1EWWA

Solution structure of spruce budworm antifreeze protein at 30 degrees celsius
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
90
structure length
90
Chain Sequence
DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords ANTIFREEZE PROTEIN
publication title Beta-helix structure and ice-binding properties of a hyperactive antifreeze protein from an insect.
pubmed doi rcsb
source organism Choristoneura fumiferana
total genus 8
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1ewwA00
3GQ9A 3GQ8A 3GQAA 3SUCA 1M8NA 1EWWA 3GQ7A 1L0SA 1N4IA 1Z2FA
chains in the Genus database with same CATH superfamily
1G95A 2OEFA 1QRMA 3OH3A 4KPZA 3VBJA 2QKXA 1SSTA 3VBNA 3PMOA 3GQ9A 3OH1A 3ST8A 1THJA 3HJJA 4IHHA 3FS8A 1QRGA 4EGGA 3OH0A 2JF2A 4N27A 2JF3A 3EG4A 2ICXA 1V3WA 5E3RA 5E3PA 3VNPA 4M9CA 2I5KA 4J09A 1MR7A 2IUAA 4FCEA 4M2BA 1KRUA 3Q1XA 1HM8A 4N6BA 4M98A 4R36A 3F1XA 4HUSA 2FKOA 3TISA 3VBLA 3FSXA 1KHRA 1KGQA 3VBKA 1M8NA 3HSQA 2GGQA 3BSYA 5ADXU 2V0JA 5E3QA 1KK4A 2OI7A 4J18A 3KWEA 3BSWA 1QRLA 3T57A 1XATA 3TK8A 1QREA 4G87A 3TIOA 2WLEA 3DHOA 1FWYA 2P2OA 4MZUA 3P47A 1QRFA 5DEPA 2WLDA 4E1KA 3CJ8A 1OCXA 1KK6A 3GQ8A 1KRRA 3GVDA 3I3XA 4EABA 3TDTA 3OTZA 1S80A 4MFGA 3R2WA 4N69A 4K6RA 4MYOA 2VD4A 4G3SA 3BFPA 2WLFA 3TV0A 3DJ4A 2GGOA 1G97A 4E6UA 2QIAA 2W0VA 3R5CA 4M2AA 1SSMA 3R5AA 2V0HA 2IC7A 1YP4A 3D98A 2NPOA 5L6SA 4HZDA 3SUCA 3IXCA 4AAWA 4EA9A 1YP2A 3KWCA 1KRVA 1LXAA 3ECTA 1EWWA 4R7PA 1N4IA 4HZCA 1Z90A 4E6TA 3KWDA 3MC4A 4G3QA 1QQ0A 4KNXA 3DK5A 4E79A 3SRTA 4M28A 1KQAA 2QIVX 1J2ZA 2OEGA 3FWWA 4KPXA 2ICYA 3OU9A 1HM9A 3EH0A 4IHFA 3EEVA 5DEMA 4H7OA 5F42A 3FSYA 5AFUV 1KK5A 2WLGA 2V0LA 3GUEA 2V0KA 4M99A 4HCQA 3FSBA 2OI6A 3OUPA 4AA7A 3V4EA 3VBPA 3NZ2A 3P1BA 3R1WA 5DG3A 4KNRA 5AFUU 4AC3A 3OH2A 4DCLA 3BSSA 4IHGA 1KGTA 3R8YA 2Q4JA 1TDTA 1L0SA 3R5BA 2W0WA 3R0SA 3TWDA 1FXJA 4KQLA 3D8VA 1YP3A 1MR9A 1SSQA 4HURA 1T3DA 3SPTA 3FOQA 1XHDA 3OGZA 3OH4A 3OTMA 5U2KA 4R37A 4EAAA 2RIJA 3FSCA 3R3RA 4N6AA 1Z2FA 3JQYA 2WLCA 1HM0A 2VHEA 3IGJA 4EQYA 2IU9A 2XATA 1MRLA 2TDTA 5ADXV 3MQGA 3GOSA 3FTTA 3GQ7A 1V67A 2IU8A 3BRKX 3C8VA 3VBMA 2OI5A 4ISXA 4EA8A 2AQ9A 3OW5A 3VBIA 4G3PA 4E75A 2V0IA 3GQAA 3R5DA 3I3AA 3R3IA 4EA7A 1HV9A 5L6VA 3BXYA 3MQHA
chains in the Genus database with same CATH topology
1L1IA 3GQ9A 3GQ8A 1EZGA 3GQAA 3SUCA 1M8NA 1EWWA 3GQ7A 1L0SA 1N4IA 1Z2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  3GQ8 A;  3GQA A;  3SUC A;  1M8N A;  1EWW A;  3GQ7 A;  1L0S A;  1N4I A;  1Z2F A; 
#chains in the Genus database with same CATH topology
