ON8A 4EE4A 1ZJOA 2ICYA 1MC3A 4M2AA 5C47A 2VHEA 1SSTA 5EJZA 1VZXA 1SSMA 3U2XA 2BO6A 2YCMA 3F1XA 2A8UA 4EEAA 3D98A 3DJ4A 4FRHA 4ASYA 5C3BA 4M99A 1KGQA 1HM9A 3C8VA 3CU0A 1KRVA 4HO5A 4Y63A 4R36A 3MQHA 1PZTA 2O1GA 2VD4A 3EEVA 2VXLA 4HO0A 2NXVA 2D0JA 4ARWA 2E8BA 2V0HA 3CKNA 2IC7A 2XMHA 3TWDA 1NHEB 4J09A 2WAWA 4E1KA 3ECTA 3ZGGA 2Y4MA 5E3RA 5C4FA 2YC5A 3V8YA 1GX0A 5I1FA 4G87A 3R5CA 4H7OA 2YQJA 4C2SA 1Z90A 4ECMA 1QG8A 4JISA 3R8YA 1PZYB 4HO9A 1QGQA 3EG4A 4KPZA 1ZCYA 4FIYA 3TK8A 5J49A 5C4EA 3N9WA 4FRDA 2RJ5A 4B42A 4MYOA 4EABA 3VBLA 1R7VA 2VS4A 1WVCA 1ZJ2A 2PGVA 3P1BA 4EQYA 3R3IA 1R80A 1KK6A 2W0WA 1O23B 5D92A 1H4EA 3MC4A 2AQ9A 1FR9A 2WLFA 5CMIA 1FG5N 3T7NA 3CKOA 5C38A 4FRPA 5CMFX 4DECA 1ZJ3A 2VK9A 1FO8A 5CQNX 4IHHA 3OH2A 1ZI3A 1VGZA 1G1LA 3LW6A 1V67A 4KRVA 5FV9A 1OMXA 1LL3A 1VZTA 2FYDB 1LL2A 2FKOA 1FXOA 1ZJPA 2FFVA 3OW5A 1HJJA 4O6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Q A;  3SPT A;  3OU9 A;  5DEP A;  5DG3 A;  1LXA A;  3FSX A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3VNP A;  2RJ0 A;  3RSB A;  2RJ7 A;  2VS3 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  3CJ8 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4N69 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  3R5B A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  1MRL A;  3PMO A;  2I5E A;  2AM5 A;  2XWN A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1G97 A;  1INJ A;  1VPA A;  3U0Y A;  4M9C A;  3MQG A;  1YRO B;  4LW6 A;  3DHO A;  1FR8 A;  1QRF A;  4ISX A;  4M98 A;  1R7X A;  3JQY A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  1J2Z A;  2I7B A;  3HL3 A;  1INI A;  4E75 A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  3Q1X A;  4EVW A;  3KWD A;  4N6A A;  4IHF A;  4N27 A;  4NAN A;  3BXY A;  3R5D A;  4R37 A;  5AFU U;  4HUS A;  1S80 A;  2IUA A;  3TDT A;  3D8V A;  1ZIZ A;  1HM8 A;  1KRR A;  3FTT A;  4EE3 A;  3TQD A;  1KRU A;  2OI7 A;  4HZD A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  3FSY A;  3OAM A;  5BXC A;  3FSC A;  5L6S A;  4B4M A;  1QRL A;  2YQH A;  1V82 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  3OTZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  1KGT A;  2TDT A;  2PA4 A;  1ZCT A;  1LL0 A;  1SSQ A;  1FWY A;  3CKV A;  2JF3 A;  2XAT A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1KHR A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  3E25 A;  3T7O A;  1MR7 A;  3BSS A;  3Q80 A;  3V0L A;  1ZJ0 A;  5ADX V;  1TW5 A;  5C1H A;  4J18 A;  5DEM A;  2VSI A;  3IGJ A;  2Z86 A;  3CKQ A;  3I0J A;  3OH4 A;  4HUR A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  4E6T A;  1THJ A;  2NPO A;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  3HSQ A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  3FSB A;  3IXC A;  1R82 A;  4EAA A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  3DK5 A;  2AE7 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  3R0S A;  1FGX A;  1H3M A;  4EA7 A;  1KQA A;  4MFG