3OUPA

Crystal structure of the gamma-carbonic anhydrase w19n mutant from methanosarcina thermophila
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPNNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the gamma-carbonic anhydrase W19N mutant from Methanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
molecule keywords Carbonic anhydrase
total genus 70
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3oupA00
3C8VA 4MYOA 3CJ8A 4MZUA 3OUPA 1THJA 2ICYA 1TDTA 4G3SA 4IHHA 5L6SA 5E3PA 3R1WA 1QQ0A 2OI6A 3OU9A 4KNRA 5F42A 3FOQA 3BSSA 2OEFA 4E6UA 1MR7A 1S80A 3TIOA 3OW5A 3R3IA 4G87A 4K6RA 4IHGA 4IHFA 4M99A 1KK6A 3MC4A 3KWEA 3BRKX 3NZ2A 1KRUA 1J2ZA 1Z90A 2OI5A 4M2BA 2VD4A 4EQYA 2GGOA 4M98A 2FKOA 4MFGA 4KNXA 2JF2A 3BFPA 5DEMA 3TV0A 4N6AA 3I3XA 4N69A 1QRFA 1YP2A 2VHEA 4N6BA 2QIAA 2WLGA 3HSQA 2WLCA 3DJ4A 4M28A 1YP3A 4E1KA 5E3QA 4EABA 2RIJA 1T3DA 1KK5A 1HM9A 3OTZA 2WLEA 3IXCA 3R8YA 2V0HA 1HV9A 1YP4A 2V0IA 1SSMA 3MQGA 5AFUV 2QIVX 2V0LA 1SSQA 4FCEA 4HUSA 3R5DA 2NPOA 1QREA 4KPZA 3V4EA 1HM0A 4M9CA 4J18A 2IC7A 1V67A 4HURA 1KRRA 3P47A 3VBIA 3VBMA 3TISA 5DG3A 3GVDA 3GUEA 3KWDA 4R7PA 5E3RA 3VBPA 3R5BA 1KK4A 4EAAA 4DCLA 3TK8A 1OCXA 3VBLA 3P1BA 4E79A 1MRLA 3FSYA 3ST8A 3FWWA 3OTMA 3R5CA 1FXJA 4AAWA 4HCQA 3MQHA 3DK5A 3SPTA 4EGGA 1KRVA 2AQ9A 3FSBA 3KWCA 1V3WA 3D98A 3D8VA 4EA9A 1KHRA 5AFUU 4E6TA 3HJJA 2XATA 2Q4JA 4E75A 1LXAA 1QRMA 1KGTA 2IUAA 2IU8A 3FTTA 1G95A 4EA7A 2W0VA 2TDTA 4N27A 4M2AA 4G3QA 2ICXA 3Q1XA 2QKXA 3BSWA 3ECTA 5ADXU 1KGQA 2OI7A 3EEVA 4R37A 3JQYA 2I5KA 5L6VA 2WLDA 2IU9A 1QRLA 3FSCA 1MR9A 3PMOA 1KQAA 4EA8A 1XATA 2OEGA 1HM8A 4AC3A 5DEPA 3IGJA 1G97A 3BSYA 3GOSA 3VNPA 3BXYA 2V0KA 3VBKA 4R36A 3T57A 3FSXA 4KQLA 3TWDA 4HZCA 4J09A 3EG4A 4G3PA 3TDTA 4AA7A 2W0WA 1SSTA 3F1XA 3R5AA 1QRGA 4HZDA 2WLFA 3DHOA 4KPXA 5U2KA 2P2OA 3R2WA 2V0JA 3VBNA 2GGQA 3FS8A 4H7OA 3I3AA 3R3RA 4ISXA 5ADXV 1FWYA 2JF3A 3VBJA 1XHDA 3SRTA 3EH0A 3R0SA
chains in the Genus database with same CATH superfamily
