3C8VA

Crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
476
structure length
453
Chain Sequence
GMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGKNFTFNIIQPYQDGDPRGMYPTILIQPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of putative acetyltransferase (YP_390128.1) from Desulfovibrio desulfuricans G20 at 2.28 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
molecule tags Transferase
molecule keywords Putative acetyltransferase
total genus 165
structure length 453
sequence length 476
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18776 Hexapep_loop Hexapeptide repeat including loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3c8vA04
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA03
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA02
2WSEJ 1V3WA 4G3QA 5DEMA 1MR7A 2FYNC 3VBLA 4EAAA 4PV1B 1V67A 3F1XA 1KGTA 3P47A 3JQYA 2K9YA 1T3DA 3EEVA 3EG4A 2JF2A 4HZCA 3SRTA 1J2ZA 4KT0J 1QQ0A 4H0LB 2TDTA 1Z90A 1OCXA 3KWEA 4N6AA 2E76B 3OTMA 2OEFA 1QRGA 2E75B 1KK4A 4IHFA 1MR9A 3DK5A 2WSCJ 2V0KA 3GVDA 1HM9A 2O01J 1G97A 4G3PA 1YP2A 3IGJA 4RKUJ 2VHEA 3BSWA 5KLIC 1JB0J 4EA9A 1MRLA 4KPXA 3VBPA 3EH0A 4N69A 2OI5A 4AC3A 2V0LA 4MZUA 5L6SA 2V0HA 3FSBA 3IXCA 3KWCA 2I5KA 3DJ4A 4HCQA 3R0SA 4M28A 1QRFA 2GGQA 1XATA 3OU9A 5E3QA 1ZRTE 3PMOA 1FXJA 1KK6A 2WLGA 4E1KA 2AQ9A 1TDTA 2ICXA 3R2WA 2IC7A 4H44B 1HM0A 3BSYA 2RIJA 5L6VA 3FTTA 3VBNA 2XATA 4EGGA 3R3RA 3ST8A 2P2OA 1XHDA 5ADXV 3MC4A 2D2CB 4J18A 4KPZA 1SSTA 5DEPA 2WSFJ 2IU8A 2QKXA 5KKZC 1HV9A 4EQYA 4E6UA 3FSCA 3TIOA 2FKOA 4H13B 2QIAA 3TV0A 3LW5J 3BXYA 4J09A 4Y28J 3TWDA 2OI6A 5U2KA 1QREA 2V0JA 3ECTA 5DG3A 1KGQA 3KWDA 5AFUV 4E75A 3BRKX 4MFGA 4I7ZB 3V4EA 1Q90D 3P1BA 4KQLA 3Q1XA 2NPOA 3R5BA 4HUSA 3FSYA 3R8YA 5L8RJ 4E6TA 3T57A 4KNRA 4DCLA 4IL6X 3GUEA 2IU9A 4R36A 1SSQA 4HZDA 3VBIA 2QJYC 3VBKA 3D8VA 3MQGA 3R3IA 1THJA 1G95A 2QIVX 4N6BA 1LXAA 4M99A 3VNPA 1S5LX 3FWWA 4EA7A 2Q4JA 3NZ2A 2WLDA 1HM8A 4IHHA 2GGOA 2W0VA 2VD4A 4N27A 2WLCA 4EA8A 2W0WA 5F42A 3VBJA 4G87A 3GOSA 5ADXU 1QRMA 4M98A 4M2AA 3FOQA 5E3PA 2OEGA 2QJKC 3C8VA 2JF3A 3DHOA 4HURA 4R7PA 4K6RA 4FCEA 1KQAA 3OW5A 3SPTA 2QIWA 1YP3A 3OTZA 3CJ8A 3R5DA 2QSIA 2WPVB 3VBMA 3R5AA 4R37A 2YIUC 4AA7A 1KHRA 3TDTA 3OUPA 1KK5A 2QJPC 2OI7A 3FSXA 3HJJA 3MQHA 2ICYA 1KRUA 5E3RA 5AFUU 1VF5B 4IHGA 3R5CA 4KNXA 3TK8A 2WLEA 3I3AA 4ISXA 2ZT9B 4EABA 3R1WA 4OGQB 1QRLA 3I3XA 4G3SA 1FWYA 1YP4A 2E74B 2WLFA 3HSQA 3TISA 3D98A 1SSMA 4AAWA 3BFPA 4MYOA 4M2BA 1KRRA 3FS8A 1S80A 3BSSA 4E79A 1KRVA 4H7OA 2IUAA 2V0IA 4M9CA
chains in the Genus database with same CATH superfamily
