3R2WA

Crystal strucutre of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
485
structure length
465
Chain Sequence
IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 465
sequence length 485
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r2wA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r2wA01
5EJ1A 3IXCA 3I0HA 3MQHA 3D5NA 3C8VA 4FRDA 3SX7A 3U2VA 4N27A 5C48A 1H7LA 2OI5A 2Q4JA 1KGTA 4FRBA 4EE5A 2AECA 1H5TB 5CMHA 3CJ8A 2WVMA 4IHFA 3BSYA 1R81A 4B2WA 1O23B 5AFUU 5C1GA 1LZ7A 2AGDA 4EEGA 1FXJA 4K6RA 2WAWA 1ZJ2A 3R0SA 5FU8A 1PZYB 3OTMA 3BCVA 2A8UA 4G87A 1JV3A 1ZI4A 1ZJ1A 3BSSA 2XMHA 4Y6NA 1ZI5A 1KRVA 3IGJA 3V0LA 5C8RA 3VBPA 2O1GA 2XWLA 3TQDA 4HZCA 1NF5B 2APCA 3R5CA 2AE7A 2XWMA 1NMMB 2VXLA 1S80A 2TDTA 4KC1A 5C3DA 4N6BA 3V4EA 2V0HA 1W57A 1WVCA 1QQ0A 3R2WA 1GA8A 2X60A 1LL0A 2OI6A 1XATA 3I0DA 3SXDA 2VSIA 1O7OA 2YESA 5C49A 4LW6A 4NAKA 1VPAA 3VBIA 3I0IX 3FSBA 2FFUA 1QRLA 1HM0A 3ZLKA 1HM9A 2W0WA 2OI7A 1IIMA 3EEVA 1HM8A 4KT7A 1FGGA 3SX3A 5C4EA 3I0CA 3FS8A 1ZCTA 3CGXA 3KWDA 3Q1XA 1H7FA 5L6VA 2P6WA 3P47A 3VBJA 2AQ9A 4D11A 2JCKA 3POLA 1LZJA 2V0JA 2D7IA 1VH1A 3IOHA 3JUJA 5CQLX 5FU0A 5CQMX 3I3AA 2WVLA 4JISA 3ZLLA 5CQNX 1S4NA 2BO8A 2I5KA 2RJ5A 1G97A 3U2UA 2YC5A 5C1HA 4IHHA 3TWDA 1VM8A 5FTVA 1G9RA 1WT2A 1ZCUA 2WE9A 2OEFA 1H5RA 3VBNA 1G1LA 4Y9XA 3OUPA 2CU2A 1KRRA 1LXAA 1QGSA 5AFUV 4DE7A 5C4CA 3F1XA 4EE4A 4HO4A 4HG6A 3HL3A 4H7OA 1H5SA 4Y7VA 5IDTA 1YP4A 3FWWA 2I7BA 1VICA 4KC2A 1ZJ0A 2VFZA 1H5RB 3O3PA 1NQIB 3EH0A 3SXAA 3V0PA 4J09A 3EE5A 2BO4A 1TDTA 1K4VA 5HS2A 4BMAA 2X65A 3D8VA 4M2AA 1H5SB 5AJPA 1EZIA 3SX8A 2XWNA 1JVDA 2P72A 3R5AA 3DK5A 3DJ4A 1H7GA 1J2ZA 3R5BA 3PMOA 3V90A 4HUSA 3CKVA 4EA7A 4D11C 2ZU7A 4ECMA 1HV9A 3DHOA 1YROB 3CU0A 4B2XA 1KK4A 4EEMA 4FRHA 1H4DA 1JYKA 1ZDGA 2QGIA 2Y4KA 1QRFA 3OH1A 4DDZA 4HO8A 4AA7A 4E1KA 2E8BA 2JF2A 1R82A 2JCLA 1GQCA 3P1BA 4B3UA 2ICXA 2VHEA 1H7HA 2GGQA 4C2SA 2RJ6A 4P02A 3R3RA 5F42A 4E6UA 2WGZA 2VS3A 1QREA 2WLEA 4D48A 5IDSA 5DDTA 1HJLA 1ZJ3A 2YC3A 2YQHA 5C36A 2WLFA 2QH5A 4FCEA 1NWGB 1ZI3A 1R7XA 3RMWA 4R37A 3SXGA 4M9CA 2IU9A 3GUEA 1ZJPA 3LW6A 3TK8A 2AM4A 1LVWA 4IHGA 5IFYA 1NKHB 1H5SC 5DEMA 5DEPA 3V0QA 2Y4MA 4KPXA 3I0EA 4B5BA 1FGXA 2D7RA 2YQJA 5AJOA 1OMXA 2RJ9A 4EA9A 1FXOA 5EIYA 4FRPA 1MC3A 4FREA 4B4BA 1VZTA 4DECA 1ZIZA 4EABA 2RIXA 3FTTA 2RJ1A 3BRKX 4FQWA 2Y7AA 3OH0A 3CKQA 3TV0A 2VD4A 5ADXU 4HZDA 4HOCA 4G3SA 1VH3A 4AYJA 4AAWA 1GWWA 1H5SD 1QWJA 4CVHA 5E3PA 4YS8A 2Z87A 1QG8A 5J49A 2BO6A 4HO5A 3BSWA 3SX5A 4IRPA 3T7NA 3ZF8A 2IU8A 3EG4A 4EQYA 3R3IA 3GVDA 2YCMA 4ZDQA 1KGQA 4N69A 5E3QA 4M98A 4Y62A 4ARWA 1O7QA 2A8WA 2UX8A 3E26A 5C38A 2MZBA 1YP3A 4ASYA 2QIAA 3U2XA 1I52A 3HJJA 1KRUA 1G8OA 1WT3A 4Y7FA 1R7VA 3BFPA 2WLDA 1OMZA 1ZI1A 4AC3A 2JCOA 1IINA 4KQLA 2RITA 3Q4SA 4BQHA 3F1YA 4ASJA 5FYEA 2FYAA 3I3XA 5C47A 4B4MA 3T57A 1TW1A 2NXVA 3CKJA 2AH9A 3T7MA 4KXOA 1FR9A 1G0RA 1W77A 1G95A 4M4KA 1TW5A 4L41C 2WLCA 1JYLA 4D0ZA 3RMVA 1MP3A 1MR7A 1KQAA 1H3MA 1SS9A 2VS4A 3OTZA 3SPTA 3K8EA 5BXCA 1FO9A 1V83A 4CJBA 1VGZA 1WT0A 3VBLA 2I5EA 1ZCYA 2ZU9A 3SXBA 3R1WA 3FSYA 1OQMB 3FSXA 2ICYA 4Y7GA 4P00A 1S4OA 5C4BA 1FRWA 4UEGA 5CMFX 5C3BA 1NHEB 4M99A 2PGVA 3V8ZA 3GOSA 2V0IA 1OCXA 2P73A 2V0KA 2IC7A 2PA4A 3ECTA 2Z86A 3HSQA 4EEOA 2X5SA 3I0JA 5ADXV 1R80A 1GQ9A 1V82A 1QRMA 3TISA 1R7YA 3OU9A 3ZGGA 3K8DA 3SXCA 4MNDA 2IUAA 2RIYA 4FRLA 4NAIA 5AJNA 3JUKA 4MFGA 3I0FA 1H5TA 2JCJA 3V8YA 1TVYA 4KNXA 5CMGX 4D0TA 5CQPA 2OEGA 1LL2A 1KK5A 4N6AA 1GX0A 1W55A 5JQQA 2FYBA 1R7TA 1ZHJA 1KK6A 3I0LA 4KC4A 5C1LA 4R36A 4KNRA 2QKXA 1INIA 1SSQA 1T3DA 5EJZA 2YQSA 2NPOA 1SSTA 4Y6UA 1XHDA 1R7UA 2Y4LA 2XMEA 3N9WA 4HO6A 4EVWA 1FO8A 4G3QA 3SRTA 5C3AA 2RJ4A 3I0GA 3OH2A 3VBKA 3Q7UA 3ST8A 2DPWA 2O1HA 3U0YA 5CMIA 3R8YA 2PX7A 5L6SA 2YQCA 1FZWA 5E3RA 3OKRA 2WLGA 4HCQA 2FFVA 2VXMA 3OW5A 1ON8A 1LZ0A 3IOJA 4Y7TA 1H4EA 4AYLA 2WVKA 3FSCA 5DG3A 1ZCVA 3CKNA 3I0KA 2E3DA 1Z90A 3PKPA 3USQA 5FV9A 1ON6A 1PZTA 3KWCA 1YP2A 4ISXA 3JQYA 1MP4A 1XHBA 4MYBA 1MR9A 1G3LA 2GGOA 3KWEA 1VGWA 1KWSA 2PGYA 4G3PA 3TDTA 5DDVA 4HO3A 1FOAA 2ZU8A 1VZXA 2FY7A 4HO9A 2FYCB 3V0MA 4FROA 1FG5N 3VBMA 4B42A 1MRLA 1GX4A 5CQOA 1KHRA 4FCUA 3VNPA 3OH4A 1G2VA 1LL3A 4GBPA 4LW3A 1INJA 1JV1A 3R5DA 4E75A 2BO7A 2RJ0A 2O1FA 3E25A 1SSMA 4R7PA 2RJ8A 4JD0A 1QGQA 3TZTA 3IOIA 4HURA 4NALA 3NGWA 2RIJA 4M28A 1XZ6A 4EA8A 4HO2A 3OGZA 2JF3A 1ZJOA 1VZUA 2Y4JA 3DUVA 2VSHA 2D0JA 2Y6PA 2QIVX 5C4DA 5CMJA 1WT1A 4EGGA 4HO0A 3FOQA 3OH3A 3OAMA 1EYRA 4J18A 1FWYA 4DCLA 1S4PA 4NANA 4KPZA 2VS5A 3RSBA 1H4CA 4B4GA 1G93A 3D98A 3U2WA 4EE3A 4MYOA 3MC4A 4Y7UA 2P2OA 4E6TA 2W0VA 3CKOA 1V84A 3QVBA 3U2TA 5FTSA 4XWIA 3JTJA 2FKOA 3USRA 4FRQA 1O0RA 1V3WA 1TZFA 1VGTA 2RJ7A 1MP5A 4EEAA 1THJA 5C4FA 1ZDFA 4M2BA 4FRAA 3PNNA 3SXEA 1FR8A 1WSZA 3T7OA 4Y64A 3KIAA 1V67A 5I1FA 1H7EA 3V0OA 3OC9A 3NZ2A 3ZGFA 3V91A 3BXYA 4CJCA 1QRGA 3V0NA 4KRVA 2WEEA 2V0LA 4CJ8A 1JVGA 2AM5A 2AESA 1G23A 3TIOA 5FUHA 1GWVA 4IRQA 2XATA 2RIZA 1H7QA 4E79A 2X5ZA 2FYDB 4EAAA 1VGUA 5U2KA 3PKQA 1H7TA 3U0XA 4Y63A 1HJJA 2AM3A 3Q80A 3MQGA 4MZUA 3F1CA 4FRMA 1E5KA 1LZIA
