3R2WA

Crystal strucutre of udp-glucose pyrophosphorylase of homo sapiens
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
485
structure length
465
Chain Sequence
b'IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 465
sequence length 485
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r2wA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3r2wA01
5C4CA 5C4FA 4FRHA 3I0EA 2YQJA 2FYCB 3T57A 3DK5A 3SX7A 1R7UA 3I3AA 3ZGGA 3R2WA 2FYBA 5C49A 2AQ9A 4FRPA 5AJPA 3BCVA 5CQOA 4XWIA 3CU0A 4N69A 1O7OA 1R7YA 1JV3A 3V0MA 1XHDA 5DEPA 4ASJA 4FCEA 1TVYA 3DUVA 3N9WA 1ZI3A 2RJ9A 2XMHA 3EE5A 3IOHA 2JF3A 3U0YA 1NKHB 1QGSA 3KIAA 4KPXA 3I0GA 4R7PA 2YESA 3EEVA 2FYAA 3I0HA 5ADXV 2FY7A 3DJ4A 4LW6A 5CMGX 5AJOA 2PGYA 5IDSA 3F1YA 3SX3A 2VS4A 3BFPA 4ZDQA 5AFUU 1H7TA 4E79A 3FOQA 3MC4A 4Y6NA 1Z90A 3VBIA 1ZCUA 2P72A 2V0IA 3OUPA 4Y64A 2ZU8A 2RJ7A 3R5AA 3KWEA 5C1GA 1G97A 5CQLX 1ZCVA 2YCMA 2QKXA 1ZIZA 3PKPA 4ECMA 2D0JA 5IDTA 4UEGA 3SRTA 5C4DA 1LZJA 2FFUA 2AECA 5C1HA 1ZJ2A 3OW5A 5BXCA 5FV9A 4DCLA 3I0IX 3IXCA 3JTJA 4HZCA 5FU8A 3OH0A 1MC3A 2V0HA 1GX4A 4FREA 1XHBA 2XATA 2APCA 2DPWA 1GQ9A 1LVWA 4Y62A 3SXEA 3GOSA 4MYOA 1O23B 4M2AA 5C36A 1W77A 4Y9XA 2PA4A 1VH3A 1GX0A 3MQGA 1FOAA 4E6TA 3Q80A 4Y7TA 1V84A 4HURA 1VPAA 1KRVA 3USRA 4Y7GA 3KWDA 2Q4JA 2D7RA 2P6WA 2A8UA 1PZTA 3R8YA 1T3DA 4KT7A 5CQMX 1MRLA 2A8WA 5E3RA 4B4GA 5EJ1A 4KRVA 4AAWA 4Y63A 1MP5A 3PNNA 2VD4A 1LL0A 2JCLA 4CVHA 1GQCA 3V8ZA 4EAAA 3OH2A 3TDTA 4AA7A 4LW3A 5L6VA 4B5BA 4EEGA 2QH5A 3U2XA 1VGTA 4Y7FA 2BO8A 3U2VA 3U2WA 3K8EA 2QIAA 4HO6A 1FO8A 1KK6A 4NAIA 2IC7A 1IINA 3I3XA 4KPZA 1FRWA 3ZLKA 3V0OA 1W57A 1QREA 4HO2A 3BSWA 1G0RA 1G23A 1QRGA 2ICXA 1NWGB 2RJ8A 1MR7A 1QQ0A 1H5SD 4MZUA 5ADXU 1V3WA 1TW1A 4CJBA 1PZYB 4H7OA 3JUJA 5C4BA 5C3BA 3NGWA 3PMOA 4NANA 2RJ4A 3V0LA 1G93A 1ZJ1A 1LXAA 1H7LA 3BSYA 2AGDA 2VFZA 2AM4A 1WT2A 1H7HA 2WLEA 5C4EA 2WEEA 4HG6A 2WVKA 1H7EA 4BQHA 3E25A 4CJ8A 2OI7A 4M4KA 1EYRA 4HO5A 1VH1A 2JCJA 3VBKA 5C48A 3V91A 5DDTA 1FXJA 1H4DA 5JQQA 1TW5A 2RJ6A 1H7FA 2AM3A 3CKVA 4B3UA 1ZDFA 2RIJA 2XMEA 2WGZA 4KXOA 2BO6A 3RSBA 2XWNA 1HM8A 2W0WA 2Y4MA 3I0DA 5CQPA 1QG8A 4JD0A 5FTVA 1GA8A 3KWCA 1W55A 4EE5A 5CQNX 1QWJA 4HZDA 3I0KA 4KC2A 3R5CA 2IUAA 1VZXA 1H5TA 5CMJA 4M9CA 1S4PA 1HV9A 1XZ6A 1ON8A 1V83A 5C38A 2YQSA 4FRBA 1ZDGA 1EZIA 2JF2A 4ARWA 4KNXA 4Y7UA 5C3AA 3U0XA 3TQDA 5IFYA 3FSBA 3RMVA 2JCOA 4EEMA 3U2UA 3TWDA 1H5SB 2Y4JA 3T7OA 2OEFA 4R36A 5CMFX 4DECA 2W0VA 2QIVX 3VBMA 1G95A 1H5RA 1JVGA 3EH0A 3V0QA 2WVMA 1LZ0A 2AH9A 3I0JA 4EE3A 3V0NA 1JV1A 1LL3A 3BRKX 4DE7A 1ZCYA 5CMIA 4DDZA 1WT1A 2OI6A 3FSYA 1V82A 1S4NA 3NZ2A 3SX8A 2VXMA 2VS3A 2QGIA 1OCXA 4ISXA 3I0CA 1FWYA 2Z86A 2OEGA 2Y4LA 4BMAA 2Y6PA 4HCQA 2NPOA 4M98A 4MYBA 1NHEB 3RMWA 2Y4KA 3SPTA 4GBPA 1INIA 2XWMA 4HO3A 4AYLA 3TIOA 1WVCA 2O1GA 2IU8A 2O1FA 1NQIB 3SXBA 1I52A 3OTZA 1TDTA 3OAMA 3D98A 1ZCTA 1ON6A 3ZGFA 1H3MA 4EE4A 1KGTA 1ZJPA 1YP2A 3OH3A 3SXGA 4EQYA 3D5NA 3SXAA 5FYEA 5C1LA 1MP3A 4FQWA 1JYLA 4N27A 5EJZA 4IRQA 1G9RA 3T7NA 1H5SC 3SXCA 1FGXA 5E3PA 3BSSA 4JISA 2YQHA 2E8BA 4D11A 1KHRA 1QRMA 2WLFA 2RIXA 4YS8A 3FS8A 2CU2A 3USQA 1NF5B 2PX7A 4MFGA 4FCUA 5AFUV 1SSQA 3R1WA 1R7XA 4E75A 4C2SA 4IHGA 1FG5N 3V90A 4FRDA 1SSTA 3MQHA 2ZU7A 2V0JA 1V67A 1MP4A 1ZJ3A 2YC5A 1KK4A 1NMMB 3V4EA 1GWWA 2BO4A 2RIYA 1QRLA 2V0KA 4EA9A 3V0PA 2RJ5A 4EEAA 4K6RA 3TK8A 3DHOA 4IHHA 3QVBA 2D7IA 1FZWA 2WAWA 4FRAA 1XATA 3VBLA 2VHEA 3I0FA 4J18A 3SXDA 2MZBA 2WLGA 1VGZA 3R5BA 5FU0A 3VBPA 1G8OA 2X5SA 2XWLA 1FXOA 1ZJ0A 3GVDA 3Q1XA 3OH4A 2VSHA 4M28A 1O0RA 1IIMA 1INJA 3CKNA 1MR9A 2X65A 4AC3A 4E6UA 3P47A 1HJJA 1E5KA 3VBJA 3TV0A 1VGWA 3R3RA 2FFVA 3CKOA 4HO9A 2RJ1A 3IOJA 2I5EA 1R82A 3F1CA 1OMZA 3OGZA 1LL2A 2VS5A 1YROB 2AE7A 4NALA 5E3QA 3PKQA 2RITA 1GWVA 4KC4A 2WVLA 1LZ7A 3K8DA 2RIZA 4KQLA 1VZUA 1K4VA 1ZHJA 2V0LA 2E3DA 4AYJA 5C3DA 4EA8A 2Y7AA 3U2TA 1SSMA 5AJNA 2WE9A 3E26A 2JCKA 1FO9A 1OQMB 2P2OA 1VZTA 1WT0A 3ZLLA 4M99A 1KK5A 1R7VA 4HOCA 4Y6UA 3HSQA 1WSZA 2AESA 1H4CA 3IGJA 4FRQA 3HJJA 5DG3A 2VSIA 4MNDA 3JUKA 4D0TA 3JQYA 5J49A 4E1KA 4ASYA 3P1BA 2OI5A 4G3SA 2GGOA 1J2ZA 1KWSA 4D11C 2YQCA 2YC3A 2WLCA 1TZFA 2Z87A 3R3IA 4D0ZA 1G1LA 1R80A 3OKRA 4B4BA 4EVWA 1H5TB 4B4MA 2X5ZA 3VNPA 4EEOA 1THJA 1H7QA 4J09A 5FUHA 4Y7VA 2GGQA 5EIYA 2VXLA 4R37A 3O3PA 4FRMA 3BXYA 5CMHA 3TISA 1KQAA 3VBNA 5DDVA 3F1XA 3SX5A 1ZI1A 4B2WA 5U2KA 3GUEA 3ST8A 2P73A 5L6SA 4FROA 1O7QA 1QGQA 1ZJOA 2IU9A 2UX8A 3HL3A 1H5RB 1HM9A 1HJLA 2NXVA 2ICYA 1H4EA 1KRRA 4G87A 1ZI5A 4IHFA 1ZI4A 5I1FA 1JVDA 1VICA 1KGQA 3FWWA 3V8YA 4M2BA 3ECTA 3FSXA 4B2XA 4HUSA 4HO4A 4HO0A 1S80A 2AM5A 5DEMA 5HS2A 1G2VA 1FR8A 1FGGA 4EABA 1JYKA 4KC1A 3CKJA 3ZF8A 4B42A 1HM0A 2BO7A 1G3LA 5C8RA 4FRLA 4P00A 3D8VA 3EG4A 1YP3A 2I7BA 2ZU9A 3CKQA 5F42A 4HO8A 1FR9A 4G3PA 1OMXA 3R0SA 3OH1A 4G3QA 2X60A 1H7GA 4IRPA 3POLA 3TZTA 1VM8A 4EGGA 2TDTA 4CJCA 1KRUA 3Q7UA 5C47A 1R81A 3T7MA 4EA7A 2FKOA 1S4OA 4D48A 2WLDA 4N6AA 1QRFA 1YP4A 4N6BA 3LW6A 3OTMA 1SS9A 3Q4SA 3FSCA 3CJ8A 2FYDB 2RJ0A 3R5DA 3CGXA 1VGUA 1WT3A 3IOIA 1H5SA 2I5KA 4KNRA 1LZIA 4L41C 2O1HA 1R7TA 2PGVA 3C8VA 3I0LA 4P02A 5FTSA 3OC9A 3OU9A 4NAKA 3FTTA