A;  3SX8 A;  1GQ9 A;  2JF2 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  4R7P A;  4KC1 A;  1XZ6 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  3VBN A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3KWC A;  2QIA A;  3V0P A;  4E79 A;  5FU8 A;  1LZI A;  1JV1 A;  3VBJ A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  3P47 A;  1ZCU A;  1MP5 A;  3OKR A;  3OUP A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  1OCX A;  3FWW A;  3OH1 A;  3EH0 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3TIS A;  3TIO A;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  4AA7 A;  1TZF A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3SRT A;  3K8D A;  4EA9 A;  1GQC A;  4MZU A;  1H5S A;  3O3P A;  2QIV X;  3Q4S A;  2ICX A;  4KQL A;  1V3W A;  1WT1 A;  5U2K A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  1QQ0 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  3R3R A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  3BSW A;  3BFP A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  4HZC A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  5F42 A;  1TVY A;  2BO8 A;  4EGG A;  4CJ8 A;  5C3D A;  1XHD A;  1NWG B;  4EEM A;  1H7T A;  1V83 A;  2RIJ A;  1WT0 A;  3TV0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  3T57 A;  4XWI A;  3OC9 A;  3I3A A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  4FCE A;  2BO7 A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  5ADX U;  3GVD A;  2WLC A;  3I0E A;  3U2T A;  2A8W A;  3GOS A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  3I3X A;  1OMZ A;  4IHG A;  4B4G A;  4KPX A;  1MP4 A;  5L6V A;  1O0R A;  2I5K A;  3IOI A;  4FRB A;  3RMV A;  1KK5 A;  5E3P A;  5E3Q A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  3VBI A;  5FTV A;  2AEC A;  3VBK A;  3HJJ A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  3VBM A;  2AM3 A;  4AYJ A;  3R5A A;  5FUH A;  4DCL A;  3SXA A;  2QGI A;  1YP2 A;  2RJ4 A;  1MR9 A;  2WLG A;  4HCQ A;  1QRE A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  1QRG A;  4EEO A;  4E6U A;  1NMM B;  1T3D A;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2WLE A;  2JCO A;  2WLD A;  2D7I A;  4KNX A;  3Q7U A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  1XAT A;  3NZ2 A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  1IIN A;  3D5N A;  4Y6U A;  4G3S A;  2P2O A;  3KWE A;  1H4C A;  3F1Y A;  1H5T A;  4N6B A;  5DDT A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  1KK4 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  2IU8 A;  1R81 A;  3ZGF A;  3BSY A;  2X5Z A;  4KXO A;  3FS8 A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  3V4E A;  4Y7T A;  5AFU V;  3R1W A;  3OTM A;  1LVW A;  2IU9 A;  3QVB A;  1VGT A;  1GWW A;  3CGX A;  5C1L A;  5CQP A;  4M28 A;  2WE9 A;  1TDT A;  3ST8 A;  1LZ7 A;  3OGZ A;  3VBP A;  1ZDG A;  4ASJ A;  5C4D A;  1QRM A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EA8 A;  2BO4 A;  