chains in the Genus database with same CATH superfamily
5EJ1A 3IXCA 3I0HA 3MQHA 3D5NA 3C8VA 4FRDA 3SX7A 3U2VA 4N27A 5C48A 1H7LA 2OI5A 2Q4JA 1KGTA 4FRBA 4EE5A 2AECA 1H5TB 1N4IA 5CMHA 3CJ8A 2WVMA 4IHFA 3BSYA 1R81A 4B2WA 1O23B 5AFUU 5C1GA 1LZ7A 2AGDA 4EEGA 1FXJA 4K6RA 2WAWA 1ZJ2A 3R0SA 5FU8A 1PZYB 3OTMA 3BCVA 2A8UA 4G87A 4FIYA 1JV3A 1ZI4A 1ZJ1A 3BSSA 2XMHA 4Y6NA 1ZI5A 1KRVA 3IGJA 3V0LA 5C8RA 3VBPA 2O1GA 2XWLA 3TQDA 4HZCA 1NF5B 2APCA 3R5CA 2AE7A 2XWMA 1NMMB 2VXLA 1S80A 4O6MA 2TDTA 4KC1A 5C3DA 4N6BA 3V4EA 2V0HA 1W57A 1WVCA 1QQ0A 3R2WA 1GA8A 2X60A 1LL0A 2OI6A 1XATA 3I0DA 3SXDA 2VSIA 1O7OA 2YESA 5C49A 4LW6A 4NAKA 1VPAA 3VBIA 2J0AA 3I0IX 3FSBA 2FFUA 1QRLA 1HM0A 3ZLKA 1HM9A 2W0WA 2OI7A 1IIMA 3EEVA 1HM8A 4KT7A 1FGGA 3SX3A 5C4EA 3I0CA 3FS8A 1ZCTA 3CGXA 3KWDA 3Q1XA 1H7FA 5L6VA 2P6WA 3P47A 3VBJA 2AQ9A 4MIXA 4D11A 1Z2FA 2JCKA 3POLA 1LZJA 5D92A 2V0JA 2D7IA 1VH1A 3IOHA 3JUJA 5CQLX 5FU0A 5CQMX 3I3AA 2WVLA 4JISA 3ZLLA 5CQNX 1S4NA 2BO8A 2I5KA 2RJ5A 1G97A 3U2UA 2YC5A 5C1HA 4IHHA 3TWDA 1VM8A 5FTVA 1G9RA 1WT2A 1ZCUA 3GQ8A 2WE9A 2OEFA 1H5RA 3VBNA 1G1LA 4Y9XA 3OUPA 2CU2A 1KRRA 1LXAA 1QGSA 5AFUV 4DE7A 5C4CA 3F1XA 4EE4A 4HO4A 4HG6A 3HL3A 4H7OA 1H5SA 4Y7VA 5IDTA 1YP4A 3FWWA 2I7BA 1VICA 4KC2A 1ZJ0A 2C0NA 2VFZA 1H5RB 3O3PA 1NQIB 3EH0A 3SXAA 3V0PA 4J09A 3EE5A 2BO4A 1TDTA 1K4VA 5HS2A 4BMAA 2X65A 3D8VA 4M2AA 1H5SB 5AJPA 1EZIA 3SX8A 2XWNA 1JVDA 2P72A 3R5AA 3DK5A 3DJ4A 1H7GA 1J2ZA 3R5BA 3PMOA 3V90A 4HUSA 3CKVA 4EA7A 4D11C 2ZU7A 4ECMA 1HV9A 3DHOA 1YROB 3CU0A 4B2XA 1KK4A 4EEMA 4FRHA 1H4DA 1JYKA 1ZDGA 3OH1A 2QGIA 1QRFA 2Y4KA 4DDZA 4HO8A 4AA7A 4E1KA 2E8BA 2JF2A 1R82A 2JCLA 1GQCA 3P1BA 4B3UA 2ICXA 2VHEA 1H7HA 2GGQA 4C2SA 2RJ6A 4P02A 3R3RA 5F42A 4E6UA 2WGZA 2VS3A 1QREA 2WLEA 4D48A 5IDSA 5DDTA 1HJLA 1ZJ3A 2YC3A 2YQHA 5C36A 2WLFA 2QH5A 4FCEA 1NWGB 1ZI3A 1R7XA 3RMWA 4R37A 3SXGA 4M9CA 2IU9A 3GUEA 1ZJPA 3LW6A 3TK8A 2AM4A 1LVWA 4IHGA 5IFYA 1NKHB 1H5SC 5DEMA 5DEPA 3V0QA 1L0SA 4KPXA 2Y4MA 3I0EA 4B5BA 1FGXA 2D7RA 2YQJA 5AJOA 1OMXA 2RJ9A 4EA9A 1FXOA 5EIYA 4FRPA 1MC3A 4FREA 4B4BA 1VZTA 4DECA 1ZIZA 4EABA 2RIXA 3FTTA 2RJ1A 3BRKX 4FQWA 3OH0A 2Y7AA 3CKQA 3TV0A 2VD4A 5ADXU 4HZDA 4HOCA 4G3SA 1VH3A 4AYJA 4AAWA 1GWWA 1H5SD 1QWJA 4CVHA 5E3PA 4YS8A 2Z87A 1QG8A 5J49A 3GQAA 2BO6A 4HO5A 3BSWA 3SX5A 4IRPA 3T7NA 3ZF8A 2IU8A 3EG4A 4EQYA 3R3IA 3GVDA 2YCMA 4ZDQA 2VK9A 1KGQA 4N69A 5E3QA 4M98A 4Y62A 4ARWA 1O7QA 2A8WA 2UX8A 3E26A 5C38A 2MZBA 1YP3A 4ASYA 2QIAA 4O6NA 3U2XA 1I52A 3HJJA 1KRUA 1G8OA 1WT3A 4Y7FA 1R7VA 3BFPA 2WLDA 1OMZA 1ZI1A 4AC3A 2JCOA 1IINA 4KQLA 2RITA 3Q4SA 4BQHA 3F1YA 4ASJA 5FYEA 2FYAA 3I3XA 5C47A 4B4MA 3T57A 1TW1A 2NXVA 3CKJA 2AH9A 3T7MA 4KXOA 1FR9A 1G0RA 1W77A 1G95A 4M4KA 1TW5A 4L41C 2WLCA 1JYLA 4D0ZA 3RMVA 1MP3A 1MR7A 1KQAA 1H3MA 1SS9A 2VS4A 3OTZA 3SPTA 3K8EA 5BXCA 1FO9A 1V83A 4CJBA 1VGZA 1WT0A 3VBLA 2I5EA 1ZCYA 2ZU9A 3SXBA 3R1WA 3FSYA 1OQMB 3FSXA 2ICYA 3SUCA 4Y7GA 4P00A 1S4OA 5C4BA 1FRWA 4UEGA 5CMFX 5C3BA 1NHEB 4M99A 2PGVA 3V8ZA 3GOSA 2V0IA 1OCXA 2P73A 2V0KA 2IC7A 2PA4A 3ECTA 2Z86A 3HSQA 4EEOA 2X5SA 3I0JA 1EWWA 5ADXV 2J0BA 1R80A 1GQ9A 1V82A 1QRMA 3TISA 1R7YA 3OU9A 3ZGGA 3K8DA 3SXCA 4MNDA 2IUAA 2RIYA 4FRLA 4NAIA 5AJNA 3JUKA 4MFGA 3I0FA 1H5TA 2JCJA 3V8YA 1TVYA 4KNXA 5CMGX 4D0TA 5CQPA 2OEGA 1LL2A 1KK5A 4N6AA 1GX0A 1W55A 5JQQA 2FYBA 1R7TA 1ZHJA 1KK6A 3I0LA 4KC4A 5C1LA 4R36A 4KNRA 2QKXA 1INIA 1SSQA 1T3DA 5EJZA 2YQSA 4FIXA 2NPOA 1SSTA 4Y6UA 1XHDA 1R7UA 2Y4LA 2XMEA 3N9WA 4HO6A 4EVWA 1FO8A 4G3QA 3SRTA 5C3AA 2RJ4A 3I0GA 3OH2A 3VBKA 3Q7UA 3ST8A 2DPWA 2O1HA 3U0YA 5CMIA 3R8YA 2PX7A 5L6SA 2YQCA 1FZWA 5E3RA 3OKRA 2WLGA 4HCQA 2FFVA 4Q7CA 2VXMA 3OW5A 1ON8A 1LZ0A 3IOJA 4Y7TA 1H4EA 4AYLA 2WVKA 3FSCA 5DG3A 1ZCVA 3CKNA 3I0KA 2E3DA 1Z90A 3PKPA 3USQA 5FV9A 1ON6A 1PZTA 3KWCA 1YP2A 4ISXA 3JQYA 1MP4A 1XHBA 4MYBA 1MR9A 1G3LA 2GGOA 3KWEA 1VGWA 1KWSA 2PGYA 1M8NA 4G3PA 3TDTA 5DDVA 4HO3A 1FOAA 2ZU8A 1VZXA 2FY7A 4HO9A 2FYCB 3V0MA 4FROA 1FG5N 3VBMA 4B42A 1MRLA 1GX4A 5CQOA 1KHRA 4FCUA 3OH4A 3VNPA 1G2VA 1LL3A 4GBPA 4LW3A 1INJA 1JV1A 3R5DA 4E75A 2BO7A 2RJ0A 2O1FA 3E25A 1SSMA 4R7PA 2RJ8A 4JD0A 1QGQA 