chains in the Genus database with same CATH superfamily
5C4CA 5C4FA 4FRHA 3I0EA 2YQJA 2FYCB 3T57A 3DK5A 3SX7A 1R7UA 3I3AA 3ZGGA 3R2WA 2FYBA 5C49A 2AQ9A 4FRPA 5AJPA 3BCVA 5CQOA 4XWIA 4MIXA 3CU0A 4N69A 1O7OA 1R7YA 1JV3A 3V0MA 1XHDA 5DEPA 1M8NA 4ASJA 4FCEA 1TVYA 3DUVA 3N9WA 1ZI3A 2RJ9A 2XMHA 3EE5A 3IOHA 2JF3A 3U0YA 1NKHB 1QGSA 3KIAA 4KPXA 3I0GA 4R7PA 2YESA 3EEVA 2FYAA 3I0HA 5ADXV 2FY7A 3DJ4A 4LW6A 5CMGX 5AJOA 2PGYA 5IDSA 3F1YA 3SX3A 2VS4A 3BFPA 4ZDQA 5AFUU 1H7TA 4E79A 2VK9A 3FOQA 3MC4A 4Y6NA 1Z90A 3VBIA 1ZCUA 2P72A 2V0IA 3OUPA 4Y64A 2ZU8A 2RJ7A 3R5AA 3KWEA 5C1GA 1G97A 5CQLX 1ZCVA 2YCMA 2QKXA 1ZIZA 3PKPA 4ECMA 2D0JA 5IDTA 4UEGA 3SRTA 5C4DA 1LZJA 2FFUA 2AECA 5C1HA 3GQAA 1ZJ2A 3OW5A 5BXCA 5FV9A 4DCLA 3I0IX 3IXCA 3JTJA 4HZCA 5FU8A 3OH0A 1MC3A 5D91A 2V0HA 1GX4A 4FREA 1XHBA 2XATA 2APCA 4Q7CA 2DPWA 1GQ9A 1LVWA 4Y62A 3SXEA 3GOSA 3GQ8A 4MYOA 1O23B 4M2AA 5C36A 1W77A 4Y9XA 2PA4A 1VH3A 1GX0A 3MQGA 1FOAA 4E6TA 3Q80A 4Y7TA 1V84A 4HURA 1VPAA 1KRVA 3USRA 4Y7GA 3KWDA 2Q4JA 2D7RA 2P6WA 2A8UA 1PZTA 3R8YA 1T3DA 4KT7A 5CQMX 1MRLA 2A8WA 5E3RA 4B4GA 5EJ1A 4KRVA 4AAWA 4Y63A 1MP5A 3PNNA 2VD4A 1LL0A 2JCLA 4CVHA 1GQCA 3V8ZA 4EAAA 3OH2A 3TDTA 4AA7A 4LW3A 5L6VA 4B5BA 4EEGA 2QH5A 3U2XA 1VGTA 4Y7FA 2BO8A 3U2VA 3U2WA 3K8EA 2QIAA 4HO6A 1FO8A 1KK6A 4NAIA 2IC7A 1IINA 3I3XA 4KPZA 1FRWA 3ZLKA 3V0OA 1W57A 1QREA 4HO2A 3BSWA 1G0RA 1G23A 1QRGA 2ICXA 1NWGB 2RJ8A 1MR7A 1QQ0A 1H5SD 4MZUA 5ADXU 1V3WA 1TW1A 4CJBA 1PZYB 4H7OA 3JUJA 5C4BA 5C3BA 3NGWA 3PMOA 4NANA 3GQ9A 2RJ4A 3V0LA 1G93A 1ZJ1A 1LXAA 1H7LA 3BSYA 2AGDA 1L0SA 2VFZA 2AM4A 1WT2A 1H7HA 2WLEA 5C4EA 2WEEA 4HG6A 2WVKA 1H7EA 4BQHA 3E25A 4CJ8A 2OI7A 4M4KA 1EYRA 4HO5A 1VH1A 2JCJA 3VBKA 5C48A 3V91A 5DDTA 1FXJA 1H4DA 5JQQA 1TW5A 1Z2FA 2RJ6A 1H7FA 2AM3A 3CKVA 4B3UA 1ZDFA 2RIJA 2XMEA 2WGZA 4KXOA 2BO6A 3RSBA 2XWNA 1HM8A 2W0WA 2Y4MA 3I0DA 5CQPA 1QG8A 4JD0A 5FTVA 1GA8A 3KWCA 1W55A 4EE5A 5CQNX 1QWJA 4HZDA 3I0KA 4KC2A 3R5CA 2IUAA 1VZXA 1H5TA 5CMJA 4M9CA 1S4PA 1HV9A 1XZ6A 1ON8A 2J0AA 1V83A 5C38A 2YQSA 4FRBA 1ZDGA 1EZIA 2JF2A 4ARWA 4KNXA 4Y7UA 5C3AA 3U0XA 3TQDA 5IFYA 3FSBA 3RMVA 2JCOA 4EEMA 3U2UA 3TWDA 1H5SB 2Y4JA 3T7OA 2OEFA 4R36A 5CMFX 4DECA 2W0VA 2QIVX 3VBMA 1G95A 1H5RA 1JVGA 3EH0A 3V0QA 2WVMA 1LZ0A 2AH9A 3I0JA 4EE3A 3V0NA 1JV1A 1LL3A 3BRKX 4DE7A 1ZCYA 5CMIA 4DDZA 1WT1A 2OI6A 3FSYA 1V82A 1S4NA 3NZ2A 3SX8A 2VXMA 2VS3A 2QGIA 1OCXA 4ISXA 3I0CA 1FWYA 2Z86A 2OEGA 2Y4LA 4BMAA 2Y6PA 4HCQA 2NPOA 4M98A 4MYBA 1NHEB 3RMWA 2Y4KA 3SPTA 4GBPA 1INIA 2XWMA 4HO3A 4AYLA 3TIOA 1WVCA 2O1GA 2IU8A 2O1FA 1NQIB 3SXBA 1I52A 3OTZA 1TDTA 3OAMA 3D98A 1ZCTA 1ON6A 3ZGFA 1H3MA 4EE4A 1KGTA 1ZJPA 1YP2A 3GQ7A 3OH3A 3SXGA 4EQYA 3D5NA 3SXAA 5FYEA 5C1LA 1MP3A 4FQWA 1JYLA 4N27A 5EJZA 4IRQA 1G9RA 3T7NA 1H5SC 3SXCA 1FGXA 5E3PA 3BSSA 4JISA 2YQHA 2E8BA 4D11A 1KHRA 1QRMA 2WLFA 2RIXA 4YS8A 3FS8A 2CU2A 3USQA 1NF5B 2PX7A 4MFGA 4FCUA 5AFUV 1SSQA 3R1WA 1R7XA 4E75A 4C2SA 4IHGA 1FG5N 3V90A 4FRDA 1SSTA 3MQHA 2ZU7A 2V0JA 1V67A 1MP4A 1ZJ3A 2YC5A 1KK4A 1NMMB 3V4EA 1GWWA 2BO4A 2RIYA 1QRLA 2V0KA 4EA9A 3V0PA 2RJ5A 4EEAA 4K6RA 3TK8A 3DHOA 4IHHA 3QVBA 2D7IA 1FZWA 2WAWA 4FRAA 1XATA 3VBLA 2VHEA 3I0FA 4J18A 3SXDA 2MZBA 2WLGA 1VGZA 3R5BA 5FU0A 3VBPA 1G8OA 2X5SA 4FIXA 2XWLA 1FXOA 1ZJ0A 3GVDA 3Q1XA 3OH4A 2VSHA 4M28A 1O0RA 1IIMA 1INJA 3CKNA 1MR9A 2X65A 4AC3A 4E6UA 3P47A 1HJJA 1E5KA 3VBJA 3TV0A 1VGWA 3R3RA 2FFVA 3CKOA 4HO9A 2RJ1A 3IOJA 2I5EA 1R82A 3F1CA 1OMZA 3OGZA 1LL2A 2VS5A 1YROB 2AE7A 2C0NA 4NALA 5E3QA 4O6NA 3PKQA 2RITA 1GWVA 4KC4A 2WVLA 1LZ7A 3K8DA 2RIZA 4KQLA 1VZUA 1K4VA 1ZHJA 2V0LA 2E3DA 4AYJA 5C3DA 4EA8A 2Y7AA 3U2TA 1SSMA 5AJNA 2WE9A 3E26A 2JCKA 1FO9A 1OQMB 2P2OA 1VZTA 1WT0A 3ZLLA 4M99A 1KK5A 1R7VA 4HOCA 4Y6UA 3HSQA 1WSZA 2AESA 1H4CA 3IGJA 4FRQA 3HJJA 5DG3A 2VSIA 4MNDA 3JUKA 4D0TA 3JQYA 5J49A 4E1KA 4ASYA 3P1BA 2OI5A 4G3SA 2GGOA 1J2ZA 1KWSA 4D11C 2YQCA 2YC3A 2WLCA 1TZFA 2Z87A 3R3IA 4D0ZA 1G1LA 1R80A 3OKRA 4B4BA 4EVWA 1H5TB 4B4MA 2X5ZA 3VNPA 4EEOA 1THJA 1H7QA 4J09A 5FUHA 4Y7VA 2GGQA 5EIYA 2VXLA 4R37A 3O3PA 4FRMA 3BXYA 5CMHA 