3C8VA 4MYOA 3CJ8A 4MZUA 3OUPA 1THJA 2ICYA 1TDTA 4G3SA 4IHHA 5L6SA 5E3PA 3R1WA 1QQ0A 2OI6A 3OU9A 4KNRA 5F42A 3FOQA 3BSSA 2OEFA 1Z2FA 4E6UA 1MR7A 1S80A 3TIOA 3OW5A 3GQAA 3R3IA 4G87A 4K6RA 4IHGA 4IHFA 4M99A 1KK6A 3MC4A 3KWEA 3BRKX 3NZ2A 1KRUA 1J2ZA 1Z90A 2OI5A 4M2BA 2VD4A 4EQYA 2GGOA 4M98A 2FKOA 4MFGA 4KNXA 2JF2A 3BFPA 5DEMA 3TV0A 3OGZA 3I3XA 4N6AA 4N69A 1QRFA 1YP2A 3GQ9A 2VHEA 3GQ8A 4N6BA 2QIAA 2WLGA 3HSQA 2WLCA 3DJ4A 3GQ7A 1YP3A 4M28A 5E3QA 4E1KA 4EABA 2RIJA 1T3DA 1KK5A 1HM9A 3OTZA 2WLEA 3IXCA 3R8YA 2V0HA 1HV9A 1YP4A 2V0IA 1SSMA 3MQGA 5AFUV 2QIVX 2V0LA 1SSQA 4FCEA 3OH0A 4HUSA 3R5DA 2NPOA 1QREA 4KPZA 3V4EA 1HM0A 4M9CA 4J18A 2IC7A 1V67A 4HURA 1KRRA 3P47A 3VBIA 3VBMA 3TISA 5DG3A 3GVDA 3GUEA 3KWDA 4R7PA 5E3RA 3VBPA 3R5BA 1KK4A 4EAAA 4DCLA 3TK8A 1OCXA 3VBLA 3P1BA 4E79A 1MRLA 3FSYA 3ST8A 3FWWA 3OTMA 3R5CA 1FXJA 4AAWA 4HCQA 3MQHA 3DK5A 3SPTA 4EGGA 1KRVA 1EWWA 2AQ9A 3FSBA 3KWCA 3OH2A 1V3WA 3D98A 3D8VA 4EA9A 1KHRA 5AFUU 4E6TA 3HJJA 2XATA 2Q4JA 4E75A 1LXAA 1QRMA 1KGTA 2IUAA 2IU8A 3FTTA 1G95A 4EA7A 2W0VA 2TDTA 4N27A 4M2AA 4G3QA 2ICXA 3Q1XA 2QKXA 3BSWA 3ECTA 5ADXU 1KGQA 2OI7A 3EEVA 4R37A 3JQYA 2I5KA 5L6VA 2WLDA 2IU9A 1QRLA 3SUCA 3FSCA 1MR9A 3PMOA 1KQAA 4EA8A 1XATA 2OEGA 1HM8A 4AC3A 5DEPA 3IGJA 1G97A 3BSYA 1L0SA 3GOSA 3BXYA 2V0KA 3VNPA 3VBKA 4R36A 3T57A 3FSXA 4KQLA 3TWDA 3OH4A 4HZCA 4J09A 3EG4A 4G3PA 3TDTA 3OH1A 4AA7A 2W0WA 1SSTA 3F1XA 3R5AA 1QRGA 1M8NA 2WLFA 3DHOA 4HZDA 4KPXA 5U2KA 2P2OA 1N4IA 2V0JA 3R2WA 3VBNA 2GGQA 3FS8A 4H7OA 3I3AA 3R3RA 4ISXA 5ADXV 1FWYA 2JF3A 3VBJA 3OH3A 1XHDA 3SRTA 3EH0A 3R0SA
chains in the Genus database with same CATH topology
3C8VA 4MYOA 3CJ8A 4MZUA 3OUPA 1THJA 2ICYA 1TDTA 4G3SA 4IHHA 5L6SA 5E3PA 3R1WA 1QQ0A 2OI6A 3OU9A 4KNRA 5F42A 3FOQA 3BSSA 2OEFA 4E6UA 1MR7A 1S80A 3TIOA 3OW5A 3R3IA 4G87A 4K6RA 4IHGA 4IHFA 4M99A 1KK6A 3MC4A 3KWEA 3BRKX 3NZ2A 1KRUA 1J2ZA 1Z90A 2OI5A 4M2BA 2VD4A 4EQYA 2GGOA 4M98A 2FKOA 4MFGA 4KNXA 2JF2A 3BFPA 5DEMA 3TV0A 4N6AA 3I3XA 4N69A 1QRFA 1YP2A 2VHEA 4N6BA 2QIAA 2WLGA 3HSQA 2WLCA 3DJ4A 4M28A 1YP3A 