1ON8 A;  4EE4 A;  1ZJO A;  2ICY A;  1MC3 A;  4M2A A;  5C47 A;  2VHE A;  1SST A;  5EJZ A;  1VZX A;  1SSM A;  3U2X A;  2BO6 A;  2YCM A;  3F1X A;  2A8U A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  4M99 A;  1KGQ A;  1HM9 A;  3C8V A;  3CU0 A;  1KRV A;  4HO5 A;  4Y63 A;  4R36 A;  3MQH A;  1PZT A;  2O1G A;  2VD4 A;  3EEV A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2IC7 A;  2XMH A;  3TWD A;  1NHE B;  4J09 A;  2WAW A;  4E1K A;  3ECT A;  3ZGG A;  2Y4M A;  5E3R A;  5C4F A;  2YC5 A;  3V8Y A;  1GX0 A;  5I1F A;  4G87 A;  3R5C A;  4H7O A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  3R8Y A;  1PZY B;  4HO9 A;  1QGQ A;  3EG4 A;  4KPZ A;  1ZCY A;  3TK8 A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  4MYO A;  4EAB A;  3VBL A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3P1B A;  4EQY A;  3R3I A;  1R80 A;  1KK6 A;  2W0W A;  1O23 B;  1H4E A;  3MC4 A;  2AQ9 A;  1FR9 A;  2WLF A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  1FO8 A;  5CQN X;  4IHH A;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  1V67 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  2FKO A;  1FXO A;  1ZJP A;  2FFV A;  3OW5 A;  1HJJ A;  3SXC A; 
#chains in the Genus database with same CATH topology
 1O7Q A;  3SPT A;  3OU9 A;  5DEP A;  5DG3 A;  1LXA A;  3FSX A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3VNP A;  2RJ0 A;  3RSB A;  2RJ7 A;  2VS3 A;  3GQ7 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  3CJ8 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4N69 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  3R5B A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  1MRL A;  3PMO A;  2I5E A;  2AM5 A;  2XWN A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1G97 A;  1INJ A;  1VPA A;  3U0Y A;  4M9C A;  1Z2F A;  3MQG A;  1YRO B;  4LW6 A;  3DHO A;  1FR8 A;  1QRF A;  4ISX A;  4M98 A;  1R7X A;  3JQY A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  1J2Z A;  2I7B A;  3HL3 A;  1INI A;  4E75 A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  3Q1X A;  4EVW A;  3KWD A;  4N6A A;  4IHF A;  4N27 A;  4NAN A;  3BXY A;  3R5D A;  4R37 A;  5AFU U;  4HUS A;  1S80 A;  2IUA A;  3TDT A;  3D8V A;  1ZIZ A;  1HM8 A;  1KRR A;  3FTT A;  4EE3 A;  4Q7C A;  3TQD A;  1KRU A;  2OI7 A;  4HZD A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  3FSY A;  3OAM A;  5BXC A;  3FSC A;  5L6S A;  4B4M A;  1QRL A;  2YQH A;  1V82 A;  3GQ8 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  3OTZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  1KGT A;  2TDT A;  2PA4 A;  1ZCT A;  1LL0 A;  1SSQ A;  1FWY A;  3CKV A;  2JF3 A;  2XAT A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1KHR A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  2C0N A;  3E25 A;  3T7O A;  1MR7 A;  3BSS A;  3Q80 A;  3V0L A;  1ZJ0 A;  5ADX V;  1TW5 A;  5C1H A;  4J18 A;  5DEM A;  2VSI A;  3IGJ A;  2Z86 A;  3CKQ A;  3OH4 A;  3I0J A;  4HUR