3TISA 1KQAA 3VBNA 5DDVA 3F1XA 3SX5A 1ZI1A 4B2WA 5U2KA 3GUEA 1N4IA 3SUCA 3ST8A 2P73A 5L6SA 4FROA 1O7QA 1QGQA 1ZJOA 2IU9A 2UX8A 3HL3A 1H5RB 1HM9A 1HJLA 2NXVA 2ICYA 1H4EA 1KRRA 4G87A 1ZI5A 4IHFA 1EWWA 1ZI4A 5I1FA 1JVDA 1VICA 1KGQA 3FWWA 3V8YA 4M2BA 3ECTA 3FSXA 4B2XA 4HUSA 4HO4A 4HO0A 1S80A 2AM5A 5DEMA 5HS2A 1G2VA 1FR8A 1FGGA 4EABA 1JYKA 4KC1A 3CKJA 3ZF8A 4B42A 4FIYA 1HM0A 2BO7A 1G3LA 5C8RA 4FRLA 4P00A 3D8VA 3EG4A 1YP3A 2I7BA 2ZU9A 3CKQA 5F42A 4HO8A 1FR9A 4O6MA 4G3PA 1OMXA 3OH1A 3R0SA 4G3QA 2X60A 1H7GA 4IRPA 3POLA 3TZTA 1VM8A 4EGGA 2TDTA 4CJCA 1KRUA 3Q7UA 5C47A 1R81A 3T7MA 4EA7A 2FKOA 1S4OA 4D48A 2WLDA 4N6AA 5D92A 1QRFA 1YP4A 4N6BA 2J0BA 3OTMA 1SS9A 3LW6A 3Q4SA 3FSCA 3CJ8A 2FYDB 2RJ0A 3R5DA 3CGXA 1VGUA 1WT3A 3IOIA 1H5SA 2I5KA 4KNRA 1LZIA 4L41C 2O1HA 1R7TA 2PGVA 3C8VA 3I0LA 4P02A 5FTSA 3OC9A 3OU9A 4NAKA 3FTTA
chains in the Genus database with same CATH topology
5C4CA 5C4FA 4FRHA 3I0EA 2YQJA 2FYCB 3T57A 3DK5A 3SX7A 1R7UA 3I3AA 3ZGGA 3R2WA 2FYBA 5C49A 2AQ9A 4FRPA 5AJPA 3BCVA 5CQOA 4XWIA 4MIXA 3CU0A 4N69A 1O7OA 1R7YA 1JV3A 3V0MA 1XHDA 5DEPA 4ASJA 4FCEA 1TVYA 3DUVA 3N9WA 1ZI3A 2RJ9A 2XMHA 3EE5A 3IOHA 2JF3A 3U0YA 1NKHB 1QGSA 3KIAA 4KPXA 3I0GA 4R7PA 2YESA 3EEVA 2FYAA 3I0HA 5ADXV 2FY7A 3DJ4A 4LW6A 5CMGX 5AJOA 2PGYA 5IDSA 3F1YA 3SX3A 2VS4A 3BFPA 4ZDQA 5AFUU 1H7TA 4E79A 2VK9A 3FOQA 3MC4A 4Y6NA 1Z90A 3VBIA 1ZCUA 2P72A 2V0IA 3OUPA 4Y64A 2ZU8A 2RJ7A 3R5AA 3KWEA 5C1GA 1G97A 5CQLX 1ZCVA 2YCMA 2QKXA 1ZIZA 3PKPA 4ECMA 2D0JA 5IDTA 4UEGA 3SRTA 5C4DA 1LZJA 2FFUA 2AECA 5C1HA 1ZJ2A 3OW5A 5BXCA 5FV9A 4DCLA 3I0IX 3IXCA 3JTJA 4HZCA 5FU8A 3OH0A 1MC3A 5D91A 2V0HA 1GX4A 4FREA 1XHBA 2XATA 2APCA 4Q7CA 2DPWA 1GQ9A 1LVWA 4Y62A 3SXEA 3GOSA 4MYOA 1O23B 4M2AA 5C36A 1W77A 4Y9XA 2PA4A 1VH3A 1GX0A 3MQGA 1FOAA 4E6TA 3Q80A 4Y7TA 1V84A 4HURA 1VPAA 1KRVA 3USRA 4Y7GA 3KWDA 2Q4JA 2D7RA 2P6WA 2A8UA 1PZTA 3R8YA 1T3DA 4KT7A 5CQMX 1MRLA 2A8WA 5E3RA 4B4GA 5EJ1A 4KRVA 4AAWA 4Y63A 1MP5A 3PNNA 2VD4A 1LL0A 2JCLA 4CVHA 1GQCA 3V8ZA 4EAAA 3OH2A 3TDTA 4AA7A 4LW3A 5L6VA 4B5BA 4EEGA 2QH5A 3U2XA 1VGTA 4Y7FA 2BO8A 3U2VA 3U2WA 3K8EA 2QIAA 4HO6A 1FO8A 1KK6A 4NAIA 2IC7A 1IINA 3I3XA 4KPZA 1FRWA 3ZLKA 3V0OA 1W57A 1QREA 4HO2A 3BSWA 1G0RA 1G23A 1QRGA 2ICXA 1NWGB 2RJ8A 1MR7A 1QQ0A 1H5SD 4MZUA 5ADXU 1V3WA 1TW1A 4CJBA 1PZYB 4H7OA 3JUJA 5C4BA 5C3BA 3NGWA 3PMOA 4NANA 2RJ4A 3V0LA 1G93A 1ZJ1A 1LXAA 1H7LA 3BSYA 2AGDA 2VFZA 2AM4A 1WT2A 1H7HA 2WLEA 5C4EA 2WEEA 4HG6A 2WVKA 1H7EA 4BQHA 3E25A 4CJ8A 2OI7A 4M4KA 1EYRA 4HO5A 1VH1A 2JCJA 3VBKA 5C48A 3V91A 5DDTA 1FXJA 1H4DA 5JQQA 1TW5A 2RJ6A 1H7FA 2AM3A 3CKVA 4B3UA 1ZDFA 2RIJA 2XMEA 2WGZA 4KXOA 2BO6A 3RSBA 2XWNA 1HM8A 2W0WA 2Y4MA 3I0DA 5CQPA 1QG8A 4JD0A 5FTVA 1GA8A 3KWCA 1W55A 4EE5A 5CQNX 1QWJA 4HZDA 3I0KA 4KC2A 3R5CA 2IUAA 1VZXA 1H5TA 5CMJA 4M9CA 1S4PA 1HV9A 1XZ6A 1ON8A 2J0AA 1V83A 5C38A 2YQSA 4FRBA 1ZDGA 1EZIA 2JF2A 4ARWA 4KNXA 4Y7UA 5C3AA 3U0XA 3TQDA 5IFYA 3FSBA 3RMVA 2JCOA 4EEMA 3U2UA 3TWDA 1H5SB 2Y4JA 3T7OA 2OEFA 4R36A 5CMFX 4DECA 2W0VA 2QIVX 3VBMA 1G95A 1H5RA 1JVGA 3EH0A 3V0QA 2WVMA 1LZ0A 2AH9A 3I0JA 4EE3A 3V0NA 1JV1A 1LL3A 3BRKX 4DE7A 1ZCYA 5CMIA 4DDZA 1WT1A 2OI6A 3FSYA 1V82A 1S4NA 3NZ2A 3SX8A 2VXMA 2VS3A 2QGIA 1OCXA 4ISXA 3I0CA 1FWYA 2Z86A 2OEGA 2Y4LA 4BMAA 2Y6PA 4HCQA 2NPOA 4M98A 4MYBA 1NHEB 3RMWA 2Y4KA 3SPTA 4GBPA 1INIA 2XWMA 4HO3A 4AYLA 3TIOA 1WVCA 2O1GA 2IU8A 2O1FA 1NQIB 3SXBA 1I52A 3OTZA 1TDTA 3OAMA 3D98A 1ZCTA 1ON6A 3ZGFA 1H3MA 4EE4A 1KGTA 1ZJPA 1YP2A 3OH3A 3SXGA 4EQYA 3D5NA 3SXAA 5FYEA 5C1LA 1MP3A 4FQWA 1JYLA 4N27A 5EJZA 4IRQA 1G9RA 3T7NA 1H5SC 3SXCA 1FGXA 5E3PA 3BSSA 4JISA 2YQHA 2E8BA 4D11A 1KHRA 1QRMA 2WLFA 2RIXA 4YS8A 3FS8A 2CU2A 3USQA 1NF5B 2PX7A 4MFGA 4FCUA 5AFUV 1SSQA 3R1WA 1R7XA 4E75A 4C2SA 4IHGA 1FG5N 3V90A 4FRDA 1SSTA 3MQHA 2ZU7A 2V0JA 1V67A 1MP4A 1ZJ3A 2YC5A 1KK4A 1NMMB 3V4EA 1GWWA 2BO4A 2RIYA 1QRLA 2V0KA 4EA9A 3V0PA 2RJ5A 4EEAA 4K6RA 3TK8A 3DHOA 4IHHA 3QVBA 2D7IA 1FZWA 2WAWA 4FRAA 1XATA 3VBLA 2VHEA 3I0FA 4J18A 3SXDA 2MZBA 2WLGA 1VGZA 3R5BA 5FU0A 3VBPA 1G8OA 2X5SA 4FIXA 2XWLA 1FXOA 1ZJ0A 3GVDA 3Q1XA 3OH4A 2VSHA 4M28A 1O0RA 1IIMA 1INJA 3CKNA 1MR9A 2X65A 4AC3A 4E6UA 3P47A 1HJJA 1E5KA 3VBJA 3TV0A 1VGWA 3R3RA 2FFVA 3CKOA 4HO9A 2RJ1A 3IOJA 2I5EA 1R82A 3F1CA 1OMZA 3OGZA 1LL2A 2VS5A 1YROB 2AE7A 2C0NA 4NALA 5E3QA 4O6NA 3PKQA 2RITA 1GWVA 4KC4A 2WVLA 1LZ7A 3K8DA 2RIZA 4KQLA 1VZUA 1K4VA 1ZHJA 2V0LA 2E3DA 4AYJA 5C3DA 4EA8A 2Y7AA 3U2TA 1SSMA 5AJNA 2WE9A 3E26A 2JCKA 1FO9A 1OQMB 2P2OA 1VZTA 1WT0A 3ZLLA 4M99A 1KK5A 1R7VA 4HOCA 4Y6UA 3HSQA 1WSZA 2AESA 1H4CA 3IGJA 4FRQA 3HJJA 5DG3A 