3TZTA 3IOIA 4HURA 4NALA 3GQ7A 3NGWA 2RIJA 4M28A 1XZ6A 4EA8A 4HO2A 3OGZA 2JF3A 1ZJOA 1VZUA 2Y4JA 3DUVA 2VSHA 2D0JA 2Y6PA 2QIVX 5C4DA 5CMJA 1WT1A 4EGGA 4HO0A 3FOQA 3OH3A 3OAMA 1EYRA 4J18A 1FWYA 4DCLA 1S4PA 4NANA 4KPZA 2VS5A 3RSBA 1H4CA 4B4GA 1G93A 3D98A 3U2WA 4EE3A 4MYOA 3MC4A 4Y7UA 2P2OA 4E6TA 2W0VA 3CKOA 1V84A 3QVBA 3U2TA 5FTSA 4XWIA 3JTJA 2FKOA 3USRA 4FRQA 1O0RA 1V3WA 1TZFA 1VGTA 2RJ7A 1MP5A 4EEAA 1THJA 5C4FA 1ZDFA 4M2BA 4FRAA 3PNNA 3SXEA 1FR8A 1WSZA 3T7OA 4Y64A 3KIAA 1V67A 5I1FA 1H7EA 3V0OA 3OC9A 3NZ2A 3ZGFA 3V91A 3BXYA 4CJCA 1QRGA 3V0NA 4KRVA 2WEEA 2V0LA 4CJ8A 1JVGA 2AM5A 2AESA 1G23A 3TIOA 5FUHA 1GWVA 4IRQA 2XATA 2RIZA 1H7QA 4E79A 2X5ZA 5D91A 2FYDB 4EAAA 1VGUA 5U2KA 3PKQA 1H7TA 3U0XA 3GQ9A 4Y63A 1HJJA 2AM3A 3Q80A 3MQGA 4MZUA 3F1CA 4FRMA 1E5KA 1LZIA
chains in the Genus database with same CATH topology
5EJ1A 3IXCA 3I0HA 3MQHA 3D5NA 3C8VA 4FRDA 3SX7A 3U2VA 4N27A 5C48A 1H7LA 2OI5A 2Q4JA 1KGTA 4FRBA 4EE5A 2AECA 1H5TB 5CMHA 3CJ8A 2WVMA 4IHFA 3BSYA 1R81A 4B2WA 1O23B 5AFUU 5C1GA 1LZ7A 2AGDA 4EEGA 1FXJA 4K6RA 2WAWA 1ZJ2A 3R0SA 5FU8A 1PZYB 3OTMA 3BCVA 2A8UA 4G87A 4FIYA 1JV3A 1ZI4A 1ZJ1A 3BSSA 2XMHA 4Y6NA 1ZI5A 1KRVA 3IGJA 3V0LA 5C8RA 3VBPA 2O1GA 2XWLA 3TQDA 4HZCA 1NF5B 2APCA 3R5CA 2AE7A 2XWMA 1NMMB 2VXLA 1S80A 4O6MA 2TDTA 4KC1A 5C3DA 4N6BA 3V4EA 2V0HA 1W57A 1WVCA 1QQ0A 3R2WA 1GA8A 2X60A 1LL0A 2OI6A 1XATA 3I0DA 3SXDA 2VSIA 1O7OA 2YESA 5C49A 4LW6A 4NAKA 1VPAA 3VBIA 2J0AA 3I0IX 3FSBA 2FFUA 1QRLA 1HM0A 3ZLKA 1HM9A 2W0WA 2OI7A 1IIMA 3EEVA 1HM8A 4KT7A 1FGGA 3SX3A 5C4EA 3I0CA 3FS8A 1ZCTA 3CGXA 3KWDA 3Q1XA 1H7FA 5L6VA 2P6WA 3P47A 3VBJA 2AQ9A 4MIXA 4D11A 2JCKA 3POLA 5D92A 1LZJA 2V0JA 2D7IA 1VH1A 3IOHA 3JUJA 5CQLX 5FU0A 5CQMX 3I3AA 2WVLA 4JISA 3ZLLA 5CQNX 1S4NA 2BO8A 2I5KA 2RJ5A 1G97A 3U2UA 2YC5A 5C1HA 4IHHA 3TWDA 1VM8A 5FTVA 1G9RA 1WT2A 1ZCUA 2WE9A 2OEFA 1H5RA 3VBNA 1G1LA 4Y9XA 3OUPA 2CU2A 1KRRA 1LXAA 1QGSA 5AFUV 4DE7A 5C4CA 3F1XA 4EE4A 4HO4A 4HG6A 3HL3A 4H7OA 1H5SA 4Y7VA 5IDTA 1YP4A 3FWWA 2I7BA 1VICA 4KC2A 1ZJ0A 2C0NA 2VFZA 1H5RB 3O3PA 1NQIB 3EH0A 3SXAA 3V0PA 4J09A 3EE5A 2BO4A 1TDTA 1K4VA 5HS2A 4BMAA 2X65A 3D8VA 4M2AA 1H5SB 5AJPA 1EZIA 3SX8A 2XWNA 1JVDA 2P72A 3R5AA 3DK5A 3DJ4A 1H7GA 1J2ZA 3R5BA 3PMOA 3V90A 4HUSA 3CKVA 4EA7A 4D11C 2ZU7A 4ECMA 1HV9A 3DHOA 1YROB 3CU0A 4B2XA 1KK4A 4EEMA 4FRHA 1H4DA 1JYKA 1ZDGA 2QGIA 2Y4KA 1QRFA 3OH1A 4DDZA 4HO8A 4AA7A 4E1KA 2E8BA 2JF2A 1R82A 2JCLA 1GQCA 3P1BA 4B3UA 2ICXA 2VHEA 1H7HA 2GGQA 4C2SA 2RJ6A 4P02A 3R3RA 5F42A 4E6UA 2WGZA 2VS3A 1QREA 2WLEA 4D48A 5IDSA 5DDTA 1HJLA 1ZJ3A 2YC3A 2YQHA 5C36A 2WLFA 2QH5A 4FCEA 1NWGB 1ZI3A 1R7XA 3RMWA 4R37A 3SXGA 4M9CA 2IU9A 3GUEA 1ZJPA 3LW6A 3TK8A 2AM4A 1LVWA 4IHGA 5IFYA 1NKHB 1H5SC 5DEMA 5DEPA 3V0QA 2Y4MA 4KPXA 3I0EA 4B5BA 1FGXA 2D7RA 2YQJA 5AJOA 1OMXA 2RJ9A 4EA9A 1FXOA 5EIYA 4FRPA 1MC3A 4FREA 4B4BA 1VZTA 4DECA 1ZIZA 4EABA 2RIXA 3FTTA 2RJ1A 3BRKX 4FQWA 2Y7AA 3OH0A 3CKQA 3TV0A 2VD4A 5ADXU 4HZDA 4HOCA 4G3SA 1VH3A 4AYJA 4AAWA 1GWWA 1H5SD 1QWJA 4CVHA 5E3PA 4YS8A 2Z87A 1QG8A 5J49A 2BO6A 4HO5A 3BSWA 3SX5A 4IRPA 3T7NA 3ZF8A 2IU8A 3EG4A 4EQYA 3R3IA 3GVDA 2YCMA 4ZDQA 2VK9A 1KGQA 4N69A 5E3QA 4M98A 4Y62A 4ARWA 1O7QA 2A8WA 2UX8A 3E26A 5C38A 2MZBA 1YP3A 4ASYA 2QIAA 4O6NA 3U2XA 1I52A 3HJJA 1KRUA 1G8OA 1WT3A 4Y7FA 1R7VA 3BFPA 2WLDA 1OMZA 1ZI1A 4AC3A 2JCOA 1IINA 4KQLA 2RITA 3Q4SA 4BQHA 3F1YA 4ASJA 5FYEA 2FYAA 3I3XA 5C47A 4B4MA 3T57A 1TW1A 2NXVA 3CKJA 2AH9A 3T7MA 4KXOA 1FR9A 1G0RA 1W77A 1G95A 4M4KA 1TW5A 4L41C 2WLCA 1JYLA 4D0ZA 3RMVA 1MP3A 1MR7A 1KQAA 1H3MA 1SS9A 2VS4A 3OTZA 3SPTA 3K8EA 5BXCA 1FO9A 1V83A 4CJBA 1VGZA 1WT0A 3VBLA 2I5EA 1ZCYA 2ZU9A 3SXBA 3R1WA 3FSYA 1OQMB 3FSXA 2ICYA 4Y7GA 4P00A 1S4OA 5C4BA 1FRWA 4UEGA 5CMFX 5C3BA 1NHEB 4M99A 2PGVA 3V8ZA 3GOSA 2V0IA 1OCXA 2P73A 2V0KA 2IC7A 2PA4A 3ECTA 2Z86A 3HSQA 4EEOA 2X5SA 3I0JA 5ADXV 2J0BA 1R80A 1GQ9A 1V82A 1QRMA 3TISA 1R7YA 3OU9A 3ZGGA 3K8DA 3SXCA 4MNDA 2IUAA 2RIYA 4FRLA 4NAIA 5AJNA 3JUKA 4MFGA 3I0FA 1H5TA 2JCJA 3V8YA 1TVYA 4KNXA 5CMGX 4D0TA 5CQPA 2OEGA 1LL2A 1KK5A 4N6AA 1GX0A 1W55A 5JQQA 2FYBA 1R7TA 1ZHJA 1KK6A 3I0LA 4KC4A 5C1LA 4R36A 4KNRA 2QKXA 1INIA 1SSQA 1T3DA 5EJZA 2YQSA 4FIXA 2NPOA 1SSTA 4Y6UA 1XHDA 1R7UA 2Y4LA 2XMEA 3N9WA 4HO6A 4EVWA 1FO8A 4G3QA 3SRTA 5C3AA 2RJ4A 3I0GA 3OH2A 3VBKA 3Q7UA 3ST8A 2DPWA 2O1HA 3U0YA 5CMIA 3R8YA 2PX7A 5L6SA 2YQCA 1FZWA 5E3RA 3OKRA 2WLGA 4HCQA 2FFVA 4Q7CA 2VXMA 3OW5A 1ON8A 1LZ0A 3IOJA 4Y7TA 1H4EA 4AYLA 2WVKA 3FSCA 5DG3A 1ZCVA 3CKNA 3I0KA 2E3DA 1Z90A 3PKPA 3USQA 5FV9A 1ON6A 1PZTA 3KWCA 1YP2A 4ISXA 3JQYA 1MP4A 1XHBA 4MYBA 1MR9A 