2WLGA

Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
211
Chain Sequence
MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup y
molecule tags Transferase
molecule keywords POLYSIALIC ACID O-ACETYLTRANSFERASE
total genus 78
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2wlgA00
4EA9A 2IUAA 4G3SA 2GGQA 3V4EA 3OTMA 2NPOA 1KGQA 1V67A 1FXJA 3VBJA 2WLFA 2P2OA 5F42A 3OUPA 1LXAA 3FSBA 3TISA 3EG4A 1QRLA 1SSQA 3D8VA 2OEGA 4HURA 3TV0A 4R7PA 2IC7A 3BXYA 3R5DA 3TIOA 1KRRA 1Z90A 1QREA 1MR9A 2WLGA 4KNRA 3R1WA 3R3RA 3KWCA 4KQLA 2IU9A 3GUEA 2QKXA 4E6UA 3GVDA 3VNPA 4HZCA 4EAAA 2V0HA 5ADXV 3MQHA 4E6TA 4M2BA 3Q1XA 1OCXA 3BFPA 4H7OA 3P47A 5E3PA 2QIAA 3FWWA 3MC4A 3CJ8A 4J09A 4R36A 2AQ9A 1KK6A 3DJ4A 4HZDA 2V0IA 2WLEA 1TDTA 2OI7A 3BSWA 2Q4JA 1KRUA 1S80A 4IHFA 3R8YA 1YP3A 3OU9A 4FCEA 4AC3A 1KHRA 3R3IA 3R2WA 4J18A 3VBIA 4DCLA 2OI5A 4AAWA 4KPXA 2JF3A 3OW5A 4HCQA 4EQYA 2WLDA 3R5BA 5DEMA 4M2AA 1SSTA 1KQAA 1SSMA 2I5KA 4MZUA 4R37A 5AFUU 3EEVA 3GOSA 3BSYA 3HJJA 2V0LA 2XATA 1MRLA 2WLCA 3I3AA 4HUSA 1MR7A 2GGOA 4E79A 4EA8A 3R5AA 5U2KA 4M98A 3SRTA 2V0JA 5AFUV 3FS8A 4MFGA 4KNXA 4AA7A 1G95A 1HM0A 5E3RA 3F1XA 3HSQA 2VD4A 4KPZA 3TK8A 1YP2A 2IU8A 4M99A 1HV9A 3OTZA 1KRVA 3TWDA 4EABA 4G3QA 1QRFA 4M28A 5L6SA 3FSXA 4E75A 2OI6A 1T3DA 3C8VA 1KK5A 3DK5A 3JQYA 3FSYA 2V0KA 2ICYA 3I3XA 2RIJA 2TDTA 1KK4A 1THJA 4N6BA 2QIVX 3DHOA 3KWDA 4IHHA 1KGTA 5DEPA 4EGGA 5ADXU 1QQ0A 5E3QA 1XHDA 3BSSA 1J2ZA 1HM9A 3R5CA 4G3PA 1QRMA 2W0VA 4IHGA 4ISXA 2ICXA 3T57A 2VHEA 1V3WA 3P1BA 4G87A 3VBMA 4N6AA 3VBPA 1G97A 1XATA 1YP4A 3BRKX 4N27A 2FKOA 3VBKA 3NZ2A 3TDTA 3SPTA 2OEFA 1QRGA 2JF2A 3IXCA 2W0WA 3D98A 4N69A 3MQGA 3ST8A 3FTTA 3FSCA 3PMOA 4M9CA 4K6RA 4EA7A 5L6VA 3IGJA 3VBLA 4MYOA 1FWYA 3EH0A 3R0SA 3VBNA 3KWEA 4E1KA 3FOQA 1HM8A 3ECTA 5DG3A
chains in the Genus database with same CATH superfamily