2FYUK 1J2JB 4AQRD 3G9RA 1L4AC 2FXMA 4WB4A 2KS1A 4H0LD 4DJGA 1K73Q 3O8ZA 1JB0J 1BGYD 2LKMA 4AC3A 3GHGB 4HCQA 3A0BH 3OU9A 1KILB 5APYA 3WUTA 5L6VA 2N1TB 1CI6A 3MIWA 4O9BA 3L72G 5K5GB 2IU8A 2PGDA 4PV1C 3TIOA 2KSEA 3CL3D 3P8CE 1KYOH 1KB9I 1QL2A 5AFUV 3V4EA 4N3YB 3RK3B 4KQLA 5L8RJ 1PPJD 1TU3F 2H7HA 2QJYB 1NTMJ 1G95A 5AVVB 1S1CX 3CXHD 1L0NJ 3MTUE 2WLCA 1KILD 3AECC 1AVYA 2J58A 2OYOA 1X0TA 3G4SP 3CX5H 2K37A 3H1KE 2N9BA 3R5DA 1IFDA 1SQVK 1LTTC 2XU6A 3TNUB 1BCCD 3C9IA 4K35A 2E75D 3CLQA 3CC7P 2E76D 2W6BA 5BVZA 4OGQB 1SQBK 1FU1A 1VQ8P 1M8NA 5C39A 1DEBA 1JCCA 1LWUC 1M57D 2GUVA 3RK2B 4H7OA 1SQXJ 1M1JC 1V3WA 4G3QA 3LW5H 3VBLA 4EAAA 4C7RA 3HRNA 4DZOA 1QQ0A 3H1IG 3H1HJ 4XFJA 3TGUD 3H1LD 2ZXEB 1SQXK 1USDA 5GTHH 4L74A 3U1CA 1NKNA 4B86A 1IJDB 1JY2N 5H2FH 3JC22 3H1JG 3FWNA 4RESB 1MKMA 4L73A 4ZMDA 1ZRTE 2P1JA 2ZJSE 4E1KA 3WMM0 5B5EE 1NAFA 1SQPE 3ST8A 3MHVA 2D2CB 2J59M 3BASA 1RE4C 3OW2O 1YIJP 1SFCA 5U2KA 1EXIA 3CCLP 4MN4C 3CCJP 3KWDA 4MFGA 2W6JH 1Q86Q 4LC1A 1YYCA 1JEKA 3L75E 1NKZB 2KOGA 3KXDA 1VF5C 1NO4A 3Q5PA 1HH0A 2GGOA 2XNDH 2W0WA 2QJKC 5KJ7C 3L74J 3SPTA 3V2QA 1KYOI 4IFMA 3OTZA 2OYIB 3TDTA 2IFMA 4U3FD 2AXCA 3QH9A 5TISH 1PV3A 4EABA 3CCUP 3S4RA 4G3SA 5AVXB 3CCMP 2HODB 4UB8H 3L35A 2Q9IA 2YNYA 2E43A 1L0SA 2HFED 2FXPA 1N73B 1VDFA 1GL2D 3GVDA 1NTZJ 2WSCH 4NPDA 2K3RA 1VQNP 3VOPA 3H1JE 5AW0B 3B8EB 1MRLA 4H13C 2MJZA 1OMIA 3DJ4A 1QRFA 1GL2B 4BRYB 3VMXA 3PMOA 4D6TE 3HTKA 1SQQD 2YMYA 1FDIA 4AYCA 1LTJC 1LT9B 2XATA 5AVTB 5AVUB 1SFCD 3R4YA 5ADXV 3P32A 1X8YA 4TT3H 1NJIQ 3CWBG 1JTHA 2KB7P 4PD4H 1HGZA 2O1KA 4Y28J 2ZT9D 3ECTA 2A06G 2D2CD 1YJNP 3CXHE 2Y9ZA 1DX7A 1HF9A 3R8YA 1S9KE 4DCLA 4W80A 1NU1E 3H1IE 2QJYC 5KAIE 3P7KA 2QIVX 3VNPA 3GMAA 4GT1A 2Z4EA 1QX8A 4PD4I 4IHHA 2W0VA 1S72P 4EA8A 4H13D 2LXCB 1FZFA 3DHOA 3C8VA 4R7PA 4N78E 1L0LJ 2BCCD 2FYUE 1PGOA 5APSA 4GODA 2OYIC 2YIUC 1VL2A 3CMEP 2FYUG 2XDJA 5KJ7A 1EWWA 2R3SA 3VP9A 4GOEA 3L73E 2IZ1A 2V0IA 2NPSB 1OW7A 2D2CC 3M9BA 1V67A 1J2ZA 1U7MA 1X22A 1P84H 2QJPB 1PGJA 1GL2A 3PTZA 1FZBA 3FGAD 1GMJA 1HWTC 1JM0A 3S1KA 3CWBD 2VHEA 3W67A 4EA9A 5APWA 3G6EP 3FXEA 3HD7C 3BCCD 3KZIE 1NTKJ 3E7KA 1FDOA 3PHLA 3RK3E 2QVAA 1NTME 1GZLA 2ICXA 1T2KC 3H1JJ 2RIJA 2O01H 1N2DC 4OWFA 5AW2B 2JJLA 1NTKK 4W7ZA 3USSA 2XKMA 1PGQA 4PV1D 4N78D 4U3FG 1GK6A 1QREA 1BDCA 3G3ZA 1AV1A 1HTLC 4UB6H 1E5WA 2KZJA 3H1ID 4K3AA 2N1TA 1BDDA 3FWWA 2KZIA 2B87A 2ITAA 2WLDA 1VPCA 2JR8A 4DT0A 4TLFA 4HURA 1L0LG 4K6RA 4FCEA 3CJ8A 2C9LY 1H0TA 1KHRA 4LGDE 3SWYA 4DCKA 1KRUA 1U57A 3GW6A 3TK8A 4JYBA 1JCDA 2FYZA 1U7JA 3BFPA 3I56P 5CCGD 2YXQB 1JY3N 3MD0A 4BWNA 5AW5B 1IFIA 1MR7A 3VMZA 3VBNA 1NGMB 3SRTA 2ZVOB 1OCXA 2H8PD 2WSCJ 3EFGA 1PP9D 2OYHA 2IBZD 3IN6A 3AE7C 4QMAA 5CJ4A 2OI5A 2JO1A 4HKZH 4XE5B 1H0TB 1FDMA 1YITP 2M0BA 3A7OA 4PJ0E 3FSCA 1S3JA 1YTZT 2A45G 2DW3A 5CCHD 4J09A 1VQLP 3V4QA 3R5BA 3CX5E 3FSYA 1GW3A 2IU9A 