1G3LA 2GGOA 3KWEA 1VGWA 1KWSA 2PGYA 4G3PA 3TDTA 5DDVA 4HO3A 1FOAA 2ZU8A 1VZXA 2FY7A 4HO9A 2FYCB 3V0MA 4FROA 1FG5N 3VBMA 4B42A 1MRLA 1GX4A 5CQOA 1KHRA 4FCUA 3VNPA 3OH4A 1G2VA 1LL3A 4GBPA 4LW3A 1INJA 1JV1A 3R5DA 4E75A 2BO7A 2RJ0A 2O1FA 3E25A 1SSMA 4R7PA 2RJ8A 4JD0A 1QGQA 3TZTA 3IOIA 4HURA 4NALA 3NGWA 2RIJA 4M28A 1XZ6A 4EA8A 4HO2A 3OGZA 2JF3A 1ZJOA 1VZUA 2Y4JA 3DUVA 2VSHA 2D0JA 2Y6PA 2QIVX 5C4DA 5CMJA 1WT1A 4EGGA 4HO0A 3FOQA 3OH3A 3OAMA 1EYRA 4J18A 1FWYA 4DCLA 1S4PA 4NANA 4KPZA 2VS5A 3RSBA 1H4CA 4B4GA 1G93A 3D98A 3U2WA 4EE3A 4MYOA 3MC4A 4Y7UA 2P2OA 4E6TA 2W0VA 3CKOA 1V84A 3QVBA 3U2TA 5FTSA 4XWIA 3JTJA 2FKOA 3USRA 4FRQA 1O0RA 1V3WA 1TZFA 1VGTA 2RJ7A 1MP5A 4EEAA 1THJA 5C4FA 1ZDFA 4M2BA 4FRAA 3PNNA 3SXEA 1FR8A 1WSZA 3T7OA 4Y64A 3KIAA 1V67A 5I1FA 1H7EA 3V0OA 3OC9A 3NZ2A 3ZGFA 3V91A 3BXYA 4CJCA 1QRGA 3V0NA 4KRVA 2WEEA 2V0LA 4CJ8A 1JVGA 2AM5A 2AESA 1G23A 3TIOA 5FUHA 1GWVA 4IRQA 2XATA 2RIZA 1H7QA 4E79A 2X5ZA 5D91A 2FYDB 4EAAA 1VGUA 5U2KA 3PKQA 1H7TA 3U0XA 4Y63A 1HJJA 2AM3A 3Q80A 3MQGA 4MZUA 3F1CA 4FRMA 1E5KA 1LZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJ1 A;  3IXC A;  3I0H A;  3MQH A;  3D5N A;  3C8V A;  4FRD A;  3SX7 A;  3U2V A;  4N27 A;  5C48 A;  1H7L A;  2OI5 A;  2Q4J A;  1KGT A;  4FRB A;  4EE5 A;  2AEC A;  1H5T B;  5CMH A;  3CJ8 A;  2WVM A;  4IHF A;  3BSY A;  1R81 A;  4B2W A;  1O23 B;  5AFU U;  5C1G A;  1LZ7 A;  2AGD A;  4EEG A;  1FXJ A;  4K6R A;  2WAW A;  1ZJ2 A;  3R0S A;  5FU8 A;  1PZY B;  3OTM A;  3BCV A;  2A8U A;  4G87 A;  1JV3 A;  1ZI4 A;  1ZJ1 A;  3BSS A;  2XMH A;  4Y6N A;  1ZI5 A;  1KRV A;  3IGJ A;  3V0L A;  5C8R A;  3VBP A;  2O1G A;  2XWL A;  3TQD A;  4HZC A;  1NF5 B;  2APC A;  3R5C A;  2AE7 A;  2XWM A;  1NMM B;  2VXL A;  1S80 A;  2TDT A;  4KC1 A;  5C3D A;  4N6B A;  3V4E A;  2V0H A;  1W57 A;  1WVC A;  1QQ0 A;  3R2W A;  1GA8 A;  2X60 A;  1LL0 A;  2OI6 A;  1XAT A;  3I0D A;  3SXD A;  2VSI A;  1O7O A;  2YES A;  5C49 A;  4LW6 A;  4NAK A;  1VPA A;  3VBI A;  3I0I X;  3FSB A;  2FFU A;  1QRL A;  1HM0 A;  3ZLK A;  1HM9 A;  2W0W A;  2OI7 A;  1IIM A;  3EEV A;  1HM8 A;  4KT7 A;  1FGG A;  3SX3 A;  5C4E A;  3I0C A;  3FS8 A;  1ZCT A;  3CGX A;  3KWD A;  3Q1X A;  1H7F A;  5L6V A;  2P6W A;  3P47 A;  3VBJ A;  2AQ9 A;  4D11 A;  2JCK A;  3POL A;  1LZJ A;  2V0J A;  2D7I A;  1VH1 A;  3IOH A;  3JUJ A;  5CQL X;  5FU0 A;  5CQM X;  3I3A A;  2WVL A;  4JIS A;  3ZLL A;  5CQN X;  1S4N A;  2BO8 A;  2I5K A;  2RJ5 A;  1G97 A;  3U2U A;  2YC5 A;  5C1H A;  4IHH A;  3TWD A;  1VM8 A;  5FTV A;  1G9R A;  1WT2 A;  1ZCU A;  2WE9 A;  2OEF A;  1H5R A;  3VBN A;  1G1L A;  4Y9X A;  3OUP A;  2CU2 A;  1KRR A;  1LXA A;  1QGS A;  5AFU V;  4DE7 A;  5C4C A;  3F1X A;  4EE4 A;  4HO4 A;  4HG6 A;  3HL3 A;  4H7O A;  1H5S A;  4Y7V A;  5IDT A;  1YP4 A;  3FWW A;  2I7B A;  1VIC A;  4KC2 A;  1ZJ0 A;  2VFZ A;  1H5R B;  3O3P A;  1NQI B;  3EH0 A;  3SXA A;  3V0P A;  4J09 A;  3EE5 A;  2BO4 A;  1TDT A;  1K4V A;  5HS2 A;  4BMA A;  2X65 A;  3D8V A;  4M2A A;  1H5S B;  5AJP A;  1EZI A;  3SX8 A;  2XWN A;  1JVD A;  2P72 A;  3R5A A;  3DK5 A;  3DJ4 A;  1H7G A;  1J2Z A;  3R5B A;  3PMO A;  3V90 A;  4HUS A;  3CKV A;  4EA7 A;  4D11 C;  2ZU7 A;  4ECM A;  1HV9 A;  3DHO A;  1YRO B;  3CU0 A;  4B2X A;  1KK4 A;  4EEM A;  4FRH A;  1H4D A;  1JYK A;  1ZDG A;  2QGI A;  2Y4K A;  1QRF A;  3OH1 A;  4DDZ A;  4HO8 A;  4AA7 A;  4E1K A;  2E8B A;  2JF2 A;  1R82 A;  2JCL A;  1GQC A;  3P1B A;  4B3U A;  2ICX A;  2VHE A;  1H7H A;  2GGQ A;  4C2S A;  2RJ6 A;  4P02 A;  3R3R A;  5F42 A;  4E6U A;  2WGZ A;  2VS3 A;  1QRE A;  2WLE A;  4D48 A;  5IDS A;  5DDT A;  1HJL A;  1ZJ3 A;  2YC3 A;  2YQH A;  5C36 A;  2WLF A;  2QH5 A;  4FCE A;  1NWG B;  1ZI3 A;  1R7X A;  3RMW A;  4R37 A;  3SXG A;  4M9C A;  2IU9 A;  3GUE A;  1ZJP A;  3LW6 A;  3TK8 A;  2AM4 A;  1LVW A;  4IHG A;  5IFY A;  1NKH B;  1H5S C;  5DEM A;  5DEP A;  3V0Q A;  2Y4M A;  4KPX A;  3I0E A;  4B5B A;  1FGX A;  2D7R A;  2YQJ A;  5AJO A;  1OMX A;  2RJ9 A;  4EA9 A;  1FXO A;  5EIY A;  4FRP A;  1MC3 A;  4FRE A;  4B4B A;  1VZT A;  4DEC A;  1ZIZ A;  4EAB A;  2RIX A;  3FTT A;  2RJ1 A;  3BRK X;  4FQW A;  2Y7A A;  3OH0 A;  3CKQ A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  4HOC A;  4G3S A;  1VH3 A;  4AYJ A;  4AAW A;  1GWW A;  1H5S D;  1QWJ A;  4CVH A;  5E3P A;  4YS8 A;  2Z87 A;  1QG8 A;  5J49 A;  2BO6 A;  4HO5 A;  3BSW A;  3SX5 A;  4IRP A;  3T7N A;  3ZF8 A;  2IU8 A;  3EG4 A;  4EQY A;  3R3I A;  3GVD A;  2YCM A;  4ZDQ A;  1KGQ A;  4N69 A;  5E3Q A;  4M98 A;  4Y62 A;  4ARW A;  1O7Q A;  2A8W A;  2UX8 