4EA9A 1M8NA 2IUAA 4G3SA 2GGQA 3V4EA 3OTMA 2NPOA 1KGQA 1V67A 1FXJA 3VBJA 2WLFA 2P2OA 5F42A 1L0SA 1EWWA 3OUPA 1LXAA 3FSBA 3TISA 3EG4A 1QRLA 1SSQA 3D8VA 2OEGA 4HURA 3TV0A 4R7PA 2IC7A 3GQ8A 3BXYA 3R5DA 3TIOA 1KRRA 1Z90A 1QREA 1MR9A 3GQ7A 3OH0A 2WLGA 4KNRA 3R1WA 3R3RA 3KWCA 4KQLA 2IU9A 3GUEA 2QKXA 4E6UA 3GVDA 3VNPA 4HZCA 4EAAA 2V0HA 5ADXV 3MQHA 4E6TA 4M2BA 3Q1XA 1OCXA 3BFPA 4H7OA 3P47A 5E3PA 2QIAA 3FWWA 3MC4A 3CJ8A 4J09A 4R36A 2AQ9A 1KK6A 3DJ4A 3SUCA 4HZDA 2V0IA 2WLEA 1TDTA 2OI7A 3BSWA 2Q4JA 1KRUA 1S80A 4IHFA 3R8YA 1YP3A 3OU9A 4FCEA 4AC3A 1KHRA 3R3IA 3R2WA 4J18A 3VBIA 4DCLA 2OI5A 4AAWA 4KPXA 2JF3A 3OW5A 4HCQA 4EQYA 2WLDA 3R5BA 5DEMA 4M2AA 1SSTA 1KQAA 1SSMA 2I5KA 4MZUA 4R37A 5AFUU 3EEVA 3GOSA 3BSYA 3OH1A 3HJJA 2V0LA 2XATA 1MRLA 2WLCA 3I3AA 4HUSA 1MR7A 2GGOA 4E79A 4EA8A 3R5AA 5U2KA 4M98A 3SRTA 2V0JA 5AFUV 3FS8A 4MFGA 4KNXA 4AA7A 1G95A 1HM0A 5E3RA 3F1XA 3HSQA 2VD4A 4KPZA 3TK8A 1YP2A 2IU8A 4M99A 1HV9A 3OTZA 1KRVA 3TWDA 4EABA 4G3QA 1QRFA 1Z2FA 4M28A 5L6SA 3FSXA 4E75A 2OI6A 5DG3A 1T3DA 3C8VA 1KK5A 3DK5A 3JQYA 3FSYA 2V0KA 2ICYA 3I3XA 2RIJA 2TDTA 1KK4A 3OH3A 3GQAA 1THJA 4N6BA 2QIVX 3DHOA 3KWDA 4IHHA 1KGTA 5DEPA 4EGGA 5ADXU 1QQ0A 5E3QA 1XHDA 3BSSA 1J2ZA 1HM9A 3R5CA 4G3PA 1QRMA 2W0VA 4IHGA 4ISXA 2ICXA 3T57A 2VHEA 1V3WA 3P1BA 4G87A 3VBMA 4N6AA 3VBPA 1G97A 1XATA 1YP4A 3BRKX 4N27A 2FKOA 3VBKA 3NZ2A 3TDTA 3SPTA 2OEFA 1QRGA 3OH2A 2JF2A 3IXCA 2W0WA 3D98A 4N69A 3OGZA 3MQGA 3ST8A 3FTTA 3GQ9A 3FSCA 3PMOA 4M9CA 4K6RA 4EA7A 5L6VA 3IGJA 3VBLA 3OH4A 4MYOA 1FWYA 3EH0A 3R0SA 3VBNA 3KWEA 4E1KA 3FOQA 1HM8A 3ECTA 1N4IA
chains in the Genus database with same CATH topology
4EA9A 2IUAA 4G3SA 2GGQA 3V4EA 3OTMA 2NPOA 1KGQA 1V67A 1FXJA 3VBJA 2WLFA 2P2OA 5F42A 3OUPA 1LXAA 3FSBA 3TISA 3EG4A 1QRLA 1SSQA 3D8VA 2OEGA 4HURA 3TV0A 4R7PA 2IC7A 3BXYA 3R5DA 3TIOA 1KRRA 1Z90A 1QREA 1MR9A 2WLGA 4KNRA 3R1WA 3R3RA 3KWCA 4KQLA 2IU9A 3GUEA 2QKXA 4E6UA 3GVDA 3VNPA 4HZCA 4EAAA 2V0HA 5ADXV 3MQHA 4E6TA 4M2BA 3Q1XA 1OCXA 3BFPA 4H7OA 3P47A 5E3PA 2QIAA 3FWWA 3MC4A 3CJ8A 4J09A 4R36A 2AQ9A 1KK6A 3DJ4A 4HZDA 2V0IA 2WLEA 1TDTA 2OI7A 3BSWA 2Q4JA 1KRUA 1S80A 4IHFA 3R8YA 1YP3A 3OU9A 4FCEA 