2VSIA 4MNDA 3JUKA 4D0TA 3JQYA 5J49A 4E1KA 4ASYA 3P1BA 2OI5A 4G3SA 2GGOA 1J2ZA 1KWSA 4D11C 2YQCA 2YC3A 2WLCA 1TZFA 2Z87A 3R3IA 4D0ZA 1G1LA 1R80A 3OKRA 4B4BA 4EVWA 1H5TB 4B4MA 2X5ZA 3VNPA 4EEOA 1THJA 1H7QA 4J09A 5FUHA 4Y7VA 2GGQA 5EIYA 2VXLA 4R37A 3O3PA 4FRMA 3BXYA 5CMHA 3TISA 1KQAA 3VBNA 5DDVA 3F1XA 3SX5A 1ZI1A 4B2WA 5U2KA 3GUEA 3ST8A 2P73A 5L6SA 4FROA 1O7QA 1QGQA 1ZJOA 2IU9A 2UX8A 3HL3A 1H5RB 1HM9A 1HJLA 2NXVA 2ICYA 1H4EA 1KRRA 4G87A 1ZI5A 4IHFA 1ZI4A 5I1FA 1JVDA 1VICA 1KGQA 3FWWA 3V8YA 4M2BA 3ECTA 3FSXA 4B2XA 4HUSA 4HO4A 4HO0A 1S80A 2AM5A 5DEMA 5HS2A 1G2VA 1FR8A 1FGGA 4EABA 1JYKA 4KC1A 3CKJA 3ZF8A 4B42A 4FIYA 1HM0A 2BO7A 1G3LA 5C8RA 4FRLA 4P00A 3D8VA 3EG4A 1YP3A 2I7BA 2ZU9A 3CKQA 5F42A 4HO8A 1FR9A 4O6MA 4G3PA 1OMXA 3R0SA 3OH1A 4G3QA 2X60A 1H7GA 4IRPA 3POLA 3TZTA 1VM8A 4EGGA 2TDTA 4CJCA 1KRUA 3Q7UA 5C47A 1R81A 3T7MA 4EA7A 2FKOA 1S4OA 4D48A 2WLDA 4N6AA 5D92A 1QRFA 1YP4A 4N6BA 2J0BA 3OTMA 1SS9A 3LW6A 3Q4SA 3FSCA 3CJ8A 2FYDB 2RJ0A 3R5DA 3CGXA 1VGUA 1WT3A 3IOIA 1H5SA 2I5KA 4KNRA 1LZIA 4L41C 2O1HA 1R7TA 2PGVA 3C8VA 3I0LA 4P02A 5FTSA 3OC9A 3OU9A 4NAKA 3FTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4C A;  5C4F A;  4FRH A;  3I0E A;  2YQJ A;  2FYC B;  3T57 A;  3DK5 A;  3SX7 A;  1R7U A;  3I3A A;  3ZGG A;  3R2W A;  2FYB A;  5C49 A;  2AQ9 A;  4FRP A;  5AJP A;  3BCV A;  5CQO A;  4XWI A;  3CU0 A;  4N69 A;  1O7O A;  1R7Y A;  1JV3 A;  3V0M A;  1XHD A;  5DEP A;  4ASJ A;  4FCE A;  1TVY A;  3DUV A;  3N9W A;  1ZI3 A;  2RJ9 A;  2XMH A;  3EE5 A;  3IOH A;  2JF3 A;  3U0Y A;  1NKH B;  1QGS A;  3KIA A;  4KPX A;  3I0G A;  4R7P A;  2YES A;  3EEV A;  2FYA A;  3I0H A;  5ADX V;  2FY7 A;  3DJ4 A;  4LW6 A;  5CMG X;  5AJO A;  2PGY A;  5IDS A;  3F1Y A;  3SX3 A;  2VS4 A;  3BFP A;  4ZDQ A;  5AFU U;  1H7T A;  4E79 A;  3FOQ A;  3MC4 A;  4Y6N A;  1Z90 A;  3VBI A;  1ZCU A;  2P72 A;  2V0I A;  3OUP A;  4Y64 A;  2ZU8 A;  2RJ7 A;  3R5A A;  3KWE A;  5C1G A;  1G97 A;  5CQL X;  1ZCV A;  2YCM A;  2QKX A;  1ZIZ A;  3PKP A;  4ECM A;  2D0J A;  5IDT A;  4UEG A;  3SRT A;  5C4D A;  1LZJ A;  2FFU A;  2AEC A;  5C1H A;  1ZJ2 A;  3OW5 A;  5BXC A;  5FV9 A;  4DCL A;  3I0I X;  3IXC A;  3JTJ A;  4HZC A;  5FU8 A;  3OH0 A;  1MC3 A;  2V0H A;  1GX4 A;  4FRE A;  1XHB A;  2XAT A;  2APC A;  2DPW A;  1GQ9 A;  1LVW A;  4Y62 A;  3SXE A;  3GOS A;  4MYO A;  1O23 B;  4M2A A;  5C36 A;  1W77 A;  4Y9X A;  2PA4 A;  1VH3 A;  1GX0 A;  3MQG A;  1FOA A;  4E6T A;  3Q80 A;  4Y7T A;  1V84 A;  4HUR A;  1VPA A;  1KRV A;  3USR A;  4Y7G A;  3KWD A;  2Q4J A;  2D7R A;  2P6W A;  2A8U A;  1PZT A;  3R8Y A;  1T3D A;  4KT7 A;  5CQM X;  1MRL A;  2A8W A;  5E3R A;  4B4G A;  5EJ1 A;  4KRV A;  4AAW A;  4Y63 A;  1MP5 A;  3PNN A;  2VD4 A;  1LL0 A;  2JCL A;  4CVH A;  1GQC A;  3V8Z A;  4EAA A;  3OH2 A;  3TDT A;  4AA7 A;  4LW3 A;  5L6V A;  4B5B A;  4EEG A;  2QH5 A;  3U2X A;  1VGT A;  4Y7F A;  2BO8 A;  3U2V A;  3U2W A;  3K8E A;  2QIA A;  4HO6 A;  1FO8 A;  1KK6 A;  4NAI A;  2IC7 A;  1IIN A;  3I3X A;  4KPZ A;  1FRW A;  3ZLK A;  3V0O A;  1W57 A;  1QRE A;  4HO2 A;  3BSW A;  1G0R A;  1G23 A;  1QRG A;  2ICX A;  1NWG B;  2RJ8 A;  1MR7 A;  1QQ0 A;  1H5S D;  4MZU A;  5ADX U;  1V3W A;  1TW1 A;  4CJB A;  1PZY B;  4H7O A;  3JUJ A;  5C4B A;  5C3B A;  3NGW A;  3PMO A;  4NAN A;  2RJ4 A;  3V0L A;  1G93 A;  1ZJ1 A;  1LXA A;  1H7L A;  3BSY A;  2AGD A;  2VFZ A;  2AM4 A;  1WT2 A;  1H7H A;  2WLE A;  5C4E A;  2WEE A;  4HG6 A;  2WVK A;  1H7E A;  4BQH A;  3E25 A;  4CJ8 A;  2OI7 A;  4M4K A;  1EYR A;  4HO5 A;  1VH1 A;  2JCJ A;  3VBK A;  5C48 A;  3V91 A;  5DDT A;  1FXJ A;  1H4D A;  5JQQ A;  1TW5 A;  2RJ6 A;  1H7F A;  2AM3 A;  3CKV A;  4B3U A;  1ZDF A;  2RIJ A;  2XME A;  2WGZ A;  4KXO A;  2BO6 A;  3RSB A;  2XWN A;  1HM8 A;  2W0W A;  2Y4M A;  3I0D A;  5CQP A;  1QG8 A;  4JD0 A;  5FTV A;  1GA8 A;  3KWC A;  1W55 A;  4EE5 A;  5CQN X;  1QWJ A;  4HZD A;  3I0K A;  4KC2 A;  3R5C A;  2IUA A;  1VZX A;  1H5T A;  5CMJ A;  4M9C A;  1S4P A;  1HV9 A;  1XZ6 A;  1ON8 A;  1V83 A;  5C38 A;  2YQS A;  4FRB A;  1ZDG A;  1EZI A;  2JF2 A;  4ARW A;  4KNX A;  4Y7U A;  5C3A A;  3U0X A;  3TQD A;  5IFY A;  3FSB A;  3RMV A;  2JCO A;  4EEM A;  3U2U A;  3TWD A;  1H5S B;  2Y4J A;  3T7O A;  2OEF A;  4R36 A;  5CMF X;  4DEC A;  2W0V A;  2QIV X;  3VBM A;  1G95 A;  1H5R A;  1JVG A;  3EH0 A;  3V0Q A;  2WVM A;  1LZ0 A;  2AH9 A;  3I0J A;  4EE3 A;  3V0N A;  1JV1 A;  1LL3 A;  3BRK X;  4DE7 A;  1ZCY A;  5CMI A;  4DDZ A;  1WT1 A;  2OI6 A;  3FSY A;  1V82 A;  1S4N A;  3NZ2 A;  3SX8 A;  2VXM A;  2VS3 A;  2QGI A;  1OCX A;  