4PJ0H 1SSQA 1YBKA 2P58A 1N86A 2C9NY 4M99A 1S5LX 3GG2A 1Y8AA 2E5YA 3H1IJ 3JSVC 4M2AA 5BU5A 1MFTA 1H8AA 5CCHA 1SQXG 5KKZB 2GUSA 2IBZI 3L72E 2ZFCA 5TJHA 3VBMA 3BCCG 4Z1MH 3CC2P 2M5AA 2Y0CA 4D6TG 2L91A 1FJKA 4RO0A 1LTAC 2XV5A 5E79E 2ZYDA 3CPWO 3MP7B 2JP3A 1SSMA 1IFJA 2YKPA 3BSSA 2IBZE 4E79A 2FBWC 2NPSC 1EXJA 3CWBE 1X9VA 1HUCA 2FXOA 3AE1C 3JQYA 3CWBJ 4H44D 2IYOA 2TDTA 1IO4A 4WBAA 3PP5A 4R4MA 5KLVK 2UWJE 3IF4A 1HJBA 4HJGH 1OXZA 1LT9A 1KV4A 4DOJA 1KK6A 3HD7D 1BE3D 2R32A 4IL6E 2OARA 2O01N 1FAVA 1L2PA 1BGYG 1SQBJ 5CCHC 2O3JA 1URQD 1FZCC 2BEZF 4ASWA 5DG3A 3O6QB 1Q90D 2YKOA 5AW7B 1VQMP 2A06D 1JY3O 1IK7A 1NU1D 3MQGA 4N6BA 1NTZK 5KLVJ 1KTMA 2Q4JA 3AE3C 3D6YA 2R5BA 2QA4P 3Q5SA 3GOSA 2C0WA 3OGZA 1SS1A 4L75A 4C46A 1KQAA 4UB8E 2Q3EA 2M3EA 4AA7A 1L0NG 2E5TA 1JMBA 1QLED 2ICYA 1BE3E 3WU2E 3CD6P 1KILC 1AVOA 2WWWA 3BCCJ 4U3FJ 1VQKP 3GHGA 4PV1B 1URQA 4H44C 5GTIH 4HYTB 3L71J 1Z90A 3TGUE 2E76C 3SWKA 2P2UA 1FBMA 3L74E 2JDIH 2NPSA 3OA7A 2OTJP 2AEJA 2E74D 3V6IA 1FZEA 1RE3A 5L6SA 2KIKA 2V0HA 2G3AA 2KLUA 2IZ0A 2HG5D 4WY4C 1FXJA 2IC7A 1T2KD 1FZGA 4JYCA 2KK7A 2AEMA 1L4AB 5KAFH 4EGGA 3R3RA 3H6PA 4KPZA 1LTBC 4OH8B 2Q5UA 3PLNA 2YKQA 3CC4P 3I55P 1KILE 5APVA 3BRTB 2GM4A 3L72J 1FJPA 3EFFK 1SQPJ 1KORA 3PJSK 1PPJE 2AEFA 1M1JB 4N6JA 5AVQB 3AEFC 1PIXA 1KFNA 2FY8A 2LXBA 1N73C 5F42A 3CXHH 5CMZA 5E3PA 1D7MA 3UIAA 5KLVG 2N9YB 2FFDB 2WSSH 2QSIA 1L4AD 3H1HE 1J1EB 1PP9J 1LWUA 2NRGA 2WLEA 1GW4A 5KTBA 1IC2A 1G1IA 3G71P 2KNCA 1KC8Q 3L36A 1PP9G 3RL0D 2FYNC 1Q7YQ 3L4FA 3P8MC 1KQSO 2JF2A 2R3CA 1K9MQ 2N1TC 3AEGC 1VQOP 1N7SD 1J1DC 1MR9A 2KNCB 2ZYGA 2V0KA 1SVFA 4G3PA 4KHXA 2PAJA 3IGJA 1JNMA 4KPXA 1AA0A 3GQ9A 3B71A 1CI6B 3MZWB 1NTZG 1L0NK 5DJTB 2WLGA 1NYHA 1FOSF 1Z56A 1BSNA 1ZW0A 3AE4C 4J18A 1JOCA 1ZV8A 2SPZA 3KZIH 4WY4A 3BXYA 1M56D 1JTHB 4M3LA 4JBZA 1RE3C 3OAKA 3BRKX 1NTKD 1KQLA 3B5NA 5APQA 1VQ9P 2OYHB 2YXRB 1R8EA 1LXAA 3BATA 3L70J 1HM8A 4GOFA 2P10A 2JKVA 1IZNB 4HH2A 5APUA 4EI2A 1ZR4A 2OTLP 1LP1A 4WWIA 3VN0A 2RN0A 2WITA 1KK5A 3HE5A 1JMMA 2OI7A 1T3UA 3HD7B 3GQ7A 1VF5B 4YXDC 3T97A 1T8ZA 1VQ4P 4WY4B 3D6ZA 3K5BA 1P84D 2WPRA 3HSQA 3PRJA 3GQAA 2W83C 1S80A 5AW8B 3CXHI 1LGHB 4IFDK 3V4WA 3EG4A 2R44A 3A2AA 3MGNA 3W68A 1UIXA 2E76B 1SQVG 2E75B 5DJUB 3RL0B 3CMAP 2O01J 2YO2A 4OVNF 3SFDC 3VBPA 4CPGA 1NTMG 3R0SA 2GGQA 4IOIH 2OTKE 2AQ9A 3ABVC 1OZHA 3BSYA 1BCCE 1VQ6P 3H1HG 2J5UA 1UIIA 4WY4D 1XTGB 4NPEA 1YTZI 1VF5D 3H1HD 2IFNA 1M7LA 3H1LJ 3H32B 3RBZA 4H13B 3A0BE 2V0JA 5KJ7D 3L75J 1AQTA 1KGQA 1NTKG 2FYUJ 2BASA 1KB9E 4PD4D 2NPOA 3B5NC 4KNRA 2HPCA 1KZUB 1LT9C 1RY3A 2M3BA 5CJ0A 3SSUA 1SQQK 1RQUA 1M1JA 2FYNB 2OGUA 4XA4A 3H1KJ 1KB9H 2JF3A 1J1DB 2M8RA 1VQ7P 3AE5C 4R37A 1DEEG 3E1IA 1J1EC 3HJJA 3OH4A 2H89C 2I1JA 1AFOA 4ISXA 1BGYJ 3R1WA 