A;  3E26 A;  5C38 A;  2MZB A;  1YP3 A;  4ASY A;  2QIA A;  3U2X A;  1I52 A;  3HJJ A;  1KRU A;  1G8O A;  1WT3 A;  4Y7F A;  1R7V A;  3BFP A;  2WLD A;  1OMZ A;  1ZI1 A;  4AC3 A;  2JCO A;  1IIN A;  4KQL A;  2RIT A;  3Q4S A;  4BQH A;  3F1Y A;  4ASJ A;  5FYE A;  2FYA A;  3I3X A;  5C47 A;  4B4M A;  3T57 A;  1TW1 A;  2NXV A;  3CKJ A;  2AH9 A;  3T7M A;  4KXO A;  1FR9 A;  1G0R A;  1W77 A;  1G95 A;  4M4K A;  1TW5 A;  4L41 C;  2WLC A;  1JYL A;  4D0Z A;  3RMV A;  1MP3 A;  1MR7 A;  1KQA A;  1H3M A;  1SS9 A;  2VS4 A;  3OTZ A;  3SPT A;  3K8E A;  5BXC A;  1FO9 A;  1V83 A;  4CJB A;  1VGZ A;  1WT0 A;  3VBL A;  2I5E A;  1ZCY A;  2ZU9 A;  3SXB A;  3R1W A;  3FSY A;  1OQM B;  3FSX A;  2ICY A;  4Y7G A;  4P00 A;  1S4O A;  5C4B A;  1FRW A;  4UEG A;  5CMF X;  5C3B A;  1NHE B;  4M99 A;  2PGV A;  3V8Z A;  3GOS A;  2V0I A;  1OCX A;  2P73 A;  2V0K A;  2IC7 A;  2PA4 A;  3ECT A;  2Z86 A;  3HSQ A;  4EEO A;  2X5S A;  3I0J A;  5ADX V;  1R80 A;  1GQ9 A;  1V82 A;  1QRM A;  3TIS A;  1R7Y A;  3OU9 A;  3ZGG A;  3K8D A;  3SXC A;  4MND A;  2IUA A;  2RIY A;  4FRL A;  4NAI A;  5AJN A;  3JUK A;  4MFG A;  3I0F A;  1H5T A;  2JCJ A;  3V8Y A;  1TVY A;  4KNX A;  5CMG X;  4D0T A;  5CQP A;  2OEG A;  1LL2 A;  1KK5 A;  4N6A A;  1GX0 A;  1W55 A;  5JQQ A;  2FYB A;  1R7T A;  1ZHJ A;  1KK6 A;  3I0L A;  4KC4 A;  5C1L A;  4R36 A;  4KNR A;  2QKX A;  1INI A;  1SSQ A;  1T3D A;  5EJZ A;  2YQS A;  2NPO A;  1SST A;  4Y6U A;  1XHD A;  1R7U A;  2Y4L A;  2XME A;  3N9W A;  4HO6 A;  4EVW A;  1FO8 A;  4G3Q A;  3SRT A;  5C3A A;  2RJ4 A;  3I0G A;  3OH2 A;  3VBK A;  3Q7U A;  3ST8 A;  2DPW A;  2O1H A;  3U0Y A;  5CMI A;  3R8Y A;  2PX7 A;  5L6S A;  2YQC A;  1FZW A;  5E3R A;  3OKR A;  2WLG A;  4HCQ A;  2FFV A;  2VXM A;  3OW5 A;  1ON8 A;  1LZ0 A;  3IOJ A;  4Y7T A;  1H4E A;  4AYL A;  2WVK A;  3FSC A;  5DG3 A;  1ZCV A;  3CKN A;  3I0K A;  2E3D A;  1Z90 A;  3PKP A;  3USQ A;  5FV9 A;  1ON6 A;  1PZT A;  3KWC A;  1YP2 A;  4ISX A;  3JQY A;  1MP4 A;  1XHB A;  4MYB A;  1MR9 A;  1G3L A;  2GGO A;  3KWE A;  1VGW A;  1KWS A;  2PGY A;  4G3P A;  3TDT A;  5DDV A;  4HO3 A;  1FOA A;  2ZU8 A;  1VZX A;  2FY7 A;  4HO9 A;  2FYC B;  3V0M A;  4FRO A;  1FG5 N;  3VBM A;  4B42 A;  1MRL A;  1GX4 A;  5CQO A;  1KHR A;  4FCU A;  3VNP A;  3OH4 A;  1G2V A;  1LL3 A;  4GBP A;  4LW3 A;  1INJ A;  1JV1 A;  3R5D A;  4E75 A;  2BO7 A;  2RJ0 A;  2O1F A;  3E25 A;  1SSM A;  4R7P A;  2RJ8 A;  4JD0 A;  1QGQ A;  3TZT A;  3IOI A;  4HUR A;  4NAL A;  3NGW A;  2RIJ A;  4M28 A;  1XZ6 A;  4EA8 A;  4HO2 A;  3OGZ A;  2JF3 A;  1ZJO A;  1VZU A;  2Y4J A;  3DUV A;  2VSH A;  2D0J A;  2Y6P A;  2QIV X;  5C4D A;  5CMJ A;  1WT1 A;  4EGG A;  4HO0 A;  3FOQ A;  3OH3 A;  3OAM A;  1EYR A;  4J18 A;  1FWY A;  4DCL A;  1S4P A;  4NAN A;  4KPZ A;  2VS5 A;  3RSB A;  1H4C A;  4B4G A;  1G93 A;  3D98 A;  3U2W A;  4EE3 A;  4MYO A;  3MC4 A;  4Y7U A;  2P2O A;  4E6T A;  2W0V A;  3CKO A;  1V84 A;  3QVB A;  3U2T A;  5FTS A;  4XWI A;  3JTJ A;  2FKO A;  3USR A;  4FRQ A;  1O0R A;  1V3W A;  1TZF A;  1VGT A;  2RJ7 A;  1MP5 A;  4EEA A;  1THJ A;  5C4F A;  1ZDF A;  4M2B A;  4FRA A;  3PNN A;  3SXE A;  1FR8 A;  1WSZ A;  3T7O A;  4Y64 A;  3KIA A;  1V67 A;  5I1F A;  1H7E A;  3V0O A;  3OC9 A;  3NZ2 A;  3ZGF A;  3V91 A;  3BXY A;  4CJC A;  1QRG A;  3V0N A;  4KRV A;  2WEE A;  2V0L A;  4CJ8 A;  1JVG A;  2AM5 A;  2AES A;  1G23 A;  3TIO A;  5FUH A;  1GWV A;  4IRQ A;  2XAT A;  2RIZ A;  1H7Q A;  4E79 A;  2X5Z A;  2FYD B;  4EAA A;  1VGU A;  5U2K A;  3PKQ A;  1H7T A;  3U0X A;  4Y63 A;  1HJJ A;  2AM3 A;  3Q80 A;  3MQG A;  4MZU A;  3F1C A;  4FRM A;  1E5K A;  1LZI A; 
#chains in the Genus database with same CATH topology
 5EJ1 A;  3IXC A;  3I0H A;  3MQH A;  3D5N A;  3C8V A;  4FRD A;  3SX7 A;  3U2V A;  4N27 A;  5C48 A;  1H7L A;  2OI5 A;  2Q4J A;  1KGT A;  4FRB A;  4EE5 A;  2AEC A;  1H5T B;  1N4I A;  5CMH A;  3CJ8 A;  2WVM A;  4IHF A;  3BSY A;  1R81 A;  4B2W A;  1O23 B;  5AFU U;  5C1G A;  1LZ7 A;  2AGD A;  4EEG A;  1FXJ A;  4K6R A;  2WAW A;  1ZJ2 A;  3R0S A;  5FU8 A;  1PZY B;  3OTM A;  3BCV A;  2A8U A;  4G87 A;  4FIY A;  1JV3 A;  1ZI4 A;  1ZJ1 A;  3BSS A;  2XMH A;  4Y6N A;  1ZI5 A;  1KRV A;  3IGJ A;  3V0L A;  5C8R A;  3VBP A;  2O1G A;  2XWL A;  3TQD A;  4HZC A;  1NF5 B;  2APC A;  3R5C A;  2AE7 A;  2XWM A;  1NMM B;  2VXL A;  1S80 A;  4O6M A;  2TDT A;  4KC1 A;  5C3D A;  4N6B A;  3V4E A;  2V0H A;  1W57 A;  1WVC A;  1QQ0 A;  3R2W A;  1GA8 A;  2X60 A;  1LL0 A;  2OI6 A;  1XAT A;  3I0D A;  3SXD A;  2VSI A;  1O7O A;  2YES A;  5C49 A;  4LW6 A;  4NAK