4ISX A;  3I0C A;  1FWY A;  2Z86 A;  2OEG A;  2Y4L A;  4BMA A;  2Y6P A;  4HCQ A;  2NPO A;  4M98 A;  4MYB A;  1NHE B;  3RMW A;  2Y4K A;  3SPT A;  4GBP A;  1INI A;  2XWM A;  4HO3 A;  4AYL A;  3TIO A;  1WVC A;  2O1G A;  2IU8 A;  2O1F A;  1NQI B;  3SXB A;  1I52 A;  3OTZ A;  1TDT A;  3OAM A;  3D98 A;  1ZCT A;  1ON6 A;  3ZGF A;  1H3M A;  4EE4 A;  1KGT A;  1ZJP A;  1YP2 A;  3OH3 A;  3SXG A;  4EQY A;  3D5N A;  3SXA A;  5FYE A;  5C1L A;  1MP3 A;  4FQW A;  1JYL A;  4N27 A;  5EJZ A;  4IRQ A;  1G9R A;  3T7N A;  1H5S C;  3SXC A;  1FGX A;  5E3P A;  3BSS A;  4JIS A;  2YQH A;  2E8B A;  4D11 A;  1KHR A;  1QRM A;  2WLF A;  2RIX A;  4YS8 A;  3FS8 A;  2CU2 A;  3USQ A;  1NF5 B;  2PX7 A;  4MFG A;  4FCU A;  5AFU V;  1SSQ A;  3R1W A;  1R7X A;  4E75 A;  4C2S A;  4IHG A;  1FG5 N;  3V90 A;  4FRD A;  1SST A;  3MQH A;  2ZU7 A;  2V0J A;  1V67 A;  1MP4 A;  1ZJ3 A;  2YC5 A;  1KK4 A;  1NMM B;  3V4E A;  1GWW A;  2BO4 A;  2RIY A;  1QRL A;  2V0K A;  4EA9 A;  3V0P A;  2RJ5 A;  4EEA A;  4K6R A;  3TK8 A;  3DHO A;  4IHH A;  3QVB A;  2D7I A;  1FZW A;  2WAW A;  4FRA A;  1XAT A;  3VBL A;  2VHE A;  3I0F A;  4J18 A;  3SXD A;  2MZB A;  2WLG A;  1VGZ A;  3R5B A;  5FU0 A;  3VBP A;  1G8O A;  2X5S A;  2XWL A;  1FXO A;  1ZJ0 A;  3GVD A;  3Q1X A;  3OH4 A;  2VSH A;  4M28 A;  1O0R A;  1IIM A;  1INJ A;  3CKN A;  1MR9 A;  2X65 A;  4AC3 A;  4E6U A;  3P47 A;  1HJJ A;  1E5K A;  3VBJ A;  3TV0 A;  1VGW A;  3R3R A;  2FFV A;  3CKO A;  4HO9 A;  2RJ1 A;  3IOJ A;  2I5E A;  1R82 A;  3F1C A;  1OMZ A;  3OGZ A;  1LL2 A;  2VS5 A;  1YRO B;  2AE7 A;  4NAL A;  5E3Q A;  3PKQ A;  2RIT A;  1GWV A;  4KC4 A;  2WVL A;  1LZ7 A;  3K8D A;  2RIZ A;  4KQL A;  1VZU A;  1K4V A;  1ZHJ A;  2V0L A;  2E3D A;  4AYJ A;  5C3D A;  4EA8 A;  2Y7A A;  3U2T A;  1SSM A;  5AJN A;  2WE9 A;  3E26 A;  2JCK A;  1FO9 A;  1OQM B;  2P2O A;  1VZT A;  1WT0 A;  3ZLL A;  4M99 A;  1KK5 A;  1R7V A;  4HOC A;  4Y6U A;  3HSQ A;  1WSZ A;  2AES A;  1H4C A;  3IGJ A;  4FRQ A;  3HJJ A;  5DG3 A;  2VSI A;  4MND A;  3JUK A;  4D0T A;  3JQY A;  5J49 A;  4E1K A;  4ASY A;  3P1B A;  2OI5 A;  4G3S A;  2GGO A;  1J2Z A;  1KWS A;  4D11 C;  2YQC A;  2YC3 A;  2WLC A;  1TZF A;  2Z87 A;  3R3I A;  4D0Z A;  1G1L A;  1R80 A;  3OKR A;  4B4B A;  4EVW A;  1H5T B;  4B4M A;  2X5Z A;  3VNP A;  4EEO A;  1THJ A;  1H7Q A;  4J09 A;  5FUH A;  4Y7V A;  2GGQ A;  5EIY A;  2VXL A;  4R37 A;  3O3P A;  4FRM A;  3BXY A;  5CMH A;  3TIS A;  1KQA A;  3VBN A;  5DDV A;  3F1X A;  3SX5 A;  1ZI1 A;  4B2W A;  5U2K A;  3GUE A;  3ST8 A;  2P73 A;  5L6S A;  4FRO A;  1O7Q A;  1QGQ A;  1ZJO A;  2IU9 A;  2UX8 A;  3HL3 A;  1H5R B;  1HM9 A;  1HJL A;  2NXV A;  2ICY A;  1H4E A;  1KRR A;  4G87 A;  1ZI5 A;  4IHF A;  1ZI4 A;  5I1F A;  1JVD A;  1VIC A;  1KGQ A;  3FWW A;  3V8Y A;  4M2B A;  3ECT A;  3FSX A;  4B2X A;  4HUS A;  4HO4 A;  4HO0 A;  1S80 A;  2AM5 A;  5DEM A;  5HS2 A;  1G2V A;  1FR8 A;  1FGG A;  4EAB A;  1JYK A;  4KC1 A;  3CKJ A;  3ZF8 A;  4B42 A;  1HM0 A;  2BO7 A;  1G3L A;  5C8R A;  4FRL A;  4P00 A;  3D8V A;  3EG4 A;  1YP3 A;  2I7B A;  2ZU9 A;  3CKQ A;  5F42 A;  4HO8 A;  1FR9 A;  4G3P A;  1OMX A;  3R0S A;  3OH1 A;  4G3Q A;  2X60 A;  1H7G A;  4IRP A;  3POL A;  3TZT A;  1VM8 A;  4EGG A;  2TDT A;  4CJC A;  1KRU A;  3Q7U A;  5C47 A;  1R81 A;  3T7M A;  4EA7 A;  2FKO A;  1S4O A;  4D48 A;  2WLD A;  4N6A A;  1QRF A;  1YP4 A;  4N6B A;  3LW6 A;  3OTM A;  1SS9 A;  3Q4S A;  3FSC A;  3CJ8 A;  2FYD B;  2RJ0 A;  3R5D A;  3CGX A;  1VGU A;  1WT3 A;  3IOI A;  1H5S A;  2I5K A;  4KNR A;  1LZI A;  4L41 C;  2O1H A;  1R7T A;  2PGV A;  3C8V A;  3I0L A;  4P02 A;  5FTS A;  3OC9 A;  3OU9 A;  4NAK A;  3FTT A; 
#chains in the Genus database with same CATH topology
 5C4C A;  5C4F A;  4FRH A;  3I0E A;  2YQJ A;  2FYC B;  3T57 A;  3DK5 A;  3SX7 A;  1R7U A;  3I3A A;  3ZGG A;  3R2W A;  2FYB A;  5C49 A;  2AQ9 A;  4FRP A;  5AJP A;  3BCV A;  5CQO A;  4XWI A;  4MIX A;  3CU0 A;  4N69 A;  1O7O A;  1R7Y A;  1JV3 A;  3V0M A;  1XHD A;  5DEP A;  1M8N A;  4ASJ A;  4FCE A;  1TVY A;  3DUV A;  3N9W A;  1ZI3 A;  2RJ9 A;  2XMH A;  3EE5 A;  3IOH A;  2JF3 A;  3U0Y A;  1NKH B;  1QGS A;  3KIA A;  4KPX A;  3I0G A;  4R7P A;  2YES A;  3EEV A;  2FYA A;  3I0H A;  5ADX V;  2FY7 A;  3DJ4 A;  4LW6 A;  5CMG X;  5AJO A;  2PGY A;  5IDS A;  3F1Y A;  3SX3 A;  2VS4 A;  3BFP A;  4ZDQ A;  5AFU U;  1H7T A;  4E79 A;  2VK9 A;  3FOQ A;  3MC4 A;  4Y6N A;  1Z90 A;  3VBI A;  1ZCU A;  2P72 A;  2V0I A;  3OUP A;  4Y64 A;  2ZU8 A;  2RJ7 A;  3R5A A;  3KWE A;  5C1G A;  1G97 A;  5CQL X;  1ZCV A;  2YCM A;  