3II6A 1FWYA 3AEDC 2IX7C 2KI7B 3AE8C 1NAYA 1KRRA 3M0DA 2IUAA 1VQPP 4M9CA 4D6TJ 3L74G 3L75G 3AEEC 3H1JD 4Y99C 1PP9E 3H1LE 1LTJB 3NMDA 3OTMA 1N7SB 2E75C 4IHFA 4IL6H 2N1TD 4RKUJ 5CCGC 3U1AA 4KJMA 3L73D 1IK9A 4IFFA 3EH0A 2IYPA 3KWCA 4GIFA 5E3QA 3CX5I 1ZR2A 2ZT9C 1RF1C 3IAOA 1NWQA 4C7NB 3AE6C 1L0LK 2HLOA 1LP1B 1JY2O 3M9QA 2FFDC 2IBZG 1PZQA 5KKZC 2I8DA 4BXLA 1EDIA 3I5CA 1NHLA 1N4IA 1SQBD 1URQB 1DIPA 4E6TA 1FZAA 1FC2C 3B5NB 3EWKA 3JCUH 3VBIA 4EYYQ 1MV8A 1IFNA 2K1AA 3M0DC 1N7LA 1QRMA 3C1LA 3FOQA 3RL0C 1PL5A 3KYQA 1BCCJ 1EC5A 1P84I 3R5AA 3L70E 3TF5A 3D70A 3L71E 2QJPC 1L0LD 1MFZA 3B4SA 3Q5RA 3HUSC 4YXWH 1Z2FA 2OQQA 3L37A 2QRXA 3IR9A 1K05A 1NH4A 4EIJA 2K9JA 4MYOA 3S9OA 1E79H 1ZMEC 2WSEJ 3TDKA 1KGTA 4HZCA 3EEVA 3WU2H 4H0LB 2H88C 1SQVD 1OVVA 1WT6A 2A45H 2HYNA 5KAFE 2B88A 2WTYA 1JO5A 3BSWA 1R5SA 1SQPG 2KSJA 5AW1B 1XATA 1GU4A 2YO3A 5CBOA 1BCCG 3L70G 2ZYAA 2Y9YA 3AE2C 1LJ2A 3L70D 3MC4A 2WSFJ 2Q3IA 2BCCE 2FYUD 4LLHA 3HE4A 1N73A 3LW5J 3N4XA 4EOTA 1GDTA 4YTPC 2ZXXA 2CPSA 3F5HA 3Q2YA 3CI9A 1QVGO 3FWLA 1AJYA 3BRVB 2Q6QA 1W2BO 4GDOA 2C0XA 2RKLA 4R4LA 4G87A 1M90Q 5ADXU 1LWUB 3RK2C 2P67A 2AXTH 2QIWA 1YP3A 3FX0A 1GTWA 3KQGA 1RH5B 5AVYB 2WMMA 1H89A 2K88A 4AUWA 2WSFH 3I3AA 1NVOA 4D6TD 1NTMD 2PRRA 4I7ZC 1SP4A 1FS0E 2Q7CA 1KN7A 2QJKB 1KRVA 5DEMA 3VP8A 1EZVI 3M9HA 3R2PA 1K8AQ 3T57A 1RF1A 1QVFO 1SQPK 1N8RQ 3L73J 2WPSA 2L5GB 3TNUA 3CCEP 3DK5A 1G2CA 2B89A 4JF7A 2I5KA 1FZCA 1ZOYC 5BU8B 1BSHA 1SQXD 2Y0DA 3FTTA 4UB6E 3L71G 3HUSA 1Q82Q 3VMYA 2H43A 2P2OA 2NZ2A 1BE3G 5DEPA 1CW5A 3NFQA 1RQVA 3GF3A 2JWDA 2OI6A 2BEQD 3OH2A 3TYYA 5AW3B 3HUSB 4L76A 3T97B 1OW8A 3AEAC 2V4HA 4R36A 1HJ0A 3MUDA 3VBKA 4EDFA 3D8VA 3V2PA 2BCCJ 1WMKA 2I1KA 1GD2E 1VQ5P 3QWOC 3KPEA 2WPVB 3H1KG 3OUPA 1PGPA 3FSXA 1OFCX 5E3RA 1SFCB 2VRSA 4IHGA 2ZT9B 5AVSB 4RJTA 3RK3C 1YP4A 2POHA 4NPFX 1OW6A 2HR3A 1RHZB 2V7QJ 3F89A 4A7PA 5B66E 1RF0A 4N6AA 1T3DA 2P7JA 2MKVA 3EQ2A 2Z5HA 3M91A 2OEFA 1KD1Q 3GLMA 3LIEA 1URQC 1CSBA 4YPCA 1H88A 4MZUA 2GA1A 1YHQP 2K9JB 2WSEH 1GK4A 1KFMA 1TDTA 4ZKPA 1KYOE 3VYIA 3TSIA 5APXA 1IFMA 3VTPC 1SSTA 1ZP0C 1L0ND 3V2NA 2OYIA 1HV9A 2B87B 2QIAA 4JPZB 3TV0A 1ZXGA 2KXPB 3E1RA 3TGUG 4JQ0D 3Q1XA 4HUSA 5KLIB 2G8YA 1NU1K 1DH3A 3L75D 4U7JA 2R5DA 3CX5D 1THJA 2A06E 2ZAEB 1NTKE 4W7YA 4EA7A 1SQBE 1OVUA 3NZ2A 3D71A 4H0LC 1KMIZ 5APTA 1NU1J 4I2LC 1MUUA 1EDLA 3IFMA 1L0NE 1EZVE 3B5ND 2QEXP 1S5LH 1AQ5A 2WVRA 5AFUU 3H32A 1KYOD 3R5CA 1LT1A 4HB1A 2E74C 2CPBA 3D98A 1JY3P 1ZLLA 1S5LE 1MZ9A 1PPJG 3NTNA 1SLQA 1W2EA 1A02J 1SQVE 1FE6A 1X79B 3U59A 5E79H 2QE7H 5B5EH 1KK4A 1CZQA 1NTZE 1A02F 1YP2A 2W6AA 4C7NA 2YIUB 3H25A 2KS1B 3IXCA 5AVWB 2NPSD 3KDPB 2Y0EA 2BCCG 1HM0A 3RL0g 5GTHE 1DD4A 4U3FE 4OGQD 3SFEC 5H2FE 1KQGB 3L71D 3OJAB 5M1BA 3JCUE 