4AC3A 1KHRA 3R3IA 3R2WA 4J18A 3VBIA 4DCLA 2OI5A 4AAWA 4KPXA 2JF3A 3OW5A 4HCQA 4EQYA 2WLDA 3R5BA 5DEMA 4M2AA 1SSTA 1KQAA 1SSMA 2I5KA 4MZUA 4R37A 5AFUU 3EEVA 3GOSA 3BSYA 3HJJA 2V0LA 2XATA 1MRLA 2WLCA 3I3AA 4HUSA 1MR7A 2GGOA 4E79A 4EA8A 3R5AA 5U2KA 4M98A 3SRTA 2V0JA 5AFUV 3FS8A 4MFGA 4KNXA 4AA7A 1G95A 1HM0A 5E3RA 3F1XA 3HSQA 2VD4A 4KPZA 3TK8A 1YP2A 2IU8A 4M99A 1HV9A 3OTZA 1KRVA 3TWDA 4EABA 4G3QA 1QRFA 4M28A 5L6SA 3FSXA 4E75A 2OI6A 1T3DA 3C8VA 1KK5A 3DK5A 3JQYA 3FSYA 2V0KA 2ICYA 3I3XA 2RIJA 2TDTA 1KK4A 1THJA 4N6BA 2QIVX 3DHOA 3KWDA 4IHHA 1KGTA 5DEPA 4EGGA 5ADXU 1QQ0A 5E3QA 1XHDA 3BSSA 1J2ZA 1HM9A 3R5CA 4G3PA 1QRMA 2W0VA 4IHGA 4ISXA 2ICXA 3T57A 2VHEA 1V3WA 3P1BA 4G87A 3VBMA 4N6AA 3VBPA 1G97A 1XATA 1YP4A 3BRKX 4N27A 2FKOA 3VBKA 3NZ2A 3TDTA 3SPTA 2OEFA 1QRGA 2JF2A 3IXCA 2W0WA 3D98A 4N69A 3MQGA 3ST8A 3FTTA 3FSCA 3PMOA 4M9CA 4K6RA 4EA7A 5L6VA 3IGJA 3VBLA 4MYOA 1FWYA 3EH0A 3R0SA 3VBNA 3KWEA 4E1KA 3FOQA 1HM8A 3ECTA 5DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA9 A;  2IUA A;  4G3S A;  2GGQ A;  3V4E A;  3OTM A;  2NPO A;  1KGQ A;  1V67 A;  1FXJ A;  3VBJ A;  2WLF A;  2P2O A;  5F42 A;  3OUP A;  1LXA A;  3FSB A;  3TIS A;  3EG4 A;  1QRL A;  1SSQ A;  3D8V A;  2OEG A;  4HUR A;  3TV0 A;  4R7P A;  2IC7 A;  3BXY A;  3R5D A;  3TIO A;  1KRR A;  1Z90 A;  1QRE A;  1MR9 A;  2WLG A;  4KNR A;  3R1W A;  3R3R A;  3KWC A;  4KQL A;  2IU9 A;  3GUE A;  2QKX A;  4E6U A;  3GVD A;  3VNP A;  4HZC A;  4EAA A;  2V0H A;  5ADX V;  3MQH A;  4E6T A;  4M2B A;  3Q1X A;  1OCX A;  3BFP A;  4H7O A;  3P47 A;  5E3P A;  2QIA A;  3FWW A;  3MC4 A;  3CJ8 A;  4J09 A;  4R36 A;  2AQ9 A;  1KK6 A;  3DJ4 A;  4HZD A;  2V0I A;  2WLE A;  1TDT A;  2OI7 A;  3BSW A;  2Q4J A;  1KRU A;  1S80 A;  4IHF A;  3R8Y A;  1YP3 A;  3OU9 A;  4FCE A;  4AC3 A;  1KHR A;  3R3I A;  3R2W A;  4J18 A;  3VBI A;  4DCL A;  2OI5 A;  4AAW A;  4KPX A;  2JF3 A;  3OW5 A;  4HCQ A;  4EQY A;  2WLD A;  3R5B A;  5DEM A;  4M2A A;  1SST A;  1KQA A;  1SSM A;  2I5K A;  4MZU