4E1KA 5E3QA 4EABA 2RIJA 1T3DA 1KK5A 1HM9A 3OTZA 2WLEA 3IXCA 3R8YA 2V0HA 1HV9A 1YP4A 2V0IA 1SSMA 3MQGA 5AFUV 2QIVX 2V0LA 1SSQA 4FCEA 4HUSA 3R5DA 2NPOA 1QREA 4KPZA 3V4EA 1HM0A 4M9CA 4J18A 2IC7A 1V67A 4HURA 1KRRA 3P47A 3VBIA 3VBMA 3TISA 5DG3A 3GVDA 3GUEA 3KWDA 4R7PA 5E3RA 3VBPA 3R5BA 1KK4A 4EAAA 4DCLA 3TK8A 1OCXA 3VBLA 3P1BA 4E79A 1MRLA 3FSYA 3ST8A 3FWWA 3OTMA 3R5CA 1FXJA 4AAWA 4HCQA 3MQHA 3DK5A 3SPTA 4EGGA 1KRVA 2AQ9A 3FSBA 3KWCA 1V3WA 3D98A 3D8VA 4EA9A 1KHRA 5AFUU 4E6TA 3HJJA 2XATA 2Q4JA 4E75A 1LXAA 1QRMA 1KGTA 2IUAA 2IU8A 3FTTA 1G95A 4EA7A 2W0VA 2TDTA 4N27A 4M2AA 4G3QA 2ICXA 3Q1XA 2QKXA 3BSWA 3ECTA 5ADXU 1KGQA 2OI7A 3EEVA 4R37A 3JQYA 2I5KA 5L6VA 2WLDA 2IU9A 1QRLA 3FSCA 1MR9A 3PMOA 1KQAA 4EA8A 1XATA 2OEGA 1HM8A 4AC3A 5DEPA 3IGJA 1G97A 3BSYA 3GOSA 3VNPA 3BXYA 2V0KA 3VBKA 4R36A 3T57A 3FSXA 4KQLA 3TWDA 4HZCA 4J09A 3EG4A 4G3PA 3TDTA 4AA7A 2W0WA 1SSTA 3F1XA 3R5AA 1QRGA 4HZDA 2WLFA 3DHOA 4KPXA 5U2KA 2P2OA 3R2WA 2V0JA 3VBNA 2GGQA 3FS8A 4H7OA 3I3AA 3R3RA 4ISXA 5ADXV 1FWYA 2JF3A 3VBJA 1XHDA 3SRTA 3EH0A 3R0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8V A;  4MYO A;  3CJ8 A;  4MZU A;  3OUP A;  1THJ A;  2ICY A;  1TDT A;  4G3S A;  4IHH A;  5L6S A;  5E3P A;  3R1W A;  1QQ0 A;  2OI6 A;  3OU9 A;  4KNR A;  5F42 A;  3FOQ A;  3BSS A;  2OEF A;  4E6U A;  1MR7 A;  1S80 A;  3TIO A;  3OW5 A;  3R3I A;  4G87 A;  4K6R A;  4IHG A;  4IHF A;  4M99 A;  1KK6 A;  3MC4 A;  3KWE A;  3BRK X;  3NZ2 A;  1KRU A;  1J2Z A;  1Z90 A;  2OI5 A;  4M2B A;  2VD4 A;  4EQY A;  2GGO A;  4M98 A;  2FKO A;  4MFG A;  4KNX A;  2JF2 A;  3BFP A;  5DEM A;  3TV0 A;  4N6A A;  3I3X A;  4N69 A;  1QRF A;  1YP2 A;  2VHE A;  4N6B A;  2QIA A;  2WLG A;  3HSQ A;  2WLC A;  3DJ4 A;  4M28 A;  1YP3 A;  4E1K A;  5E3Q A;  4EAB A;  2RIJ A;  1T3D A;  1KK5 A;  1HM9 A;  3OTZ A;  2WLE A;  3IXC A;  3R8Y A;  2V0H A;  1HV9 A;  1YP4 A;  2V0I A;  1SSM A;  3MQG A;  5AFU V;  2QIV X;  2V0L A;  1SSQ A;  4FCE A;  4HUS A;  3R5D A;  2NPO A;  1QRE A;  4KPZ A;  3V4E A;  1HM0 A;  4M9C A;  