4E6UA 2FKOA 2A45I 1SQQG 1G2CB 5CBNA 4I7ZB 3A0HH 1YI2P 4IL6X 3GUEA 1YJWP 1G1JA 2FKWB 2XNXA 3M0AA 1GL2C 2KP8A 5KLVE 3LIDA 1YJ9P 2JEEA 2VD4A 2JWAA 1PFIA 4N27A 5TISE 1EDJA 1Q81Q 4M98A 2OEGA 3A0HE 3OW5A 1DD3A 3HTKB 3OH0A 1Q2NA 2KLVA 1SQPD 1SFCC 1WRGA 4ZNCA 1SQQE 4KNXA 3RBXA 2YMKA 1ZRTD 2V7QH 2B9BA 5CHXA 3BCCE 2WPQA 2HPCB 5EFWB 5AVRB 3FXDA 3V5BA 1LNQA 1BE3J 1NTMK 3A3YB 1NTZD 3F1XA 1GU5A 4ZKUA 3KWEA 3M06A 1RE4A 2HODA 3Q3DA 1G97A 5AW6B 3CCQP 5CCGA 3WUVA 1SQVJ 2V0LA 3FSBA 3WUUA 1EDKA 3GHGC 5GTIE 1QL1A 2RMZA 2W8ZA 1HBWA 1EZVG 1T6AA 3GF7A 2OYHC 3OH3A 1EZVD 3AE9C 5AW9B 3H1KD 2E42A 4EQYA 1YQ4C 2QG4A 3TWDA 1S4XA 1N7SA 3CCSP 1OVRA 3Q1MA 4I6MC 2XZRA 3V2RA 3CCRP 5KLVD 3P1BA 1EQ7A 1LTGC 1Y47A 2AXTE 3BVHA 4HZDA 3R3IA 1KB9D 4PD4E 4Y99B 3H1LG 2QM8A 1M1KQ 2KUBA 3OH1A 1ZN5A 3P8CD 1FZCB 1JY2P 1JUNA 2IPPA 5KAIH 1FOSE 3L73G 1HVVA 1SQXE 1RF1B 3NXSA 3RK3D 2E74B 2WLFA 3TISA 4AAWA 3FS8A 2ZVNB 1BGYE 1LTJA 2WQYC 2QM7A 3P47A 3L74D 1HGVA 2K9YA 4KT0J 3ITKA 1XTCC 2M5AB 3GQ8A 1QRGA 1NOHA 1HM9A 3SUCA 1RF0C 3PH0A 1SQBG 5KLIC 3RGUA 3O6QA 3VMAA 4N69A 1LTSC 3MUDC 4M28A 1Y9BA 1IFPA 3RK2D 1P84E 1OIPA 4OGQC 1T3JA 5AW4B 3R2WA 4H44B 2FFDA 1L0LE 4BRYA 1N7SC 1KQFB 1USEA 1XHDA 3L72D 2WZ7A 2QKXA 1QGKB 1L4AA 2LR2A 2KYVA 3HE5B 4WVZA 3HE4B 1W5CE 3HD7A 1K04A 3SWFA 3TK1A 4E75A 3A5TA 1OWAA 2O1JA 5AVZB 2Z5IA 1SQQJ 2WT7B 1S9KD 1QEXA 4I1LA 1R5LA 2W90A 2PFXA 1NU1G 1YQ3C 3ZDMA 4ASVA 1M8OB 3VBJA 3KHUA 2WT7A 2IDBA 2CK3H 1S2EA 2RH0A 1KILA 5B66H 2W27A 2PP6A 3MQHA 2Q1KA 3CCVP 1OX3A 1QRLA 3I3XA 3AEBC 4M2BA 3N7NA 1LTIC 4GKGA 3TGUJ
chains in the Genus database with same CATH topology
1MR7A 4N6AA 3VBNA 1NGMB 1T3DA 3EG4A 3SRTA 2MKVA 1UIXA 1OCXA 2E76B 3G9RA 2OEFA 2E75B 2WSCJ 3GLMA 2O01J 4H0LD 1JB0J 3IN6A 3SFDC 3VBPA 3AE7C 2OI5A 4AC3A 2JO1A 4MZUA 4HCQA 3R0SA 2GGQA 3OU9A 2AQ9A 1TDTA 3ABVC 3BSYA 5L6VA 2J5UA 1VF5D 1SSTA 1ZP0C 2IU8A 1HV9A 4PV1C 3FSCA 3TIOA 4H13B 2QIAA 3TV0A 4J09A 2V0JA 1KGQA 5AFUV 3V4EA 4KQLA 3Q1XA 2NPOA 3R5BA 4HUSA 3FSYA 5L8RJ 2G8YA 4KNRA 2IU9A 1TU3F 4U7JA 1SSQA 1THJA 1G95A 4M99A 1S1CX 1RQUA 1S5LX 4EA7A 3NZ2A 3D71A 4H0LC 1KMIZ 2WLCA 3AECC 4M2AA 2JF3A 3AE5C 3R5DA 3VBMA 4R37A 3HJJA 4Z1MH 2H89C 5AFUU 2E75D 3R5CA 4ISXA 2E76D 3R1WA 4OGQB 1FWYA 3AEDC 2E74C 2JP3A 3D98A 1SSMA 3AE8C 1KRRA 3BSSA 4E79A 2FBWC 4H7OA 2IUAA 1EXJA 4M9CA 1V3WA 4G3QA 3AEEC 3VBLA 4EAAA 3AE1C 3JQYA 4H44D 1QQ0A 2TDTA 4XFJA 3OTMA 1KK4A 2E75C 4IHFA 4R4MA 1YP2A 4RKUJ 3EH0A 3H25A 1MKMA 3IXCA 3KWCA 5E3QA 1ZRTE 2ZT9C 1KK6A 4E1KA 1HM0A 3RL0g 1DD4A 3IAOA 4OGQD 3AE6C 3SFEC 1KQGB 5M1BA 3ST8A 2D2CB 5KKZC 4E6UA 2FKOA 2BEZF 5U2KA 1EXIA 5DG3A 3KWDA 1DIPA 4I7ZB 4MFGA 1Q90D 4E6TA 4IL6X 3GUEA 1IK7A 3EWKA 3VBIA 3MQGA 1VF5C 4N6BA 1KTMA 2Q4JA 3AE3C 3Q5PA 3D6YA 2GGOA 