A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  4E6T A;  1THJ A;  2NPO A;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  3HSQ A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  3FSB A;  3IXC A;  1R82 A;  4EAA A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  3DK5 A;  2AE7 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  3R0S A;  1FGX A;  1H3M A;  4EA7 A;  1KQA A;  4MFG A;  3SX8 A;  1GQ9 A;  2JF2 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  1N4I A;  4R7P A;  1XZ6 A;  4KC1 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  4MIX A;  3VBN A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3KWC A;  2QIA A;  3V0P A;  4E79 A;  5FU8 A;  1LZI A;  1JV1 A;  3VBJ A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  3P47 A;  1ZCU A;  1MP5 A;  3OKR A;  3OUP A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  1OCX A;  3FWW A;  3OH1 A;  3EH0 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3TIS A;  3TIO A;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  4AA7 A;  1TZF A;  3GQ9 A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3SRT A;  3K8D A;  4EA9 A;  1GQC A;  4MZU A;  1H5S A;  3O3P A;  2QIV X;  3Q4S A;  2ICX A;  4KQL A;  1V3W A;  1WT1 A;  5U2K A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  1L0S A;  1QQ0 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  1M8N A;  3R3R A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  3BSW A;  4FIX A;  3BFP A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  4HZC A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  5F42 A;  1TVY A;  2BO8 A;  4EGG A;  4CJ8 A;  5C3D A;  1XHD A;  1NWG B;  4EEM A;  1H7T A;  3SUC A;  1V83 A;  2RIJ A;  1WT0 A;  3TV0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  2J0B A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  3T57 A;  4XWI A;  3OC9 A;  3I3A A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  4FCE A;  2BO7 A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  5ADX U;  2J0A A;  3GVD A;  2WLC A;  3I0E A;  3U2T A;  2A8W A;  3GOS A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  3I3X A;  1OMZ A;  4IHG A;  4B4G A;  4KPX A;  1MP4 A;  5L6V A;  1O0R A;  2I5K A;  3IOI A;  4FRB A;  3RMV A;  1KK5 A;  5E3P A;  5D91 A;  5E3Q A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  3VBI A;  5FTV A;  2AEC A;  3VBK A;  3HJJ A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  3VBM A;  2AM3 A;  4AYJ A;  3R5A A;  4O6N A;  5FUH A;  4DCL A;  3SXA A;  3SXC A;  2QGI A;  1YP2 A;  2RJ4 A;  1MR9 A;  2WLG A;  4HCQ A;  1QRE A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  1QRG A;  4EEO A;  4E6U A;  1NMM B;  1T3D A;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2WLE A;  2JCO A;  2WLD A;  2D7I A;  4KNX A;  3Q7U A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  1XAT A;  3NZ2 A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  1IIN A;  3D5N A;  4Y6U A;  4G3S A;  2P2O A;  3KWE A;  1H4C A;  