2QKX A;  1ZIZ A;  3PKP A;  4ECM A;  2D0J A;  5IDT A;  4UEG A;  3SRT A;  5C4D A;  1LZJ A;  2FFU A;  2AEC A;  5C1H A;  3GQA A;  1ZJ2 A;  3OW5 A;  5BXC A;  5FV9 A;  4DCL A;  3I0I X;  3IXC A;  3JTJ A;  4HZC A;  5FU8 A;  3OH0 A;  1MC3 A;  5D91 A;  2V0H A;  1GX4 A;  4FRE A;  1XHB A;  2XAT A;  2APC A;  4Q7C A;  2DPW A;  1GQ9 A;  1LVW A;  4Y62 A;  3SXE A;  3GOS A;  3GQ8 A;  4MYO A;  1O23 B;  4M2A A;  5C36 A;  1W77 A;  4Y9X A;  2PA4 A;  1VH3 A;  1GX0 A;  3MQG A;  1FOA A;  4E6T A;  3Q80 A;  4Y7T A;  1V84 A;  4HUR A;  1VPA A;  1KRV A;  3USR A;  4Y7G A;  3KWD A;  2Q4J A;  2D7R A;  2P6W A;  2A8U A;  1PZT A;  3R8Y A;  1T3D A;  4KT7 A;  5CQM X;  1MRL A;  2A8W A;  5E3R A;  4B4G A;  5EJ1 A;  4KRV A;  4AAW A;  4Y63 A;  1MP5 A;  3PNN A;  2VD4 A;  1LL0 A;  2JCL A;  4CVH A;  1GQC A;  3V8Z A;  4EAA A;  3OH2 A;  3TDT A;  4AA7 A;  4LW3 A;  5L6V A;  4B5B A;  4EEG A;  2QH5 A;  3U2X A;  1VGT A;  4Y7F A;  2BO8 A;  3U2V A;  3U2W A;  3K8E A;  2QIA A;  4HO6 A;  1FO8 A;  1KK6 A;  4NAI A;  2IC7 A;  1IIN A;  3I3X A;  4KPZ A;  1FRW A;  3ZLK A;  3V0O A;  1W57 A;  1QRE A;  4HO2 A;  3BSW A;  1G0R A;  1G23 A;  1QRG A;  2ICX A;  1NWG B;  2RJ8 A;  1MR7 A;  1QQ0 A;  1H5S D;  4MZU A;  5ADX U;  1V3W A;  1TW1 A;  4CJB A;  1PZY B;  4H7O A;  3JUJ A;  5C4B A;  5C3B A;  3NGW A;  3PMO A;  4NAN A;  3GQ9 A;  2RJ4 A;  3V0L A;  1G93 A;  1ZJ1 A;  1LXA A;  1H7L A;  3BSY A;  2AGD A;  1L0S A;  2VFZ A;  2AM4 A;  1WT2 A;  1H7H A;  2WLE A;  5C4E A;  2WEE A;  4HG6 A;  2WVK A;  1H7E A;  4BQH A;  3E25 A;  4CJ8 A;  2OI7 A;  4M4K A;  1EYR A;  4HO5 A;  1VH1 A;  2JCJ A;  3VBK A;  5C48 A;  3V91 A;  5DDT A;  1FXJ A;  1H4D A;  5JQQ A;  1TW5 A;  1Z2F A;  2RJ6 A;  1H7F A;  2AM3 A;  3CKV A;  4B3U A;  1ZDF A;  2RIJ A;  2XME A;  2WGZ A;  4KXO A;  2BO6 A;  3RSB A;  2XWN A;  1HM8 A;  2W0W A;  2Y4M A;  3I0D A;  5CQP A;  1QG8 A;  4JD0 A;  5FTV A;  1GA8 A;  3KWC A;  1W55 A;  4EE5 A;  5CQN X;  1QWJ A;  4HZD A;  3I0K A;  4KC2 A;  3R5C A;  2IUA A;  1VZX A;  1H5T A;  5CMJ A;  4M9C A;  1S4P A;  1HV9 A;  1XZ6 A;  1ON8 A;  2J0A A;  1V83 A;  5C38 A;  2YQS A;  4FRB A;  1ZDG A;  1EZI A;  2JF2 A;  4ARW A;  4KNX A;  4Y7U A;  5C3A A;  3U0X A;  3TQD A;  5IFY A;  3FSB A;  3RMV A;  2JCO A;  4EEM A;  3U2U A;  3TWD A;  1H5S B;  2Y4J A;  3T7O A;  2OEF A;  4R36 A;  5CMF X;  4DEC A;  2W0V A;  2QIV X;  3VBM A;  1G95 A;  1H5R A;  1JVG A;  3EH0 A;  3V0Q A;  2WVM A;  1LZ0 A;  2AH9 A;  3I0J A;  4EE3 A;  3V0N A;  1JV1 A;  1LL3 A;  3BRK X;  4DE7 A;  1ZCY A;  5CMI A;  4DDZ A;  1WT1 A;  2OI6 A;  3FSY A;  1V82 A;  1S4N A;  3NZ2 A;  3SX8 A;  2VXM A;  2VS3 A;  2QGI A;  1OCX A;  4ISX A;  3I0C A;  1FWY A;  2Z86 A;  2OEG A;  2Y4L A;  4BMA A;  2Y6P A;  4HCQ A;  2NPO A;  4M98 A;  4MYB A;  1NHE B;  3RMW A;  2Y4K A;  3SPT A;  4GBP A;  1INI A;  2XWM A;  4HO3 A;  4AYL A;  3TIO A;  1WVC A;  2O1G A;  2IU8 A;  2O1F A;  1NQI B;  3SXB A;  1I52 A;  3OTZ A;  1TDT A;  3OAM A;  3D98 A;  1ZCT A;  1ON6 A;  3ZGF A;  1H3M A;  4EE4 A;  1KGT A;  1ZJP A;  1YP2 A;  3GQ7 A;  3OH3 A;  3SXG A;  4EQY A;  3D5N A;  3SXA A;  5FYE A;  5C1L A;  1MP3 A;  4FQW A;  1JYL A;  4N27 A;  5EJZ A;  4IRQ A;  1G9R A;  3T7N A;  1H5S C;  3SXC A;  1FGX A;  5E3P A;  3BSS A;  4JIS A;  2YQH A;  2E8B A;  4D11 A;  1KHR A;  1QRM A;  2WLF A;  2RIX A;  4YS8 A;  3FS8 A;  2CU2 A;  3USQ A;  1NF5 B;  2PX7 A;  4MFG A;  4FCU A;  5AFU V;  1SSQ A;  3R1W A;  1R7X A;  4E75 A;  4C2S A;  4IHG A;  1FG5 N;  3V90 A;  4FRD A;  1SST A;  3MQH A;  2ZU7 A;  2V0J A;  1V67 A;  1MP4 A;  1ZJ3 A;  2YC5 A;  1KK4 A;  1NMM B;  3V4E A;  1GWW A;  2BO4 A;  2RIY A;  1QRL A;  2V0K A;  4EA9 A;  3V0P A;  2RJ5 A;  4EEA A;  4K6R A;  3TK8 A;  3DHO A;  4IHH A;  3QVB A;  2D7I A;  1FZW A;  2WAW A;  4FRA A;  1XAT A;  3VBL A;  2VHE A;  3I0F A;  4J18 A;  3SXD A;  2MZB A;  2WLG A;  1VGZ A;  3R5B A;  5FU0 A;  3VBP A;  1G8O A;  2X5S A;  4FIX A;  2XWL A;  1FXO A;  1ZJ0 A;  3GVD A;  3Q1X A;  3OH4 A;  2VSH A;  4M28 A;  1O0R A;  1IIM A;  1INJ A;  3CKN A;  1MR9 A;  2X65 A;  4AC3 A;  4E6U A;  3P47 A;  1HJJ A;  1E5K A;  3VBJ A;  3TV0 A;  1VGW A;  3R3R A;  2FFV A;  3CKO A;  4HO9 A;  2RJ1 A;  3IOJ A;  2I5E A;  1R82 A;  3F1C A;  1OMZ A;  3OGZ A;  1LL2 A;  2VS5 A;  1YRO B;  2AE7 A;  2C0N A;  4NAL A;  5E3Q A;  4O6N A;  3PKQ A;  2RIT A;  1GWV A;  4KC4 A;  2WVL A;  1LZ7 A;  3K8D A;  2RIZ A;  4KQL A;  1VZU A;  1K4V A;  1ZHJ A;  2V0L A;  2E3D A;  4AYJ A;  5C3D A;  4EA8 A;  2Y7A A;  3U2T A;  1SSM A;  5AJN A;  2WE9 A;  3E26 A;  2JCK A;  1FO9 A;  1OQM B;  2P2O A;  1VZT A;  1WT0 