2VD4A 4N27A 2W0WA 3Q5SA 3GOSA 1QRMA 4M98A 3FOQA 2OEGA 2QJKC 1PL5A 1KQAA 3OW5A 3SPTA 1DD3A 3OTZA 3R5AA 4AA7A 3TDTA 3D70A 2QJPC 2ICYA 3Q5RA 4KNXA 1PV3A 4EABA 2OQQA 2YMKA 4G3SA 1K05A 4MYOA 3S9OA 1ZMEC 2WSEJ 4PV1B 3F1XA 1KGTA 4HZCA 3EEVA 4H44C 2FXPA 4H0LB 1Z90A 3KWEA 2H88C 2E76C 3Q3DA 3GVDA 1G97A 3BSWA 2E74D 1MRLA 4H13C 5L6SA 1OMIA 2V0LA 2V0HA 3FSBA 2G3AA 3DJ4A 1QRFA 1XATA 3PMOA 1FXJA 2IC7A 1FDIA 3GF7A 2XATA 4EGGA 3AE2C 3R3RA 3R4YA 5ADXV 3MC4A 4KPZA 2WSFJ 3AE9C 4EQYA 4TT3H 1YQ4C 3LW5J 3TWDA 4Y28J 1KILE 2ZT9D 3ECTA 3Q1MA 2D2CD 4YTPC 1HF9A 3P1BA 3R8YA 3Q2YA 4DCLA 1AJYA 4HZDA 1KORA 2QJYC 3R3IA 2QIVX 3VNPA 3GMAA 4GDOA 4IHHA 2W0VA 3AEFC 1PIXA 4EA8A 4R4LA 4H13D 5F42A 4G87A 5ADXU 5E3PA 3DHOA 3C8VA 4R7PA 2QIWA 1YP3A 2QSIA 2YIUC 1VL2A 2WLEA 3I3AA 4I7ZC 2E74B 2WLFA 3TISA 4AAWA 3FS8A 1KRVA 2V0IA 1OW7A 5DEMA 2WQYC 2D2CC 2FYNC 3P47A 1V67A 3T57A 2K9YA 2JF2A 1J2ZA 4KT0J 3AEGC 1QRGA 3FGAD 1MR9A 3DK5A 2V0KA 1GMJA 1HM9A 4G3PA 3IGJA 2VHEA 5KLIC 4EA9A 4KPXA 3O6QA 4N69A 2I5KA 3B71A 1ZOYC 4M28A 1Y9BA 1FDOA 3RK3E 4OGQC 2WLGA 2ICXA 3R2WA 1NYHA 4H44B 2RIJA 3FTTA 1KQFB 2P2OA 1XHDA 2NZ2A 3AE4C 4J18A 5DEPA 2QKXA 4PV1D 3BXYA 1RQVA 3GF3A 2OI6A 2BEQD 1QREA 3T97B 1K04A 1OW8A 4E75A 3BRKX 3AEAC 4R36A 1HJ0A 3VBKA 3D8VA 1R8EA 1LXAA 3FWWA 1WMKA 2WLDA 1HM8A 2P10A 1YQ3C 3VBJA 4HURA 2IDBA 4K6RA 4FCEA 3CJ8A 2WPVB 1KHRA 3OUPA 1KK5A 2OI7A 3FSXA 3MQHA 1KRUA 5E3RA 1U57A 1VF5B 4IHGA 3TK8A 4YXDC 2ZT9B 1QRLA 3D6ZA 3I3XA 1YP4A 3HSQA 1OW6A 3AEBC 3BFPA 2V7QJ 4M2BA 1S80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE J;  1V3W A;  4G3Q A;  5DEM A;  1MR7 A;  2FYN C;  3VBL A;  4EAA A;  4PV1 B;  1V67 A;  3F1X A;  1KGT A;  3P47 A;  3JQY A;  2K9Y A;  1T3D A;  3EEV A;  3EG4 A;  2JF2 A;  4HZC A;  3SRT A;  1J2Z A;  4KT0 J;  1QQ0 A;  4H0L B;  2TDT A;  1Z90 A;  1OCX A;  3KWE A;  4N6A A;  2E76 B;  3OTM A;  2OEF A;  1QRG A;  2E75 B;  1KK4 A;  4IHF A;  1MR9 A;  3DK5 A;  2WSC J;  2V0K A;  3GVD A;  1HM9 A;  2O01 J;  1G97 A;  4G3P A;  1YP2 A;  3IGJ A;  4RKU J;  2VHE A;  3BSW A;  5KLI C;  1JB0 J;  4EA9 A;  1MRL A;  4KPX A;  3VBP A;  3EH0 A;  4N69 A;  2OI5 A;  4AC3 A;  2V0L A;  4MZU A;  5L6S A;  2V0H A;  3FSB A;  3IXC A;  3KWC A;  2I5K A;  3DJ4 A;  4HCQ A;  3R0S A;  4M28 A;  1QRF A;  2GGQ A;  1XAT A;  3OU9 A;  5E3Q A;  1ZRT E;  3PMO A;  1FXJ A;  1KK6 A;  2WLG A;  4E1K A;  2AQ9 A;  1TDT A;  2ICX A;  3R2W A;  2IC7 A;  4H44 B;  1HM0 A;  3BSY A;  2RIJ A;  5L6V A;  3FTT A;  3VBN A;  2XAT A;  4EGG A;  3R3R A;  3ST8 A;  2P2O A;  1XHD A;  5ADX V;  3MC4 A;  2D2C B;  4J18 A;  4KPZ A;  1SST A;  5DEP A;  2WSF J;  2IU8 A;  2QKX A;  5KKZ C;  1HV9 A;  4EQY A;  4E6U A;  3FSC A;  3TIO A;  2FKO A;  4H13 B;  2QIA A;  3TV0 A;  3LW5 J;  