3F1Y A;  1H5T A;  4N6B A;  5DDT A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  1KK4 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  2IU8 A;  1R81 A;  3ZGF A;  3BSY A;  2X5Z A;  3GQA A;  4KXO A;  3FS8 A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  3V4E A;  4Y7T A;  5AFU V;  3R1W A;  3OTM A;  1LVW A;  2IU9 A;  3QVB A;  1VGT A;  1GWW A;  3CGX A;  5C1L A;  5CQP A;  4M28 A;  2WE9 A;  1TDT A;  3OGZ A;  3ST8 A;  1LZ7 A;  3VBP A;  1ZDG A;  4ASJ A;  5C4D A;  1QRM A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EA8 A;  2BO4 A;  1ON8 A;  4EE4 A;  1ZJO A;  2ICY A;  1MC3 A;  4M2A A;  5C47 A;  2VHE A;  1SST A;  5EJZ A;  1VZX A;  1SSM A;  3U2X A;  2BO6 A;  2YCM A;  3F1X A;  2A8U A;  1EWW A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  4M99 A;  1KGQ A;  1HM9 A;  3C8V A;  3CU0 A;  1KRV A;  4HO5 A;  4Y63 A;  4R36 A;  3MQH A;  1PZT A;  2O1G A;  2VD4 A;  3EEV A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2IC7 A;  2XMH A;  3TWD A;  1NHE B;  4J09 A;  2WAW A;  4E1K A;  3ECT A;  3ZGG A;  2Y4M A;  5E3R A;  5C4F A;  2YC5 A;  3V8Y A;  1GX0 A;  5I1F A;  4G87 A;  3R5C A;  4H7O A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  3R8Y A;  1PZY B;  4HO9 A;  1QGQ A;  3EG4 A;  4KPZ A;  1ZCY A;  4FIY A;  3TK8 A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  4MYO A;  4EAB A;  3VBL A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3P1B A;  4EQY A;  3R3I A;  1R80 A;  1KK6 A;  2W0W A;  1O23 B;  5D92 A;  1H4E A;  3MC4 A;  2AQ9 A;  1FR9 A;  2WLF A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  2VK9 A;  1FO8 A;  5CQN X;  4IHH A;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  1V67 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  2FKO A;  1FXO A;  1ZJP A;  2FFV A;  3OW5 A;  1HJJ A;  4O6M A; 
#chains in the Genus database with same CATH homology
 1O7Q A;  3SPT A;  3OU9 A;  5DEP A;  5DG3 A;  1LXA A;  3FSX A;  3POL A;  2P72 A;  2V0L A;  5C3A A;  5C4B A;  1H7L A;  2RJ9 A;  3VNP A;  2RJ0 A;  3RSB A;  2RJ7 A;  2VS3 A;  4LW3 A;  2OI5 A;  2GGO A;  4AYL A;  5FYE A;  4HO2 A;  3CJ8 A;  1G9R A;  2XWM A;  3ZLL A;  3PKP A;  2FY7 A;  4N69 A;  4Y9X A;  4D48 A;  3SXB A;  2PX7 A;  1FRW A;  1H7E A;  3R5B A;  2FYC B;  2DPW A;  1QWJ A;  3V0O A;  1MRL A;  3PMO A;  2I5E A;  2AM5 A;  2XWN A;  2O1F A;  3CKJ A;  4P00 A;  1VGU A;  3U2U A;  1G97 A;  1INJ A;  1VPA A;  3U0Y A;  4M9C A;  3MQG A;  1YRO B;  4LW6 A;  3DHO A;  1FR8 A;  1QRF A;  4ISX A;  4M98 A;  1R7X A;  3JQY A;  5HS2 A;  4FQW A;  1G0R A;  2VFZ A;  1W57 A;  1J2Z A;  2I7B A;  3HL3 A;  1INI A;  4E75 A;  4YS8 A;  1H7G A;  1OQM B;  2Y4J A;  1YP4 A;  3OH3 A;  1LZJ A;  2X5S A;  3Q1X A;  4EVW A;  3KWD A;  4N6A A;  4IHF A;  4N27 A;  4NAN A;  3BXY A;  3R5D A;  4R37 A;  5AFU U;  4HUS A;  1S80 A;  2IUA A;  3TDT A;  3D8V A;  1ZIZ A;  1HM8 A;  1KRR A;  3FTT A;  4EE3 A;  4Q7C A;  3TQD A;  1KRU A;  2OI7 A;  4HZD A;  4Y7U A;  4D0T A;  2XWL A;  5CQO A;  2FYA A;  3FSY A;  3OAM A;  