4J18 A;  2IC7 A;  1V67 A;  4HUR A;  1KRR A;  3P47 A;  3VBI A;  3VBM A;  3TIS A;  5DG3 A;  3GVD A;  3GUE A;  3KWD A;  4R7P A;  5E3R A;  3VBP A;  3R5B A;  1KK4 A;  4EAA A;  4DCL A;  3TK8 A;  1OCX A;  3VBL A;  3P1B A;  4E79 A;  1MRL A;  3FSY A;  3ST8 A;  3FWW A;  3OTM A;  3R5C A;  1FXJ A;  4AAW A;  4HCQ A;  3MQH A;  3DK5 A;  3SPT A;  4EGG A;  1KRV A;  2AQ9 A;  3FSB A;  3KWC A;  1V3W A;  3D98 A;  3D8V A;  4EA9 A;  1KHR A;  5AFU U;  4E6T A;  3HJJ A;  2XAT A;  2Q4J A;  4E75 A;  1LXA A;  1QRM A;  1KGT A;  2IUA A;  2IU8 A;  3FTT A;  1G95 A;  4EA7 A;  2W0V A;  2TDT A;  4N27 A;  4M2A A;  4G3Q A;  2ICX A;  3Q1X A;  2QKX A;  3BSW A;  3ECT A;  5ADX U;  1KGQ A;  2OI7 A;  3EEV A;  4R37 A;  3JQY A;  2I5K A;  5L6V A;  2WLD A;  2IU9 A;  1QRL A;  3FSC A;  1MR9 A;  3PMO A;  1KQA A;  4EA8 A;  1XAT A;  2OEG A;  1HM8 A;  4AC3 A;  5DEP A;  3IGJ A;  1G97 A;  3BSY A;  3GOS A;  3VNP A;  3BXY A;  2V0K A;  3VBK A;  4R36 A;  3T57 A;  3FSX A;  4KQL A;  3TWD A;  4HZC A;  4J09 A;  3EG4 A;  4G3P A;  3TDT A;  4AA7 A;  2W0W A;  1SST A;  3F1X A;  3R5A A;  1QRG A;  4HZD A;  2WLF A;  3DHO A;  4KPX A;  5U2K A;  2P2O A;  3R2W A;  2V0J A;  3VBN A;  2GGQ A;  3FS8 A;  4H7O A;  3I3A A;  3R3R A;  4ISX A;  5ADX V;  1FWY A;  2JF3 A;  3VBJ A;  1XHD A;  3SRT A;  3EH0 A;  3R0S A; 
#chains in the Genus database with same CATH topology
 3C8V A;  4MYO A;  3CJ8 A;  4MZU A;  3OUP A;  1THJ A;  2ICY A;  1TDT A;  4G3S A;  4IHH A;  5L6S A;  5E3P A;  3R1W A;  1QQ0 A;  2OI6 A;  3OU9 A;  4KNR A;  5F42 A;  3FOQ A;  3BSS A;  2OEF A;  1Z2F A;  4E6U A;  1MR7 A;  1S80 A;  3TIO A;  3OW5 A;  3GQA A;  3R3I A;  4G87 A;  4K6R A;  4IHG A;  4IHF A;  4M99 A;  1KK6 A;  3MC4 A;  3KWE A;  3BRK X;  3NZ2 A;  1KRU A;  1J2Z A;  1Z90 A;  2OI5 A;  4M2B A;  2VD4 A;  4EQY A;  2GGO A;  4M98 A;  2FKO A;  4MFG A;  4KNX A;  2JF2 A;  3BFP A;  5DEM A;  3TV0 A;  3OGZ A;  3I3X A;  4N6A A;  4N69 A;  1QRF A;  1YP2 A;  3GQ9 A;  2VHE A;  3GQ8 A;  4N6B A;  2QIA A;  2WLG A;  3HSQ A;  2WLC A;  3DJ4 A;  