A;  4R37 A;  5AFU U;  3EEV A;  3GOS A;  3BSY A;  3HJJ A;  2V0L A;  2XAT A;  1MRL A;  2WLC A;  3I3A A;  4HUS A;  1MR7 A;  2GGO A;  4E79 A;  4EA8 A;  3R5A A;  5U2K A;  4M98 A;  3SRT A;  2V0J A;  5AFU V;  3FS8 A;  4MFG A;  4KNX A;  4AA7 A;  1G95 A;  1HM0 A;  5E3R A;  3F1X A;  3HSQ A;  2VD4 A;  4KPZ A;  3TK8 A;  1YP2 A;  2IU8 A;  4M99 A;  1HV9 A;  3OTZ A;  1KRV A;  3TWD A;  4EAB A;  4G3Q A;  1QRF A;  4M28 A;  5L6S A;  3FSX A;  4E75 A;  2OI6 A;  1T3D A;  3C8V A;  1KK5 A;  3DK5 A;  3JQY A;  3FSY A;  2V0K A;  2ICY A;  3I3X A;  2RIJ A;  2TDT A;  1KK4 A;  1THJ A;  4N6B A;  2QIV X;  3DHO A;  3KWD A;  4IHH A;  1KGT A;  5DEP A;  4EGG A;  5ADX U;  1QQ0 A;  5E3Q A;  1XHD A;  3BSS A;  1J2Z A;  1HM9 A;  3R5C A;  4G3P A;  1QRM A;  2W0V A;  4IHG A;  4ISX A;  2ICX A;  3T57 A;  2VHE A;  1V3W A;  3P1B A;  4G87 A;  3VBM A;  4N6A A;  3VBP A;  1G97 A;  1XAT A;  1YP4 A;  3BRK X;  4N27 A;  2FKO A;  3VBK A;  3NZ2 A;  3TDT A;  3SPT A;  2OEF A;  1QRG A;  2JF2 A;  3IXC A;  2W0W A;  3D98 A;  4N69 A;  3MQG A;  3ST8 A;  3FTT A;  3FSC A;  3PMO A;  4M9C A;  4K6R A;  4EA7 A;  5L6V A;  3IGJ A;  3VBL A;  4MYO A;  1FWY A;  3EH0 A;  3R0S A;  3VBN A;  3KWE A;  4E1K A;  3FOQ A;  1HM8 A;  3ECT A;  5DG3 A; 
#chains in the Genus database with same CATH topology
 4EA9 A;  1M8N A;  2IUA A;  4G3S A;  2GGQ A;  3V4E A;  3OTM A;  2NPO A;  1KGQ A;  1V67 A;  1FXJ A;  3VBJ A;  2WLF A;  2P2O A;  5F42 A;  1L0S A;  1EWW A;  3OUP A;  1LXA A;  3FSB A;  3TIS A;  3EG4 A;  1QRL A;  1SSQ A;  3D8V A;  2OEG A;  4HUR A;  3TV0 A;  4R7P A;  2IC7 A;  3GQ8 A;  3BXY A;  3R5D A;  3TIO A;  1KRR A;  1Z90 A;  1QRE A;  1MR9 A;  3GQ7 A;  3OH0 A;  2WLG A;  4KNR A;  3R1W A;  3R3R A;  3KWC A;  4KQL A;  2IU9 A;  3GUE A;  2QKX A;  4E6U A;  3GVD A;  3VNP A;  4HZC A;  4EAA A;  2V0H A;  5ADX V;  3MQH A;  4E6T A;  4M2B A;  3Q1X A;  1OCX A;  3BFP A;  4H7O A;  3P47 A;  5E3P A;  2QIA A;  3FWW A;  3MC4 A;  3CJ8 A;  4J09 A;  4R36 A;  2AQ9 A;  1KK6 A;  3DJ4 A;  3SUC