A;  3ZLL A;  4M99 A;  1KK5 A;  1R7V A;  4HOC A;  4Y6U A;  3HSQ A;  1WSZ A;  2AES A;  1H4C A;  3IGJ A;  4FRQ A;  3HJJ A;  5DG3 A;  2VSI A;  4MND A;  3JUK A;  4D0T A;  3JQY A;  5J49 A;  4E1K A;  4ASY A;  3P1B A;  2OI5 A;  4G3S A;  2GGO A;  1J2Z A;  1KWS A;  4D11 C;  2YQC A;  2YC3 A;  2WLC A;  1TZF A;  2Z87 A;  3R3I A;  4D0Z A;  1G1L A;  1R80 A;  3OKR A;  4B4B A;  4EVW A;  1H5T B;  4B4M A;  2X5Z A;  3VNP A;  4EEO A;  1THJ A;  1H7Q A;  4J09 A;  5FUH A;  4Y7V A;  2GGQ A;  5EIY A;  2VXL A;  4R37 A;  3O3P A;  4FRM A;  3BXY A;  5CMH A;  3TIS A;  1KQA A;  3VBN A;  5DDV A;  3F1X A;  3SX5 A;  1ZI1 A;  4B2W A;  5U2K A;  3GUE A;  1N4I A;  3SUC A;  3ST8 A;  2P73 A;  5L6S A;  4FRO A;  1O7Q A;  1QGQ A;  1ZJO A;  2IU9 A;  2UX8 A;  3HL3 A;  1H5R B;  1HM9 A;  1HJL A;  2NXV A;  2ICY A;  1H4E A;  1KRR A;  4G87 A;  1ZI5 A;  4IHF A;  1EWW A;  1ZI4 A;  5I1F A;  1JVD A;  1VIC A;  1KGQ A;  3FWW A;  3V8Y A;  4M2B A;  3ECT A;  3FSX A;  4B2X A;  4HUS A;  4HO4 A;  4HO0 A;  1S80 A;  2AM5 A;  5DEM A;  5HS2 A;  1G2V A;  1FR8 A;  1FGG A;  4EAB A;  1JYK A;  4KC1 A;  3CKJ A;  3ZF8 A;  4B42 A;  4FIY A;  1HM0 A;  2BO7 A;  1G3L A;  5C8R A;  4FRL A;  4P00 A;  3D8V A;  3EG4 A;  1YP3 A;  2I7B A;  2ZU9 A;  3CKQ A;  5F42 A;  4HO8 A;  1FR9 A;  4O6M A;  4G3P A;  1OMX A;  3OH1 A;  3R0S A;  4G3Q A;  2X60 A;  1H7G A;  4IRP A;  3POL A;  3TZT A;  1VM8 A;  4EGG A;  2TDT A;  4CJC A;  1KRU A;  3Q7U A;  5C47 A;  1R81 A;  3T7M A;  4EA7 A;  2FKO A;  1S4O A;  4D48 A;  2WLD A;  4N6A A;  5D92 A;  1QRF A;  1YP4 A;  4N6B A;  2J0B A;  3OTM A;  1SS9 A;  3LW6 A;  3Q4S A;  3FSC A;  3CJ8 A;  2FYD B;  2RJ0 A;  3R5D A;  3CGX A;  1VGU A;  1WT3 A;  3IOI A;  1H5S A;  2I5K A;  4KNR A;  1LZI A;  4L41 C;  2O1H A;  1R7T A;  2PGV A;  3C8V A;  3I0L A;  4P02 A;  5FTS A;  3OC9 A;  3OU9 A;  4NAK A;  3FTT A; 
#chains in the Genus database with same CATH homology
 5C4C A;  5C4F A;  4FRH A;  3I0E A;  2YQJ A;  2FYC B;  3T57 A;  3DK5 A;  3SX7 A;  1R7U A;  3I3A A;  3ZGG A;  3R2W A;  2FYB A;  5C49 A;  2AQ9 A;  4FRP A;  5AJP A;  3BCV A;  5CQO A;  4XWI A;  4MIX A;  3CU0 A;  4N69 A;  1O7O A;  1R7Y A;  1JV3 A;  3V0M A;  1XHD A;  5DEP A;  4ASJ A;  4FCE A;  1TVY A;  3DUV A;  3N9W A;  1ZI3 A;  2RJ9 A;  2XMH A;  3EE5 A;  3IOH A;  2JF3 A;  3U0Y A;  1NKH B;  1QGS A;  3KIA A;  4KPX A;  3I0G A;  4R7P A;  2YES A;  3EEV A;  2FYA A;  3I0H A;  5ADX V;  2FY7 A;  3DJ4 A;  4LW6 A;  5CMG X;  5AJO A;  2PGY A;  5IDS A;  3F1Y A;  3SX3 A;  2VS4 A;  3BFP A;  4ZDQ A;  5AFU U;  1H7T A;  4E79 A;  2VK9 A;  3FOQ A;  3MC4 A;  4Y6N A;  1Z90 A;  3VBI A;  1ZCU A;  2P72 A;  2V0I A;  3OUP A;  4Y64 A;  2ZU8 A;  2RJ7 A;  3R5A A;  3KWE A;  5C1G A;  1G97 A;  5CQL X;  1ZCV A;  2YCM A;  2QKX A;  1ZIZ A;  3PKP A;  4ECM A;  2D0J A;  5IDT A;  4UEG A;  3SRT A;  5C4D A;  1LZJ A;  2FFU A;  2AEC A;  5C1H A;  1ZJ2 A;  3OW5 A;  5BXC A;  5FV9 A;  4DCL A;  3I0I X;  3IXC A;  3JTJ A;  4HZC A;  5FU8 A;  3OH0 A;  1MC3 A;  5D91 A;  2V0H A;  1GX4 A;  4FRE A;  1XHB A;  2XAT A;  2APC A;  4Q7C A;  2DPW A;  1GQ9 A;  1LVW A;  4Y62 A;  3SXE A;  3GOS A;  4MYO A;  1O23 B;  4M2A A;  5C36 A;  1W77 A;  4Y9X A;  2PA4 A;  1VH3 A;  1GX0 A;  3MQG A;  1FOA A;  4E6T A;  3Q80 A;  4Y7T A;  1V84 A;  4HUR A;  1VPA A;  1KRV A;  3USR A;  4Y7G A;  3KWD A;  2Q4J A;  2D7R A;  2P6W A;  2A8U A;  1PZT A;  3R8Y A;  1T3D A;  4KT7 A;  5CQM X;  1MRL A;  2A8W A;  5E3R A;  4B4G A;  5EJ1 A;  4KRV A;  4AAW A;  4Y63 A;  1MP5 A;  3PNN A;  2VD4 A;  1LL0 A;  2JCL A;  4CVH A;  1GQC A;  3V8Z A;  4EAA A;  3OH2 A;  3TDT A;  4AA7 A;  4LW3 A;  5L6V A;  4B5B A;  4EEG A;  2QH5 A;  3U2X A;  1VGT A;  4Y7F A;  2BO8 A;  3U2V A;  3U2W A;  3K8E A;  2QIA A;  4HO6 A;  1FO8 A;  1KK6 A;  4NAI A;  2IC7 A;  1IIN A;  3I3X A;  4KPZ A;  1FRW A;  3ZLK A;  3V0O A;  1W57 A;  1QRE A;  4HO2 A;  3BSW A;  1G0R A;  1G23 A;  1QRG A;  2ICX A;  1NWG B;  2RJ8 A;  1MR7 A;  1QQ0 A;  1H5S D;  4MZU A;  5ADX U;  1V3W A;  1TW1 A;  4CJB A;  1PZY B;  4H7O A;  3JUJ A;  5C4B A;  5C3B A;  3NGW A;  3PMO A;  4NAN A;  2RJ4 A;  3V0L A;  1G93 A;  1ZJ1 A;  1LXA A;  1H7L A;  3BSY A;  2AGD A;  2VFZ A;  2AM4 A;  1WT2 A;  1H7H A;  2WLE A;  5C4E A;  2WEE A;  4HG6 A;  2WVK A;  1H7E A;  4BQH A;  3E25 A;  4CJ8 A;  2OI7 A;  4M4K A;  1EYR A;  4HO5 A;  1VH1 A;  2JCJ A;  3VBK A;  5C48 A;  3V91 A;  5DDT A;  1FXJ A;  1H4D A;  5JQQ A;  1TW5 A;  2RJ6 A;  1H7F A;  2AM3 A;  3CKV A;  4B3U A;  1ZDF A;  2RIJ A;  2XME A;  2WGZ A;  4KXO A;  2BO6 A;  3RSB A;  2XWN A;  1HM8 A;  2W0W A;  2Y4M A;  3I0D A;  5CQP