3GQ7 A;  1YP3 A;  4M28 A;  5E3Q A;  4E1K A;  4EAB A;  2RIJ A;  1T3D A;  1KK5 A;  1HM9 A;  3OTZ A;  2WLE A;  3IXC A;  3R8Y A;  2V0H A;  1HV9 A;  1YP4 A;  2V0I A;  1SSM A;  3MQG A;  5AFU V;  2QIV X;  2V0L A;  1SSQ A;  4FCE A;  3OH0 A;  4HUS A;  3R5D A;  2NPO A;  1QRE A;  4KPZ A;  3V4E A;  1HM0 A;  4M9C A;  4J18 A;  2IC7 A;  1V67 A;  4HUR A;  1KRR A;  3P47 A;  3VBI A;  3VBM A;  3TIS A;  5DG3 A;  3GVD A;  3GUE A;  3KWD A;  4R7P A;  5E3R A;  3VBP A;  3R5B A;  1KK4 A;  4EAA A;  4DCL A;  3TK8 A;  1OCX A;  3VBL A;  3P1B A;  4E79 A;  1MRL A;  3FSY A;  3ST8 A;  3FWW A;  3OTM A;  3R5C A;  1FXJ A;  4AAW A;  4HCQ A;  3MQH A;  3DK5 A;  3SPT A;  4EGG A;  1KRV A;  1EWW A;  2AQ9 A;  3FSB A;  3KWC A;  3OH2 A;  1V3W A;  3D98 A;  3D8V A;  4EA9 A;  1KHR A;  5AFU U;  4E6T A;  3HJJ A;  2XAT A;  2Q4J A;  4E75 A;  1LXA A;  1QRM A;  1KGT A;  2IUA A;  2IU8 A;  3FTT A;  1G95 A;  4EA7 A;  2W0V A;  2TDT A;  4N27 A;  4M2A A;  4G3Q A;  2ICX A;  3Q1X A;  2QKX A;  3BSW A;  3ECT A;  5ADX U;  1KGQ A;  2OI7 A;  3EEV A;  4R37 A;  3JQY A;  2I5K A;  5L6V A;  2WLD A;  2IU9 A;  1QRL A;  3SUC A;  3FSC A;  1MR9 A;  3PMO A;  1KQA A;  4EA8 A;  1XAT A;  2OEG A;  1HM8 A;  4AC3 A;  5DEP A;  3IGJ A;  1G97 A;  3BSY A;  1L0S A;  3GOS A;  3BXY A;  2V0K A;  3VNP A;  3VBK A;  4R36 A;  3T57 A;  3FSX A;  4KQL A;  3TWD A;  3OH4 A;  4HZC A;  4J09 A;  3EG4 A;  4G3P A;  3TDT A;  3OH1 A;  4AA7 A;  2W0W A;  1SST A;  3F1X A;  3R5A A;  1QRG A;  1M8N A;  2WLF A;  3DHO A;  4HZD A;  4KPX A;  5U2K A;  2P2O A;  1N4I A;  2V0J A;  3R2W A;  3VBN A;  2GGQ A;  3FS8 A;  4H7O A;  3I3A A;  3R3R A;  4ISX A;  5ADX V;  1FWY A;  2JF3 A;  3VBJ A;  3OH3 A;  1XHD A;  3SRT A;  3EH0 A;  3R0S A; 
#chains in the Genus database with same CATH homology