3BXY A;  4J09 A;  4Y28 J;  3TWD A;  2OI6 A;  5U2K A;  1QRE A;  2V0J A;  3ECT A;  5DG3 A;  1KGQ A;  3KWD A;  5AFU V;  4E75 A;  3BRK X;  4MFG A;  4I7Z B;  3V4E A;  1Q90 D;  3P1B A;  4KQL A;  3Q1X A;  2NPO A;  3R5B A;  4HUS A;  3FSY A;  3R8Y A;  5L8R J;  4E6T A;  3T57 A;  4KNR A;  4DCL A;  4IL6 X;  3GUE A;  2IU9 A;  4R36 A;  1SSQ A;  4HZD A;  3VBI A;  2QJY C;  3VBK A;  3D8V A;  3MQG A;  3R3I A;  1THJ A;  1G95 A;  2QIV X;  4N6B A;  1LXA A;  4M99 A;  3VNP A;  1S5L X;  3FWW A;  4EA7 A;  2Q4J A;  3NZ2 A;  2WLD A;  1HM8 A;  4IHH A;  2GGO A;  2W0V A;  2VD4 A;  4N27 A;  2WLC A;  4EA8 A;  2W0W A;  5F42 A;  3VBJ A;  4G87 A;  3GOS A;  5ADX U;  1QRM A;  4M98 A;  4M2A A;  3FOQ A;  5E3P A;  2OEG A;  2QJK C;  3C8V A;  2JF3 A;  3DHO A;  4HUR A;  4R7P A;  4K6R A;  4FCE A;  1KQA A;  3OW5 A;  3SPT A;  2QIW A;  1YP3 A;  3OTZ A;  3CJ8 A;  3R5D A;  2QSI A;  2WPV B;  3VBM A;  3R5A A;  4R37 A;  2YIU C;  4AA7 A;  1KHR A;  3TDT A;  3OUP A;  1KK5 A;  2QJP C;  2OI7 A;  3FSX A;  3HJJ A;  3MQH A;  2ICY A;  1KRU A;  5E3R A;  5AFU U;  1VF5 B;  4IHG A;  3R5C A;  4KNX A;  3TK8 A;  2WLE A;  3I3A A;  4ISX A;  2ZT9 B;  4EAB A;  3R1W A;  4OGQ B;  1QRL A;  3I3X A;  4G3S A;  1FWY A;  1YP4 A;  2E74 B;  2WLF A;  3HSQ A;  3TIS A;  3D98 A;  1SSM A;  4AAW A;  3BFP A;  4MYO A;  4M2B A;  1KRR A;  3FS8 A;  1S80 A;  3BSS A;  4E79 A;  1KRV A;  4H7O A;  2IUA A;  2V0I A;  4M9C A; 
#chains in the Genus database with same CATH topology
 2FYU K;  1J2J B;  4AQR D;  3G9R A;  1L4A C;  2FXM A;  4WB4 A;  2KS1 A;  4H0L D;  4DJG A;  1K73 Q;  3O8Z A;  1JB0 J;  1BGY D;  2LKM A;  4AC3 A;  3GHG B;  4HCQ A;  3A0B H;  3OU9 A;  1KIL B;  5APY A;  3WUT A;  5L6V A;  2N1T B;  1CI6 A;  3MIW A;  4O9B A;  3L72 G;  5K5G B;  2IU8 A;  2PGD A;  4PV1 C;  3TIO A;  2KSE A;  3CL3 D;  3P8C E;  1KYO H;  1KB9 I;  1QL2 A;  5AFU V;  3V4E A;  4N3Y B;  3RK3 B;  4KQL A;  5L8R J;  1PPJ D;  1TU3 F;  2H7H A;  2QJY B;  1NTM J;  1G95 A;  5AVV B;  1S1C X;  3CXH D;  1L0N J;  3MTU E;  2WLC A;  1KIL D;  3AEC C;  1AVY A;  2J58 A;  2OYO A;  1X0T A;  3G4S P;  3CX5 H;  2K37 A;  3H1K E;  2N9B A;  3R5D A;  1IFD A;  1SQV K;  1LTT C;  2XU6 A;  3TNU B;  1BCC D;  3C9I A;  4K35 A;  2E75 D;  3CLQ A;  3CC7 P;  2E76 D;  2W6B A;  5BVZ A;  4OGQ B;  1SQB K;  1FU1 A;  1VQ8 P;  1M8N A;  5C39 A;  1DEB A;  1JCC A;  1LWU C;  1M57 D;  2GUV A;  3RK2 B;  4H7O A;  1SQX J;  1M1J C;  1V3W A;  4G3Q A;  3LW5 H;  3VBL A;  4EAA A;  4C7R A;  3HRN A;  4DZO A;  1QQ0 A;  3H1I G;  3H1H J;  4XFJ A;  3TGU D;  3H1L D;  2ZXE B;  1SQX K;  1USD A;  5GTH H;  4L74 A;  3U1C A;  1NKN A;  4B86 A;  1IJD B;  1JY2 N;  5H2F H;  3JC2 2;  3H1J G;  3FWN A;  4RES B;  1MKM A;  4L73 A;  4ZMD A;  1ZRT E;  2P1J