 1G95 A;  2OEF A;  1QRM A;  3OH3 A;  4KPZ A;  3VBJ A;  2QKX A;  1SST A;  3VBN A;  3PMO A;  3GQ9 A;  3OH1 A;  3ST8 A;  1THJ A;  3HJJ A;  4IHH A;  3FS8 A;  1QRG A;  4EGG A;  3OH0 A;  2JF2 A;  4N27 A;  2JF3 A;  3EG4 A;  2ICX A;  1V3W A;  5E3R A;  5E3P A;  3VNP A;  4M9C A;  2I5K A;  4J09 A;  1MR7 A;  2IUA A;  4FCE A;  4M2B A;  1KRU A;  3Q1X A;  1HM8 A;  4N6B A;  4M98 A;  4R36 A;  3F1X A;  4HUS A;  2FKO A;  3TIS A;  3VBL A;  3FSX A;  1KHR A;  1KGQ A;  3VBK A;  1M8N A;  3HSQ A;  2GGQ A;  3BSY A;  5ADX U;  2V0J A;  5E3Q A;  1KK4 A;  2OI7 A;  4J18 A;  3KWE A;  3BSW A;  1QRL A;  3T57 A;  1XAT A;  3TK8 A;  1QRE A;  4G87 A;  3TIO A;  2WLE A;  3DHO A;  1FWY A;  2P2O A;  4MZU A;  3P47 A;  1QRF A;  5DEP A;  2WLD A;  4E1K A;  3CJ8 A;  1OCX A;  1KK6 A;  3GQ8 A;  1KRR A;  3GVD A;  3I3X A;  4EAB A;  3TDT A;  3OTZ A;  1S80 A;  4MFG A;  3R2W A;  4N69 A;  4K6R A;  4MYO A;  2VD4 A;  4G3S A;  3BFP A;  2WLF A;  3TV0 A;  3DJ4 A;  2GGO A;  1G97 A;  4E6U A;  2QIA A;  2W0V A;  3R5C A;  4M2A A;  1SSM A;  3R5A A;  2V0H A;  2IC7 A;  1YP4 A;  3D98 A;  2NPO A;  5L6S A;  4HZD A;  3SUC A;  3IXC A;  4AAW A;  4EA9 A;  1YP2 A;  3KWC A;  1KRV A;  1LXA A;  3ECT A;  1EWW A;  4R7P A;  1N4I A;  4HZC A;  1Z90 A;  4E6T A;  3KWD A;  3MC4 A;  4G3Q A;  1QQ0 A;  4KNX A;  3DK5 A;  4E79 A;  3SRT A;  4M28 A;  1KQA A;  2QIV X;  1J2Z A;  2OEG A;  3FWW A;  4KPX A;  2ICY A;  3OU9 A;  1HM9 A;  3EH0 A;  4IHF A;  3EEV A;  5DEM A;  4H7O A;  5F42 A;  3FSY A;  5AFU V;  1KK5 A;  2WLG A;  2V0L A;  3GUE A;  2V0K A;  4M99 A;  4HCQ A;  3FSB A;  2OI6 A;  3OUP A;  4AA7 A;  3V4E A;  3VBP A;  3NZ2 A;  3P1B A;  3R1W A;  5DG3 A;  4KNR A;  5AFU U;  4AC3 A;  3OH2 A;  4DCL A;  3BSS A;  4IHG A;  1KGT A;  3R8Y A;  2Q4J A;  1TDT A;  1L0S A;  3R5B A;  2W0W A;  3R0S A;  3TWD A;  1FXJ A;  4KQL A;  3D8V A;  1YP3 A;  1MR9 A;  1SSQ A;  4HUR A;  1T3D A;  3SPT A;  3FOQ A;  1XHD A;  3OGZ A;  3OH4 A;  3OTM A;  5U2K A;  4R37 A;  4EAA A;  2RIJ A;  3FSC A;  3R3R A;  4N6A A;  1Z2F A;  3JQY A;  2WLC A;  1HM0 A;  2VHE A;  3IGJ A;  4EQY A;  2IU9 A;  2XAT A;  1MRL A;  2TDT A;  5ADX V;  3MQG A;  3GOS A;  3FTT A;  3GQ7 A;  1V67 A;  2IU8 A;  3BRK X;  3C8V A;  3VBM A;  2OI5 A;  4ISX A;  4EA8 A;  2AQ9 A;  3OW5 A;  3VBI A;  4G3P A;  4E75 A;  2V0I A;  3GQA A;  3R5D A;  3I3A A;  3R3I A;  4EA7 A;  1HV9 A;  5L6V A;  3BXY A;  3MQH A; 
#chains in the Genus database with same CATH homology
 1L1I A;  3GQ9 A;  3GQ8 A;  1EZG A;  3GQA A;  3SUC A;  1M8N A;  1EWW A;  3GQ7 A;  1L0S A;  1N4I A;  1Z2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...