A;  1VPA A;  3VBI A;  2J0A A;  3I0I X;  3FSB A;  2FFU A;  1QRL A;  1HM0 A;  3ZLK A;  1HM9 A;  2W0W A;  2OI7 A;  1IIM A;  3EEV A;  1HM8 A;  4KT7 A;  1FGG A;  3SX3 A;  5C4E A;  3I0C A;  3FS8 A;  1ZCT A;  3CGX A;  3KWD A;  3Q1X A;  1H7F A;  5L6V A;  2P6W A;  3P47 A;  3VBJ A;  2AQ9 A;  4MIX A;  4D11 A;  1Z2F A;  2JCK A;  3POL A;  1LZJ A;  5D92 A;  2V0J A;  2D7I A;  1VH1 A;  3IOH A;  3JUJ A;  5CQL X;  5FU0 A;  5CQM X;  3I3A A;  2WVL A;  4JIS A;  3ZLL A;  5CQN X;  1S4N A;  2BO8 A;  2I5K A;  2RJ5 A;  1G97 A;  3U2U A;  2YC5 A;  5C1H A;  4IHH A;  3TWD A;  1VM8 A;  5FTV A;  1G9R A;  1WT2 A;  1ZCU A;  3GQ8 A;  2WE9 A;  2OEF A;  1H5R A;  3VBN A;  1G1L A;  4Y9X A;  3OUP A;  2CU2 A;  1KRR A;  1LXA A;  1QGS A;  5AFU V;  4DE7 A;  5C4C A;  3F1X A;  4EE4 A;  4HO4 A;  4HG6 A;  3HL3 A;  4H7O A;  1H5S A;  4Y7V A;  5IDT A;  1YP4 A;  3FWW A;  2I7B A;  1VIC A;  4KC2 A;  1ZJ0 A;  2C0N A;  2VFZ A;  1H5R B;  3O3P A;  1NQI B;  3EH0 A;  3SXA A;  3V0P A;  4J09 A;  3EE5 A;  2BO4 A;  1TDT A;  1K4V A;  5HS2 A;  4BMA A;  2X65 A;  3D8V A;  4M2A A;  1H5S B;  5AJP A;  1EZI A;  3SX8 A;  2XWN A;  1JVD A;  2P72 A;  3R5A A;  3DK5 A;  3DJ4 A;  1H7G A;  1J2Z A;  3R5B A;  3PMO A;  3V90 A;  4HUS A;  3CKV A;  4EA7 A;  4D11 C;  2ZU7 A;  4ECM A;  1HV9 A;  3DHO A;  1YRO B;  3CU0 A;  4B2X A;  1KK4 A;  4EEM A;  4FRH A;  1H4D A;  1JYK A;  1ZDG A;  3OH1 A;  2QGI A;  1QRF A;  2Y4K A;  4DDZ A;  4HO8 A;  4AA7 A;  4E1K A;  2E8B A;  2JF2 A;  1R82 A;  2JCL A;  1GQC A;  3P1B A;  4B3U A;  2ICX A;  2VHE A;  1H7H A;  2GGQ A;  4C2S A;  2RJ6 A;  4P02 A;  3R3R A;  5F42 A;  4E6U A;  2WGZ A;  2VS3 A;  1QRE A;  2WLE A;  4D48 A;  5IDS A;  5DDT A;  1HJL A;  1ZJ3 A;  2YC3 A;  2YQH A;  5C36 A;  2WLF A;  2QH5 A;  4FCE A;  1NWG B;  1ZI3 A;  1R7X A;  3RMW A;  4R37 A;  3SXG A;  4M9C A;  2IU9 A;  3GUE A;  1ZJP A;  3LW6 A;  3TK8 A;  2AM4 A;  1LVW A;  4IHG A;  5IFY A;  1NKH B;  1H5S C;  5DEM A;  5DEP A;  3V0Q A;  1L0S A;  4KPX A;  2Y4M A;  3I0E A;  4B5B A;  1FGX A;  2D7R A;  2YQJ A;  5AJO A;  1OMX A;  2RJ9 A;  4EA9 A;  1FXO A;  5EIY A;  4FRP A;  1MC3 A;  4FRE A;  4B4B A;  1VZT A;  4DEC A;  1ZIZ A;  4EAB A;  2RIX A;  3FTT A;  2RJ1 A;  3BRK X;  4FQW A;  3OH0 A;  2Y7A A;  3CKQ A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  4HOC A;  4G3S A;  1VH3 A;  4AYJ A;  4AAW A;  1GWW A;  1H5S D;  1QWJ A;  4CVH A;  5E3P A;  4YS8 A;  2Z87 A;  1QG8 A;  5J49 A;  3GQA A;  2BO6 A;  4HO5 A;  3BSW A;  3SX5 A;  4IRP A;  3T7N A;  3ZF8 A;  2IU8 A;  3EG4 A;  4EQY A;  3R3I A;  3GVD A;  2YCM A;  4ZDQ A;  2VK9 A;  1KGQ A;  4N69 A;  5E3Q A;  4M98 A;  4Y62 A;  4ARW A;  1O7Q A;  2A8W A;  2UX8 A;  3E26 A;  5C38 A;  2MZB A;  1YP3 A;  4ASY A;  2QIA A;  4O6N A;  3U2X A;  1I52 A;  3HJJ A;  1KRU A;  1G8O A;  1WT3 A;  4Y7F A;  1R7V A;  3BFP A;  2WLD A;  1OMZ A;  1ZI1 A;  4AC3 A;  2JCO A;  1IIN A;  4KQL A;  2RIT A;  3Q4S A;  4BQH A;  3F1Y A;  4ASJ A;  5FYE A;  2FYA A;  3I3X A;  5C47 A;  4B4M A;  3T57 A;  1TW1 A;  2NXV A;  3CKJ A;  2AH9 A;  3T7M A;  4KXO A;  1FR9 A;  1G0R A;  1W77 A;  1G95 A;  4M4K A;  1TW5 A;  4L41 C;  2WLC A;  1JYL A;  4D0Z A;  3RMV A;  1MP3 A;  1MR7 A;  1KQA A;  1H3M A;  1SS9 A;  2VS4 A;  3OTZ A;  3SPT A;  3K8E A;  5BXC A;  1FO9 A;  1V83 A;  4CJB A;  1VGZ A;  1WT0 A;  3VBL A;  2I5E A;  1ZCY A;  2ZU9 A;  3SXB A;  3R1W A;  3FSY A;  1OQM B;  3FSX A;  2ICY A;  3SUC A;  4Y7G A;  4P00 A;  1S4O A;  5C4B A;  1FRW A;  4UEG A;  5CMF X;  5C3B A;  1NHE B;  4M99 A;  2PGV A;  3V8Z A;  3GOS A;  2V0I A;  1OCX A;  2P73 A;  2V0K A;  2IC7 A;  2PA4 A;  3ECT A;  2Z86 A;  3HSQ A;  4EEO A;  2X5S A;  3I0J A;  1EWW A;  5ADX V;  2J0B A;  1R80 A;  1GQ9 A;  1V82 A;  1QRM A;  3TIS A;  1R7Y A;  3OU9 A;  3ZGG A;  3K8D A;  3SXC A;  4MND A;  2IUA A;  2RIY A;  4FRL A;  4NAI A;  5AJN A;  3JUK A;  4MFG A;  3I0F A;  1H5T A;  2JCJ A;  3V8Y A;  1TVY A;  4KNX A;  5CMG X;  4D0T A;  5CQP A;  2OEG A;  1LL2 A;  1KK5 A;  4N6A A;  1GX0 A;  1W55 A;  5JQQ A;  2FYB A;  1R7T A;  1ZHJ A;  1KK6 A;  3I0L A;  4KC4 A;  5C1L A;  4R36 A;  4KNR A;  2QKX A;  1INI A;  1SSQ A;  1T3D A;  5EJZ A;  2YQS A;  4FIX A;  2NPO A;  1SST A;  4Y6U A;  1XHD A;  1R7U A;  2Y4L A;  2XME A;  3N9W A;  4HO6 A;  4EVW A;  1FO8 A;  4G3Q A;  3SRT A;  5C3A A;  2RJ4 A;  3I0G A;  3OH2 A;  3VBK A;  3Q7U A;  3ST8 A;  2DPW A;  2O1H A;  3U0Y A;  5CMI A;  3R8Y A;  2PX7 A;  5L6S A;  2YQC A;  1FZW A;  5E3R A;  3OKR A;  2WLG A;  4HCQ A;  2FFV A;  4Q7C A;  2VXM A;  3OW5 A;  1ON8 A;  1LZ0 A;  3IOJ A;  4Y7T A;  1H4E A;  4AYL A;  2WVK