A;  4HZD A;  2V0I A;  2WLE A;  1TDT A;  2OI7 A;  3BSW A;  2Q4J A;  1KRU A;  1S80 A;  4IHF A;  3R8Y A;  1YP3 A;  3OU9 A;  4FCE A;  4AC3 A;  1KHR A;  3R3I A;  3R2W A;  4J18 A;  3VBI A;  4DCL A;  2OI5 A;  4AAW A;  4KPX A;  2JF3 A;  3OW5 A;  4HCQ A;  4EQY A;  2WLD A;  3R5B A;  5DEM A;  4M2A A;  1SST A;  1KQA A;  1SSM A;  2I5K A;  4MZU A;  4R37 A;  5AFU U;  3EEV A;  3GOS A;  3BSY A;  3OH1 A;  3HJJ A;  2V0L A;  2XAT A;  1MRL A;  2WLC A;  3I3A A;  4HUS A;  1MR7 A;  2GGO A;  4E79 A;  4EA8 A;  3R5A A;  5U2K A;  4M98 A;  3SRT A;  2V0J A;  5AFU V;  3FS8 A;  4MFG A;  4KNX A;  4AA7 A;  1G95 A;  1HM0 A;  5E3R A;  3F1X A;  3HSQ A;  2VD4 A;  4KPZ A;  3TK8 A;  1YP2 A;  2IU8 A;  4M99 A;  1HV9 A;  3OTZ A;  1KRV A;  3TWD A;  4EAB A;  4G3Q A;  1QRF A;  1Z2F A;  4M28 A;  5L6S A;  3FSX A;  4E75 A;  2OI6 A;  5DG3 A;  1T3D A;  3C8V A;  1KK5 A;  3DK5 A;  3JQY A;  3FSY A;  2V0K A;  2ICY A;  3I3X A;  2RIJ A;  2TDT A;  1KK4 A;  3OH3 A;  3GQA A;  1THJ A;  4N6B A;  2QIV X;  3DHO A;  3KWD A;  4IHH A;  1KGT A;  5DEP A;  4EGG A;  5ADX U;  1QQ0 A;  5E3Q A;  1XHD A;  3BSS A;  1J2Z A;  1HM9 A;  3R5C A;  4G3P A;  1QRM A;  2W0V A;  4IHG A;  4ISX A;  2ICX A;  3T57 A;  2VHE A;  1V3W A;  3P1B A;  4G87 A;  3VBM A;  4N6A A;  3VBP A;  1G97 A;  1XAT A;  1YP4 A;  3BRK X;  4N27 A;  2FKO A;  3VBK A;  3NZ2 A;  3TDT A;  3SPT A;  2OEF A;  1QRG A;  3OH2 A;  2JF2 A;  3IXC A;  2W0W A;  3D98 A;  4N69 A;  3OGZ A;  3MQG A;  3ST8 A;  3FTT A;  3GQ9 A;  3FSC A;  3PMO A;  4M9C A;  4K6R A;  4EA7 A;  5L6V A;  3IGJ A;  3VBL A;  3OH4 A;  4MYO A;  1FWY A;  3EH0 A;  3R0S A;  3VBN A;  3KWE A;  4E1K A;  3FOQ A;  1HM8 A;  3ECT A;  1N4I A; 
#chains in the Genus database with same CATH homology