A;  1QG8 A;  4JD0 A;  5FTV A;  1GA8 A;  3KWC A;  1W55 A;  4EE5 A;  5CQN X;  1QWJ A;  4HZD A;  3I0K A;  4KC2 A;  3R5C A;  2IUA A;  1VZX A;  1H5T A;  5CMJ A;  4M9C A;  1S4P A;  1HV9 A;  1XZ6 A;  1ON8 A;  2J0A A;  1V83 A;  5C38 A;  2YQS A;  4FRB A;  1ZDG A;  1EZI A;  2JF2 A;  4ARW A;  4KNX A;  4Y7U A;  5C3A A;  3U0X A;  3TQD A;  5IFY A;  3FSB A;  3RMV A;  2JCO A;  4EEM A;  3U2U A;  3TWD A;  1H5S B;  2Y4J A;  3T7O A;  2OEF A;  4R36 A;  5CMF X;  4DEC A;  2W0V A;  2QIV X;  3VBM A;  1G95 A;  1H5R A;  1JVG A;  3EH0 A;  3V0Q A;  2WVM A;  1LZ0 A;  2AH9 A;  3I0J A;  4EE3 A;  3V0N A;  1JV1 A;  1LL3 A;  3BRK X;  4DE7 A;  1ZCY A;  5CMI A;  4DDZ A;  1WT1 A;  2OI6 A;  3FSY A;  1V82 A;  1S4N A;  3NZ2 A;  3SX8 A;  2VXM A;  2VS3 A;  2QGI A;  1OCX A;  4ISX A;  3I0C A;  1FWY A;  2Z86 A;  2OEG A;  2Y4L A;  4BMA A;  2Y6P A;  4HCQ A;  2NPO A;  4M98 A;  4MYB A;  1NHE B;  3RMW A;  2Y4K A;  3SPT A;  4GBP A;  1INI A;  2XWM A;  4HO3 A;  4AYL A;  3TIO A;  1WVC A;  2O1G A;  2IU8 A;  2O1F A;  1NQI B;  3SXB A;  1I52 A;  3OTZ A;  1TDT A;  3OAM A;  3D98 A;  1ZCT A;  1ON6 A;  3ZGF A;  1H3M A;  4EE4 A;  1KGT A;  1ZJP A;  1YP2 A;  3OH3 A;  3SXG A;  4EQY A;  3D5N A;  3SXA A;  5FYE A;  5C1L A;  1MP3 A;  4FQW A;  1JYL A;  4N27 A;  5EJZ A;  4IRQ A;  1G9R A;  3T7N A;  1H5S C;  3SXC A;  1FGX A;  5E3P A;  3BSS A;  4JIS A;  2YQH A;  2E8B A;  4D11 A;  1KHR A;  1QRM A;  2WLF A;  2RIX A;  4YS8 A;  3FS8 A;  2CU2 A;  3USQ A;  1NF5 B;  2PX7 A;  4MFG A;  4FCU A;  5AFU V;  1SSQ A;  3R1W A;  1R7X A;  4E75 A;  4C2S A;  4IHG A;  1FG5 N;  3V90 A;  4FRD A;  1SST A;  3MQH A;  2ZU7 A;  2V0J A;  1V67 A;  1MP4 A;  1ZJ3 A;  2YC5 A;  1KK4 A;  1NMM B;  3V4E A;  1GWW A;  2BO4 A;  2RIY A;  1QRL A;  2V0K A;  4EA9 A;  3V0P A;  2RJ5 A;  4EEA A;  4K6R A;  3TK8 A;  3DHO A;  4IHH A;  3QVB A;  2D7I A;  1FZW A;  2WAW A;  4FRA A;  1XAT A;  3VBL A;  2VHE A;  3I0F A;  4J18 A;  3SXD A;  2MZB A;  2WLG A;  1VGZ A;  3R5B A;  5FU0 A;  3VBP A;  1G8O A;  2X5S A;  4FIX A;  2XWL A;  1FXO A;  1ZJ0 A;  3GVD A;  3Q1X A;  3OH4 A;  2VSH A;  4M28 A;  1O0R A;  1IIM A;  1INJ A;  3CKN A;  1MR9 A;  2X65 A;  4AC3 A;  4E6U A;  3P47 A;  1HJJ A;  1E5K A;  3VBJ A;  3TV0 A;  1VGW A;  3R3R A;  2FFV A;  3CKO A;  4HO9 A;  2RJ1 A;  3IOJ A;  2I5E A;  1R82 A;  3F1C A;  1OMZ A;  3OGZ A;  1LL2 A;  2VS5 A;  1YRO B;  2AE7 A;  2C0N A;  4NAL A;  5E3Q A;  4O6N A;  3PKQ A;  2RIT A;  1GWV A;  4KC4 A;  2WVL A;  1LZ7 A;  3K8D A;  2RIZ A;  4KQL A;  1VZU A;  1K4V A;  1ZHJ A;  2V0L A;  2E3D A;  4AYJ A;  5C3D A;  4EA8 A;  2Y7A A;  3U2T A;  1SSM A;  5AJN A;  2WE9 A;  3E26 A;  2JCK A;  1FO9 A;  1OQM B;  2P2O A;  1VZT A;  1WT0 A;  3ZLL A;  4M99 A;  1KK5 A;  1R7V A;  4HOC A;  4Y6U A;  3HSQ A;  1WSZ A;  2AES A;  1H4C A;  3IGJ A;  4FRQ A;  3HJJ A;  5DG3 A;  2VSI A;  4MND A;  3JUK A;  4D0T A;  3JQY A;  5J49 A;  4E1K A;  4ASY A;  3P1B A;  2OI5 A;  4G3S A;  2GGO A;  1J2Z A;  1KWS A;  4D11 C;  2YQC A;  2YC3 A;  2WLC A;  1TZF A;  2Z87 A;  3R3I A;  4D0Z A;  1G1L A;  1R80 A;  3OKR A;  4B4B A;  4EVW A;  1H5T B;  4B4M A;  2X5Z A;  3VNP A;  4EEO A;  1THJ A;  1H7Q A;  4J09 A;  5FUH A;  4Y7V A;  2GGQ A;  5EIY A;  2VXL A;  4R37 A;  3O3P A;  4FRM A;  3BXY A;  5CMH A;  3TIS A;  1KQA A;  3VBN A;  5DDV A;  3F1X A;  3SX5 A;  1ZI1 A;  4B2W A;  5U2K A;  3GUE A;  3ST8 A;  2P73 A;  5L6S A;  4FRO A;  1O7Q A;  1QGQ A;  1ZJO A;  2IU9 A;  2UX8 A;  3HL3 A;  1H5R B;  1HM9 A;  1HJL A;  2NXV A;  2ICY A;  1H4E A;  1KRR A;  4G87 A;  1ZI5 A;  4IHF A;  1ZI4 A;  5I1F A;  1JVD A;  1VIC A;  1KGQ A;  3FWW A;  3V8Y A;  4M2B A;  3ECT A;  3FSX A;  4B2X A;  4HUS A;  4HO4 A;  4HO0 A;  1S80 A;  2AM5 A;  5DEM A;  5HS2 A;  1G2V A;  1FR8 A;  1FGG A;  4EAB A;  1JYK A;  4KC1 A;  3CKJ A;  3ZF8 A;  4B42 A;  4FIY A;  1HM0 A;  2BO7 A;  1G3L A;  5C8R A;  4FRL A;  4P00 A;  3D8V A;  3EG4 A;  1YP3 A;  2I7B A;  2ZU9 A;  3CKQ A;  5F42 A;  4HO8 A;  1FR9 A;  4O6M A;  4G3P A;  1OMX A;  3R0S A;  3OH1 A;  4G3Q A;  2X60 A;  1H7G A;  4IRP A;  3POL A;  3TZT A;  1VM8 A;  4EGG A;  2TDT A;  4CJC A;  1KRU A;  3Q7U A;  5C47 A;  1R81 A;  3T7M A;  4EA7 A;  2FKO A;  1S4O A;  4D48 A;  2WLD A;  4N6A A;  5D92 A;  1QRF A;  1YP4 A;  4N6B A;  2J0B A;  3OTM A;  1SS9 A;  3LW6 A;  3Q4S A;  3FSC A;  3CJ8 A;  2FYD B;  2RJ0 A;  3R5D A;  3CGX A;  1VGU A;  1WT3 A;  3IOI A;  1H5S A;  2I5K A;  4KNR A;  1LZI A;  4L41 C;  2O1H A;  1R7T A;  2PGV A;  3C8V A;  3I0L A;  4P02 A;  5FTS A;  3OC9 A;  3OU9 A;  4NAK A;  3FTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...