5BXC A;  3FSC A;  5L6S A;  4B4M A;  1QRL A;  2YQH A;  1V82 A;  1W55 A;  4NAL A;  2AGD A;  3R2W A;  2WGZ A;  3OTZ A;  5JQQ A;  1XHB A;  1ZCV A;  4AC3 A;  1KGT A;  2TDT A;  2PA4 A;  1ZCT A;  1LL0 A;  1SSQ A;  1FWY A;  3CKV A;  2JF3 A;  2XAT A;  2P6W A;  4FRA A;  2RJ1 A;  4CVH A;  5CMG X;  2YES A;  4Y6N A;  2QKX A;  1G95 A;  4Y64 A;  3I0H A;  1KHR A;  1FO9 A;  1KWS A;  4M4K A;  1MP3 A;  3K8E A;  2C0N A;  3E25 A;  3T7O A;  1MR7 A;  3BSS A;  3Q80 A;  3V0L A;  1ZJ0 A;  5ADX V;  1TW5 A;  5C1H A;  4J18 A;  5DEM A;  2VSI A;  3IGJ A;  2Z86 A;  3CKQ A;  3I0J A;  3OH4 A;  4HUR A;  4ZDQ A;  4Y62 A;  1FGG A;  1R7Y A;  3IOH A;  1WSZ A;  1EYR A;  1S4N A;  1H5S D;  4E6T A;  1THJ A;  2NPO A;  1G93 A;  1ZI4 A;  5C1G A;  2WVL A;  3HSQ A;  1S4P A;  1SS9 A;  3PNN A;  2Q4J A;  1FOA A;  1EZI A;  4JD0 A;  1FZW A;  4HG6 A;  4BMA A;  4D11 A;  1VH1 A;  4MND A;  4KC2 A;  4D11 C;  1ZDF A;  3FSB A;  3IXC A;  1R82 A;  4EAA A;  1JVD A;  1ZJ1 A;  1R7U A;  1ZI1 A;  3DK5 A;  2AE7 A;  3E26 A;  2YC3 A;  3SX5 A;  4DE7 A;  4HOC A;  3R0S A;  1FGX A;  1H3M A;  4EA7 A;  1KQA A;  4MFG A;  3SX8 A;  1GQ9 A;  2JF2 A;  4MYB A;  3I0K A;  3I0F A;  4CJB A;  2JCL A;  3SXE A;  3V90 A;  4R7P A;  4KC1 A;  1XZ6 A;  4FRE A;  3ZF8 A;  3V0N A;  3U0X A;  3F1C A;  4FCU A;  4MIX A;  3VBN A;  1E5K A;  5IFY A;  3KIA A;  3PKQ A;  3SX7 A;  3SXG A;  4CJC A;  2VSH A;  1JYL A;  3KWC A;  2QIA A;  3V0P A;  4E79 A;  5FU8 A;  1LZI A;  1JV1 A;  3VBJ A;  2V0J A;  4P02 A;  5CQL X;  2VS5 A;  2RJ6 A;  3EE5 A;  4B5B A;  2Z87 A;  5FU0 A;  3P47 A;  1ZCU A;  1MP5 A;  3OKR A;  3OUP A;  1H5T B;  2CU2 A;  2D7R A;  4FRQ A;  1OCX A;  3FWW A;  3OH1 A;  3EH0 A;  2E3D A;  3T7M A;  1VH3 A;  2YQS A;  2RIZ A;  1NF5 B;  3TIS A;  3TIO A;  3RMW A;  3V0Q A;  4AAW A;  2OI6 A;  4AA7 A;  1TZF A;  3V91 A;  1O7O A;  1H5S B;  1VZU A;  3USR A;  3SRT A;  3K8D A;  4EA9 A;  1GQC A;  4MZU A;  1H5S A;  3O3P A;  2QIV X;  3Q4S A;  2ICX A;  4KQL A;  1V3W A;  1WT1 A;  5U2K A;  3JUK A;  1H5S C;  2RJ8 A;  2AH9 A;  1QQ0 A;  2JCK A;  5AJP A;  4UEG A;  1ZHJ A;  3R3R A;  5C4C A;  1JVG A;  5IDS A;  2XME A;  1ON6 A;  3BSW A;  4FIX A;  3BFP A;  2MZB A;  1VGW A;  1YP3 A;  3U2V A;  1G23 A;  3BCV A;  4EEG A;  2FYB A;  4HZC A;  5C49 A;  3I0C A;  4D0Z A;  1W77 A;  3SXD A;  5EJ1 A;  5IDT A;  2RIT A;  2WVK A;  2Y4K A;  3BRK X;  2Y6P A;  1HJL A;  2Y7A A;  5F42 A;  1TVY A;  2BO8 A;  4EGG A;  4CJ8 A;  5C3D A;  1XHD A;  1NWG B;  4EEM A;  1H7T A;  1V83 A;  2RIJ A;  1WT0 A;  3TV0 A;  3JUJ A;  2RIY A;  3USQ A;  3NGW A;  4B3U A;  3I0I X;  1G3L A;  5CMH A;  4G3Q A;  4FRL A;  2J0B A;  1GA8 A;  1QGS A;  2RIX A;  5C8R A;  3T57 A;  4XWI A;  3OC9 A;  3I3A A;  1G2V A;  3U2W A;  2ZU9 A;  2UX8 A;  3IOJ A;  3JTJ A;  4NAK A;  1HM0 A;  2X60 A;  4FCE A;  2BO7 A;  4G3P A;  2YQC A;  4B2X A;  4KC4 A;  4Y7F A;  5ADX U;  2J0A A;  3GVD A;  2WLC A;  3I0E A;  3U2T A;  2A8W A;  3GOS A;  4B4B A;  1GX4 A;  1K4V A;  1JYK A;  3GUE A;  4L41 C;  1FXJ A;  2WEE A;  2FFU A;  5C36 A;  3I0G A;  4HO8 A;  