 4EA9 A;  2IUA A;  4G3S A;  2GGQ A;  3V4E A;  3OTM A;  2NPO A;  1KGQ A;  1V67 A;  1FXJ A;  3VBJ A;  2WLF A;  2P2O A;  5F42 A;  3OUP A;  1LXA A;  3FSB A;  3TIS A;  3EG4 A;  1QRL A;  1SSQ A;  3D8V A;  2OEG A;  4HUR A;  3TV0 A;  4R7P A;  2IC7 A;  3BXY A;  3R5D A;  3TIO A;  1KRR A;  1Z90 A;  1QRE A;  1MR9 A;  2WLG A;  4KNR A;  3R1W A;  3R3R A;  3KWC A;  4KQL A;  2IU9 A;  3GUE A;  2QKX A;  4E6U A;  3GVD A;  3VNP A;  4HZC A;  4EAA A;  2V0H A;  5ADX V;  3MQH A;  4E6T A;  4M2B A;  3Q1X A;  1OCX A;  3BFP A;  4H7O A;  3P47 A;  5E3P A;  2QIA A;  3FWW A;  3MC4 A;  3CJ8 A;  4J09 A;  4R36 A;  2AQ9 A;  1KK6 A;  3DJ4 A;  4HZD A;  2V0I A;  2WLE A;  1TDT A;  2OI7 A;  3BSW A;  2Q4J A;  1KRU A;  1S80 A;  4IHF A;  3R8Y A;  1YP3 A;  3OU9 A;  4FCE A;  4AC3 A;  1KHR A;  3R3I A;  3R2W A;  4J18 A;  3VBI A;  4DCL A;  2OI5 A;  4AAW A;  4KPX A;  2JF3 A;  3OW5 A;  4HCQ A;  4EQY A;  2WLD A;  3R5B A;  5DEM A;  4M2A A;  1SST A;  1KQA A;  1SSM A;  2I5K A;  4MZU A;  4R37 A;  5AFU U;  3EEV A;  3GOS A;  3BSY A;  3HJJ A;  2V0L A;  2XAT A;  1MRL A;  2WLC A;  3I3A A;  4HUS A;  1MR7 A;  2GGO A;  4E79 A;  4EA8 A;  3R5A A;  5U2K A;  4M98 A;  3SRT A;  2V0J A;  5AFU V;  3FS8 A;  4MFG A;  4KNX A;  4AA7 A;  1G95 A;  1HM0 A;  5E3R A;  3F1X A;  3HSQ A;  2VD4 A;  4KPZ A;  3TK8 A;  1YP2 A;  2IU8 A;  4M99 A;  1HV9 A;  3OTZ A;  1KRV A;  3TWD A;  4EAB A;  4G3Q A;  1QRF A;  4M28 A;  5L6S A;  3FSX A;  4E75 A;  2OI6 A;  1T3D A;  3C8V A;  1KK5 A;  3DK5 A;  3JQY A;  3FSY A;  2V0K A;  2ICY A;  3I3X A;  2RIJ A;  2TDT A;  1KK4 A;  1THJ A;  4N6B A;  2QIV X;  3DHO A;  3KWD A;  4IHH A;  1KGT A;  5DEP A;  4EGG A;  5ADX U;  1QQ0 A;  5E3Q A;  1XHD A;  3BSS A;  1J2Z A;  1HM9 A;  3R5C A;  4G3P A;  1QRM A;  2W0V A;  4IHG A;  4ISX A;  2ICX A;  3T57 A;  2VHE A;  1V3W A;  3P1B A;  4G87 A;  3VBM A;  4N6A A;  3VBP A;  1G97 A;  1XAT A;  1YP4 A;  3BRK X;  4N27 A;  2FKO A;  3VBK A;  3NZ2 A;  3TDT A;  3SPT A;  2OEF A;  1QRG A;  2JF2 A;  3IXC A;  2W0W A;  3D98 A;  4N69 A;  3MQG A;  3ST8 A;  3FTT A;  3FSC A;  3PMO A;  4M9C A;  4K6R A;  4EA7 A;  5L6V A;  3IGJ A;  3VBL A;  4MYO A;  1FWY A;  3EH0 A;  3R0S A;  3VBN A;  3KWE A;  4E1K A;  3FOQ A;  1HM8 A;  3ECT A;  5DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...