 3C8V A;  4MYO A;  3CJ8 A;  4MZU A;  3OUP A;  1THJ A;  2ICY A;  1TDT A;  4G3S A;  4IHH A;  5L6S A;  5E3P A;  3R1W A;  1QQ0 A;  2OI6 A;  3OU9 A;  4KNR A;  5F42 A;  3FOQ A;  3BSS A;  2OEF A;  4E6U A;  1MR7 A;  1S80 A;  3TIO A;  3OW5 A;  3R3I A;  4G87 A;  4K6R A;  4IHG A;  4IHF A;  4M99 A;  1KK6 A;  3MC4 A;  3KWE A;  3BRK X;  3NZ2 A;  1KRU A;  1J2Z A;  1Z90 A;  2OI5 A;  4M2B A;  2VD4 A;  4EQY A;  2GGO A;  4M98 A;  2FKO A;  4MFG A;  4KNX A;  2JF2 A;  3BFP A;  5DEM A;  3TV0 A;  4N6A A;  3I3X A;  4N69 A;  1QRF A;  1YP2 A;  2VHE A;  4N6B A;  2QIA A;  2WLG A;  3HSQ A;  2WLC A;  3DJ4 A;  4M28 A;  1YP3 A;  4E1K A;  5E3Q A;  4EAB A;  2RIJ A;  1T3D A;  1KK5 A;  1HM9 A;  3OTZ A;  2WLE A;  3IXC A;  3R8Y A;  2V0H A;  1HV9 A;  1YP4 A;  2V0I A;  1SSM A;  3MQG A;  5AFU V;  2QIV X;  2V0L A;  1SSQ A;  4FCE A;  4HUS A;  3R5D A;  2NPO A;  1QRE A;  4KPZ A;  3V4E A;  1HM0 A;  4M9C A;  4J18 A;  2IC7 A;  1V67 A;  4HUR A;  1KRR A;  3P47 A;  3VBI A;  3VBM A;  3TIS A;  5DG3 A;  3GVD A;  3GUE A;  3KWD A;  4R7P A;  5E3R A;  3VBP A;  3R5B A;  1KK4 A;  4EAA A;  4DCL A;  3TK8 A;  1OCX A;  3VBL A;  3P1B A;  4E79 A;  1MRL A;  3FSY A;  3ST8 A;  3FWW A;  3OTM A;  3R5C A;  1FXJ A;  4AAW A;  4HCQ A;  3MQH A;  3DK5 A;  3SPT A;  4EGG A;  1KRV A;  2AQ9 A;  3FSB A;  3KWC A;  1V3W A;  3D98 A;  3D8V A;  4EA9 A;  1KHR A;  5AFU U;  4E6T A;  3HJJ A;  2XAT A;  2Q4J A;  4E75 A;  1LXA A;  1QRM A;  1KGT A;  2IUA A;  2IU8 A;  3FTT A;  1G95 A;  4EA7 A;  2W0V A;  2TDT A;  4N27 A;  4M2A A;  4G3Q A;  2ICX A;  3Q1X A;  2QKX A;  3BSW A;  3ECT A;  5ADX U;  1KGQ A;  2OI7 A;  3EEV A;  4R37 A;  3JQY A;  2I5K A;  5L6V A;  2WLD A;  2IU9 A;  1QRL A;  3FSC A;  1MR9 A;  3PMO A;  1KQA A;  4EA8 A;  1XAT A;  2OEG A;  1HM8 A;  4AC3 A;  5DEP A;  3IGJ A;  1G97 A;  3BSY A;  3GOS A;  3VNP A;  3BXY A;  2V0K A;  3VBK A;  4R36 A;  3T57 A;  3FSX A;  4KQL A;  3TWD A;  4HZC A;  4J09 A;  3EG4 A;  4G3P A;  3TDT A;  4AA7 A;  2W0W A;  1SST A;  3F1X A;  3R5A A;  1QRG A;  4HZD A;  2WLF A;  3DHO A;  4KPX A;  5U2K A;  2P2O A;  3R2W A;  2V0J A;  3VBN A;  2GGQ A;  3FS8 A;  4H7O A;  3I3A A;  3R3R A;  4ISX A;  5ADX V;  1FWY A;  2JF3 A;  3VBJ A;  1XHD A;  3SRT A;  3EH0 A;  3R0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...