3OH0 A;  1H4D A;  2OEG A;  1H7Q A;  5AJO A;  4Y7V A;  2QH5 A;  4IRP A;  4B2W A;  1I52 A;  3I3X A;  1OMZ A;  4IHG A;  4B4G A;  4KPX A;  1MP4 A;  5L6V A;  1O0R A;  2I5K A;  3IOI A;  4FRB A;  3RMV A;  1KK5 A;  5E3P A;  5D91 A;  5E3Q A;  3V8Z A;  1R7T A;  1VIC A;  1H7H A;  2ZU7 A;  2APC A;  1S4O A;  1HV9 A;  3VBI A;  5FTV A;  2AEC A;  3VBK A;  3HJJ A;  1G8O A;  1H5R B;  1TW1 A;  2VXM A;  1H5R A;  1NKH B;  2OEF A;  4FRM A;  3VBM A;  2AM3 A;  4AYJ A;  3R5A A;  4O6N A;  5FUH A;  4DCL A;  3SXA A;  3SXC A;  2QGI A;  1YP2 A;  2RJ4 A;  1MR9 A;  2WLG A;  4HCQ A;  1QRE A;  3I0L A;  4K6R A;  4FRO A;  3V0M A;  4BQH A;  1QRG A;  4EEO A;  4E6U A;  1NMM B;  1T3D A;  2X65 A;  1GWV A;  4KNR A;  3ZLK A;  2WLE A;  2JCO A;  2WLD A;  2D7I A;  4KNX A;  3Q7U A;  3I0D A;  4GBP A;  5C48 A;  5CMJ A;  2AES A;  3DUV A;  1XAT A;  3NZ2 A;  4Y7G A;  4HO3 A;  1H7F A;  1V84 A;  2P73 A;  3TZT A;  1IIN A;  3D5N A;  4Y6U A;  4G3S A;  2P2O A;  3KWE A;  1H4C A;  3F1Y A;  1H5T A;  4N6B A;  5DDT A;  2AM4 A;  2V0K A;  4M2B A;  5DDV A;  2WVM A;  4DDZ A;  1WT2 A;  5CQM X;  1WT3 A;  2V0I A;  4HO6 A;  1LZ0 A;  1KK4 A;  5FTS A;  1ZI5 A;  4EE5 A;  2Y4L A;  3FOQ A;  1VM8 A;  2IU8 A;  1R81 A;  3ZGF A;  3BSY A;  2X5Z A;  4KXO A;  3FS8 A;  4KT7 A;  1IIM A;  2ZU8 A;  5AJN A;  3SX3 A;  2JCJ A;  2O1H A;  3V4E A;  4Y7T A;  5AFU V;  3R1W A;  3OTM A;  1LVW A;  2IU9 A;  3QVB A;  1VGT A;  1GWW A;  3CGX A;  5C1L A;  5CQP A;  4M28 A;  2WE9 A;  1TDT A;  3ST8 A;  1LZ7 A;  3OGZ A;  3VBP A;  1ZDG A;  4ASJ A;  5C4D A;  1QRM A;  2PGY A;  2W0V A;  2GGQ A;  4IRQ A;  5EIY A;  4HO4 A;  4NAI A;  1JV3 A;  1NQI B;  4EA8 A;  2BO4 A;  1ON8 A;  4EE4 A;  1ZJO A;  2ICY A;  1MC3 A;  4M2A A;  5C47 A;  2VHE A;  1SST A;  5EJZ A;  1VZX A;  1SSM A;  3U2X A;  2BO6 A;  2YCM A;  3F1X A;  2A8U A;  4EEA A;  3D98 A;  3DJ4 A;  4FRH A;  4ASY A;  5C3B A;  4M99 A;  1KGQ A;  1HM9 A;  3C8V A;  3CU0 A;  1KRV A;  4HO5 A;  4Y63 A;  4R36 A;  3MQH A;  1PZT A;  2O1G A;  2VD4 A;  3EEV A;  2VXL A;  4HO0 A;  2NXV A;  2D0J A;  4ARW A;  2E8B A;  2V0H A;  3CKN A;  2IC7 A;  2XMH A;  3TWD A;  1NHE B;  4J09 A;  2WAW A;  4E1K A;  3ECT A;  3ZGG A;  2Y4M A;  5E3R A;  5C4F A;  2YC5 A;  3V8Y A;  1GX0 A;  5I1F A;  4G87 A;  3R5C A;  4H7O A;  2YQJ A;  4C2S A;  1Z90 A;  4ECM A;  1QG8 A;  4JIS A;  3R8Y A;  1PZY B;  4HO9 A;  1QGQ A;  3EG4 A;  4KPZ A;  1ZCY A;  4FIY A;  3TK8 A;  5J49 A;  5C4E A;  3N9W A;  4FRD A;  2RJ5 A;  4B42 A;  4MYO A;  4EAB A;  3VBL A;  1R7V A;  2VS4 A;  1WVC A;  1ZJ2 A;  2PGV A;  3P1B A;  4EQY A;  3R3I A;  1R80 A;  1KK6 A;  2W0W A;  1O23 B;  5D92 A;  1H4E A;  3MC4 A;  2AQ9 A;  1FR9 A;  2WLF A;  5CMI A;  1FG5 N;  3T7N A;  3CKO A;  5C38 A;  4FRP A;  5CMF X;  4DEC A;  1ZJ3 A;  2VK9 A;  1FO8 A;  5CQN X;  4IHH A;  3OH2 A;  1ZI3 A;  1VGZ A;  1G1L A;  3LW6 A;  1V67 A;  4KRV A;  5FV9 A;  1OMX A;  1LL3 A;  1VZT A;  2FYD B;  1LL2 A;  2FKO A;  1FXO A;  1ZJP A;  2FFV A;  3OW5 A;  1HJJ A;  4O6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...