A;  3FSC A;  5DG3 A;  1ZCV A;  3CKN A;  3I0K A;  2E3D A;  1Z90 A;  3PKP A;  3USQ A;  5FV9 A;  1ON6 A;  1PZT A;  3KWC A;  1YP2 A;  4ISX A;  3JQY A;  1MP4 A;  1XHB A;  4MYB A;  1MR9 A;  1G3L A;  2GGO A;  3KWE A;  1VGW A;  1KWS A;  2PGY A;  1M8N A;  4G3P A;  3TDT A;  5DDV A;  4HO3 A;  1FOA A;  2ZU8 A;  1VZX A;  2FY7 A;  4HO9 A;  2FYC B;  3V0M A;  4FRO A;  1FG5 N;  3VBM A;  4B42 A;  1MRL A;  1GX4 A;  5CQO A;  1KHR A;  4FCU A;  3OH4 A;  3VNP A;  1G2V A;  1LL3 A;  4GBP A;  4LW3 A;  1INJ A;  1JV1 A;  3R5D A;  4E75 A;  2BO7 A;  2RJ0 A;  2O1F A;  3E25 A;  1SSM A;  4R7P A;  2RJ8 A;  4JD0 A;  1QGQ A;  3TZT A;  3IOI A;  4HUR A;  4NAL A;  3GQ7 A;  3NGW A;  2RIJ A;  4M28 A;  1XZ6 A;  4EA8 A;  4HO2 A;  3OGZ A;  2JF3 A;  1ZJO A;  1VZU A;  2Y4J A;  3DUV A;  2VSH A;  2D0J A;  2Y6P A;  2QIV X;  5C4D A;  5CMJ A;  1WT1 A;  4EGG A;  4HO0 A;  3FOQ A;  3OH3 A;  3OAM A;  1EYR A;  4J18 A;  1FWY A;  4DCL A;  1S4P A;  4NAN A;  4KPZ A;  2VS5 A;  3RSB A;  1H4C A;  4B4G A;  1G93 A;  3D98 A;  3U2W A;  4EE3 A;  4MYO A;  3MC4 A;  4Y7U A;  2P2O A;  4E6T A;  2W0V A;  3CKO A;  1V84 A;  3QVB A;  3U2T A;  5FTS A;  4XWI A;  3JTJ A;  2FKO A;  3USR A;  4FRQ A;  1O0R A;  1V3W A;  1TZF A;  1VGT A;  2RJ7 A;  1MP5 A;  4EEA A;  1THJ A;  5C4F A;  1ZDF A;  4M2B A;  4FRA A;  3PNN A;  3SXE A;  1FR8 A;  1WSZ A;  3T7O A;  4Y64 A;  3KIA A;  1V67 A;  5I1F A;  1H7E A;  3V0O A;  3OC9 A;  3NZ2 A;  3ZGF A;  3V91 A;  3BXY A;  4CJC A;  1QRG A;  3V0N A;  4KRV A;  2WEE A;  2V0L A;  4CJ8 A;  1JVG A;  2AM5 A;  2AES A;  1G23 A;  3TIO A;  5FUH A;  1GWV A;  4IRQ A;  2XAT A;  2RIZ A;  1H7Q A;  4E79 A;  2X5Z A;  5D91 A;  2FYD B;  4EAA A;  1VGU A;  5U2K A;  3PKQ A;  1H7T A;  3U0X A;  3GQ9 A;  4Y63 A;  1HJJ A;  2AM3 A;  3Q80 A;  3MQG A;  4MZU A;  3F1C A;  4FRM A;  1E5K A;  1LZI A; 
#chains in the Genus database with same CATH homology
 5EJ1 A;  3IXC A;  3I0H A;  3MQH A;  3D5N A;  3C8V A;  4FRD A;  3SX7 A;  3U2V A;  4N27 A;  5C48 A;  1H7L A;  2OI5 A;  2Q4J A;  1KGT A;  4FRB A;  4EE5 A;  2AEC A;  1H5T B;  5CMH A;  3CJ8 A;  2WVM A;  4IHF A;  3BSY A;  1R81 A;  4B2W A;  1O23 B;  5AFU U;  5C1G A;  1LZ7 A;  2AGD A;  4EEG A;  1FXJ A;  4K6R A;  2WAW A;  1ZJ2 A;  3R0S A;  5FU8 A;  1PZY B;  3OTM A;  3BCV A;  2A8U A;  4G87 A;  4FIY A;  1JV3 A;  1ZI4 A;  1ZJ1 A;  3BSS A;  2XMH A;  4Y6N A;  1ZI5 A;  1KRV A;  3IGJ A;  3V0L A;  5C8R A;  3VBP A;  2O1G A;  2XWL A;  3TQD A;  4HZC A;  1NF5 B;  2APC A;  3R5C A;  2AE7 A;  2XWM A;  1NMM B;  2VXL A;  1S80 A;  4O6M A;  2TDT A;  4KC1 A;  5C3D A;  4N6B A;  3V4E A;  2V0H A;  1W57 A;  1WVC A;  1QQ0 A;  3R2W A;  1GA8 A;  2X60 A;  1LL0 A;  2OI6 A;  1XAT A;  3I0D A;  3SXD A;  2VSI A;  1O7O A;  2YES A;  5C49 A;  4LW6 A;  4NAK A;  1VPA A;  3VBI A;  2J0A A;  3I0I X;  3FSB A;  2FFU A;  1QRL A;  1HM0 A;  3ZLK A;  1HM9 A;  2W0W A;  2OI7 A;  1IIM A;  3EEV A;  1HM8 A;  4KT7 A;  1FGG A;  3SX3 A;  5C4E A;  3I0C A;  3FS8 A;  1ZCT A;  3CGX A;  3KWD A;  3Q1X A;  1H7F A;  5L6V A;  2P6W A;  3P47 A;  3VBJ A;  2AQ9 A;  4MIX A;  4D11 A;  2JCK A;  3POL A;  5D92 A;  1LZJ A;  2V0J A;  2D7I A;  1VH1 A;  3IOH A;  3JUJ A;  5CQL X;  5FU0 A;  5CQM X;  3I3A A;  2WVL A;  4JIS A;  3ZLL A;  5CQN X;  1S4N A;  2BO8 A;  2I5K A;  2RJ5 A;  1G97 A;  3U2U A;  2YC5 A;  5C1H A;  4IHH A;  3TWD A;  1VM8 A;  5FTV A;  1G9R A;  1WT2 A;  1ZCU A;  2WE9 A;  2OEF A;  1H5R A;  3VBN A;  1G1L A;  4Y9X A;  3OUP A;  2CU2 A;  1KRR A;  1LXA A;  1QGS A;  5AFU V;  4DE7 A;  5C4C A;  3F1X A;  4EE4 A;  4HO4 A;  4HG6 A;  3HL3 A;  4H7O A;  1H5S A;  4Y7V A;  5IDT A;  1YP4 A;  3FWW A;  2I7B A;  1VIC A;  4KC2 A;  1ZJ0 A;  2C0N A;  2VFZ A;  1H5R B;  3O3P A;  1NQI B;  3EH0 A;  3SXA A;  3V0P A;  4J09 A;  3EE5 A;  2BO4 A;  1TDT A;  1K4V A;  5HS2 A;  4BMA A;  2X65 A;  3D8V A;  4M2A A;  1H5S B;  5AJP A;  1EZI A;  3SX8 A;  2XWN A;  1JVD A;  2P72 A;  3R5A A;  3DK5 A;  3DJ4 A;  1H7G A;  1J2Z A;  3R5B A;  3PMO A;  3V90 A;  4HUS A;  3CKV A;  4EA7 A;  4D11 C;  2ZU7 A;  4ECM A;  1HV9 A;  3DHO A;  1YRO B;  3CU0 A;  4B2X A;  1KK4 A;  4EEM A;  4FRH A;  1H4D A;  1JYK A;  1ZDG A;  2QGI A;  2Y4K A;  1QRF A;  3OH1 A;  4DDZ A;  4HO8 A;  4AA7 A;  4E1K A;  2E8B A;  2JF2 A;  1R82 A;  2JCL A;  1GQC A;  3P1B A;  4B3U A;  2ICX A;  2VHE A;  1H7H A;  2GGQ A;  4C2S A;  2RJ6 A;  4P02 A;  3R3R A;  5F42 A;  4E6U A;  2WGZ A;  2VS3 A;  1QRE A;  2WLE A;  4D48 A;  5IDS A;  5DDT A;  1HJL A;  1ZJ3 A;  2YC3 A;  2YQH A;  5C36 A;  2WLF A;  2QH5 A;  4FCE A;  1NWG B;  1ZI3 A;  1R7X A;  3RMW A;  4R37 A;  3SXG A;  4M9C A;  2IU9 A;  3GUE A;  1ZJP A;  3LW6 A;  3TK8 A;  2AM4 A;  1LVW A;  4IHG A;  5IFY A;  1NKH B;  1H5S C;  5DEM A;  5DEP A;  3V0Q A;  2Y4M A;  4KPX A;  3I0E A;  4B5B A;  1FGX A;  2D7R A;  2YQJ A;  5AJO A;  1OMX A;  2RJ9 A;  4EA9 A;  1FXO A;  5EIY A;  4FRP A;  1MC3 A;  4FRE A;  4B4B A;  1VZT A;  4DEC A;  1ZIZ A;  4EAB A;  2RIX A;  3FTT A;  2RJ1 A;  3BRK X;  4FQW A;  2Y7A A;  3OH0 A;  3CKQ A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  4HOC A;  4G3S A;  1VH3 A;  4AYJ A;  4AAW A;  1GWW A;  1H5S D;  1QWJ A;  4CVH A;  5E3P A;  4YS8 A;  2Z87 A;  1QG8 A;  5J49 A;  2BO6 A;  4HO5 A;  3BSW A;  3SX5 A;  4IRP A;  3T7N A;  3ZF8 A;  2IU8 A;  3EG4 A;  4EQY A;  3R3I A;  3GVD A;  2YCM A;  4ZDQ A;  2VK9 A;  1KGQ A;  4N69 A;  5E3Q A;  4M98 A;  4Y62 A;  4ARW A;  1O7Q A;  2A8W A;  2UX8 A;  3E26 A;  5C38 A;  2MZB A;  1YP3 A;  4ASY A;  2QIA A;  4O6N A;  3U2X A;  1I52 A;  3HJJ A;  1KRU A;  1G8O A;  1WT3 A;  4Y7F A;  1R7V A;  3BFP A;  2WLD A;  1OMZ A;  1ZI1 A;  4AC3 A;  2JCO A;  1IIN A;  4KQL A;  2RIT A;  3Q4S A;  4BQH A;  3F1Y A;  4ASJ A;  5FYE A;  2FYA A;  3I3X A;  5C47 A;  4B4M A;  3T57 A;  1TW1 A;  2NXV A;  3CKJ A;  2AH9 A;  3T7M A;  4KXO A;  1FR9 A;  1G0R A;  1W77 A;  1G95 A;  4M4K A;  1TW5 A;  4L41 C;  2WLC A;  1JYL A;  4D0Z A;  3RMV A;  1MP3 A;  1MR7 A;  1KQA A;  1H3M A;  1SS9 A;  2VS4 A;  3OTZ A;  3SPT A;  3K8E A;  5BXC A;  1FO9 A;  1V83 A;  4CJB A;  1VGZ A;  1WT0 A;  3VBL A;  2I5E A;  1ZCY A;  2ZU9 A;  3SXB A;  3R1W A;  3FSY A;  1OQM B;  3FSX A;  2ICY A;  4Y7G A;  4P00 A;  1S4O A;  5C4B A;  1FRW A;  4UEG A;  5CMF X;  5C3B A;  1NHE B;  4M99 A;  2PGV A;  3V8Z A;  3GOS A;  2V0I A;  1OCX A;  2P73 A;  2V0K A;  2IC7 A;  2PA4 A;  3ECT A;  2Z86 A;  3HSQ A;  4EEO A;  2X5S A;  3I0J A;  5ADX V;  2J0B A;  1R80 A;  1GQ9 A;  1V82 A;  1QRM A;  3TIS A;  1R7Y A;  3OU9 A;  3ZGG A;  3K8D A;  3SXC A;  4MND A;  2IUA A;  2RIY A;  4FRL A;  4NAI A;  5AJN A;  3JUK A;  4MFG A;  3I0F A;  1H5T A;  2JCJ A;  3V8Y A;  1TVY A;  4KNX A;  5CMG X;  4D0T A;  5CQP A;  2OEG A;  1LL2 A;  1KK5 A;  4N6A A;  1GX0 A;  1W55 A;  5JQQ A;  2FYB A;  1R7T A;  1ZHJ A;  1KK6 A;  3I0L A;  4KC4 A;  5C1L A;  4R36 A;  4KNR A;  2QKX A;  1INI A;  1SSQ A;  1T3D A;  5EJZ A;  2YQS A;  4FIX A;  2NPO A;  1SST A;  4Y6U A;  1XHD A;  1R7U A;  2Y4L A;  2XME A;  3N9W A;  4HO6 A;  4EVW A;  1FO8 A;  4G3Q A;  3SRT A;  5C3A A;  2RJ4 A;  3I0G A;  3OH2 A;  3VBK A;  3Q7U A;  3ST8 A;  2DPW A;  2O1H A;  3U0Y A;  5CMI A;  3R8Y A;  2PX7 A;  5L6S A;  2YQC A;  1FZW A;  5E3R A;  3OKR A;  2WLG A;  4HCQ A;  2FFV A;  4Q7C A;  2VXM A;  3OW5 A;  1ON8 A;  1LZ0 A;  3IOJ A;  4Y7T A;  1H4E A;  4AYL A;  2WVK A;  3FSC A;  5DG3 A;  1ZCV A;  3CKN A;  3I0K A;  2E3D A;  1Z90 A;  3PKP A;  3USQ A;  5FV9 A;  1ON6 A;  1PZT A;  3KWC A;  1YP2 A;  4ISX A;  3JQY A;  1MP4 A;  1XHB A;  4MYB A;  1MR9 A;  1G3L A;  2GGO A;  3KWE A;  1VGW A;  1KWS A;  2PGY A;  4G3P A;  3TDT A;  5DDV A;  4HO3 A;  1FOA A;  2ZU8 A;  1VZX A;  2FY7 A;  4HO9 A;  2FYC B;  3V0M A;  4FRO A;  1FG5 N;  3VBM A;  4B42 A;  1MRL A;  1GX4 A;  5CQO A;  1KHR A;  4FCU A;  3VNP A;  3OH4 A;  1G2V A;  1LL3 A;  4GBP A;  4LW3 A;  1INJ A;  1JV1 A;  3R5D A;  4E75 A;  2BO7 A;  2RJ0 A;  2O1F A;  3E25 A;  1SSM A;  4R7P A;  2RJ8 A;  4JD0 A;  1QGQ A;  3TZT A;  3IOI A;  4HUR A;  4NAL A;  3NGW A;  2RIJ A;  4M28 A;  1XZ6 A;  4EA8 A;  4HO2 A;  3OGZ A;  2JF3 A;  1ZJO A;  1VZU A;  2Y4J A;  3DUV A;  2VSH A;  2D0J A;  2Y6P A;  2QIV X;  5C4D A;  5CMJ A;  1WT1 A;  4EGG A;  4HO0 A;  3FOQ A;  3OH3 A;  3OAM A;  1EYR A;  4J18 A;  1FWY A;  4DCL A;  1S4P A;  4NAN A;  4KPZ A;  2VS5 A;  3RSB A;  1H4C A;  4B4G A;  1G93 A;  3D98 A;  3U2W A;  4EE3 A;  4MYO A;  3MC4 A;  4Y7U A;  2P2O A;  4E6T A;  2W0V A;  3CKO A;  1V84 A;  3QVB A;  3U2T A;  5FTS A;  4XWI A;  3JTJ A;  2FKO A;  3USR A;  4FRQ A;  1O0R A;  1V3W A;  1TZF A;  1VGT A;  2RJ7 A;  1MP5 A;  4EEA A;  1THJ A;  5C4F A;  1ZDF A;  4M2B A;  4FRA A;  3PNN A;  3SXE A;  1FR8 A;  1WSZ A;  3T7O A;  4Y64 A;  3KIA A;  1V67 A;  5I1F A;  1H7E A;  3V0O A;  3OC9 A;  3NZ2 A;  3ZGF A;  3V91 A;  3BXY A;  4CJC A;  1QRG A;  3V0N A;  4KRV A;  2WEE A;  2V0L A;  4CJ8 A;  1JVG A;  2AM5 A;  2AES A;  1G23 A;  3TIO A;  5FUH A;  1GWV A;  4IRQ A;  2XAT A;  2RIZ A;  1H7Q A;  4E79 A;  2X5Z A;  5D91 A;  2FYD B;  4EAA A;  1VGU A;  5U2K A;  3PKQ A;  1H7T A;  3U0X A;  4Y63 A;  1HJJ A;  2AM3 A;  3Q80 A;  3MQG A;  4MZU A;  3F1C A;  4FRM A;  1E5K A;  1LZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...