A;  2ZJS E;  4E1K A;  3WMM 0;  5B5E E;  1NAF A;  1SQP E;  3ST8 A;  3MHV A;  2D2C B;  2J59 M;  3BAS A;  1RE4 C;  3OW2 O;  1YIJ P;  1SFC A;  5U2K A;  1EXI A;  3CCL P;  4MN4 C;  3CCJ P;  3KWD A;  4MFG A;  2W6J H;  1Q86 Q;  4LC1 A;  1YYC A;  1JEK A;  3L75 E;  1NKZ B;  2KOG A;  3KXD A;  1VF5 C;  1NO4 A;  3Q5P A;  1HH0 A;  2GGO A;  2XND H;  2W0W A;  2QJK C;  5KJ7 C;  3L74 J;  3SPT A;  3V2Q A;  1KYO I;  4IFM A;  3OTZ A;  2OYI B;  3TDT A;  2IFM A;  4U3F D;  2AXC A;  3QH9 A;  5TIS H;  1PV3 A;  4EAB A;  3CCU P;  3S4R A;  4G3S A;  5AVX B;  3CCM P;  2HOD B;  4UB8 H;  3L35 A;  2Q9I A;  2YNY A;  2E43 A;  1L0S A;  2HFE D;  2FXP A;  1N73 B;  1VDF A;  1GL2 D;  3GVD A;  1NTZ J;  2WSC H;  4NPD A;  2K3R A;  1VQN P;  3VOP A;  3H1J E;  5AW0 B;  3B8E B;  1MRL A;  4H13 C;  2MJZ A;  1OMI A;  3DJ4 A;  1QRF A;  1GL2 B;  4BRY B;  3VMX A;  3PMO A;  4D6T E;  3HTK A;  1SQQ D;  2YMY A;  1FDI A;  4AYC A;  1LTJ C;  1LT9 B;  2XAT A;  5AVT B;  5AVU B;  1SFC D;  3R4Y A;  5ADX V;  3P32 A;  1X8Y A;  4TT3 H;  1NJI Q;  3CWB G;  1JTH A;  2KB7 P;  4PD4 H;  1HGZ A;  2O1K A;  4Y28 J;  2ZT9 D;  3ECT A;  2A06 G;  2D2C D;  1YJN P;  3CXH E;  2Y9Z A;  1DX7 A;  1HF9 A;  3R8Y A;  1S9K E;  4DCL A;  4W80 A;  1NU1 E;  3H1I E;  2QJY C;  5KAI E;  3P7K A;  2QIV X;  3VNP A;  3GMA A;  4GT1 A;  2Z4E A;  1QX8 A;  4PD4 I;  4IHH A;  2W0V A;  1S72 P;  4EA8 A;  4H13 D;  2LXC B;  1FZF A;  3DHO A;  3C8V A;  4R7P A;  4N78 E;  1L0L J;  2BCC D;  2FYU E;  1PGO A;  5APS A;  4GOD A;  2OYI C;  2YIU C;  1VL2 A;  3CME P;  2FYU G;  2XDJ A;  5KJ7 A;  1EWW A;  2R3S A;  3VP9 A;  4GOE A;  3L73 E;  2IZ1 A;  2V0I A;  2NPS B;  1OW7 A;  2D2C C;  3M9B A;  1V67 A;  1J2Z A;  1U7M A;  1X22 A;  1P84 H;  2QJP B;  1PGJ A;  1GL2 A;  3PTZ A;  1FZB A;  3FGA D;  1GMJ A;  1HWT C;  1JM0 A;  3S1K A;  3CWB D;  2VHE A;  3W67 A;  4EA9 A;  5APW A;  3G6E P;  3FXE A;  3HD7 C;  3BCC D;  3KZI E;  1NTK J;  3E7K A;  1FDO A;  3PHL A;  3RK3 E;  2QVA A;  1NTM E;  1GZL A;  2ICX A;  1T2K C;  3H1J J;  2RIJ A;  2O01 H;  1N2D C;  4OWF A;  5AW2 B;  2JJL A;  1NTK K;  4W7Z A;  3USS A;  2XKM A;  1PGQ A;  4PV1 D;  4N78 D;  4U3F G;  1GK6 A;  1QRE A;  1BDC A;  3G3Z A;  1AV1 A;  1HTL C;  4UB6 H;  1E5W A;  2KZJ A;  3H1I D;  4K3A A;  2N1T A;  1BDD A;  3FWW A;  2KZI A;  2B87 A;  2ITA A;  2WLD A;  1VPC A;  2JR8 A;  4DT0 A;  4TLF A;  4HUR A;  1L0L G;  4K6R A;  4FCE A;  3CJ8 A;  2C9L Y;  1H0T A;  1KHR A;  4LGD E;  3SWY A;  4DCK A;  1KRU A;  1U57 A;  3GW6 A;  3TK8 A;  4JYB A;  1JCD A;  2FYZ A;  1U7J A;  3BFP A;  3I56 P;  5CCG D;  2YXQ B;  1JY3 N;  3MD0 A;  4BWN A;  5AW5 B;  1IFI A;  1MR7 A;  3VMZ A;  3VBN A;  1NGM B;  3SRT A;  2ZVO B;  1OCX A;  2H8P D;  2WSC J;  3EFG A;  1PP9 D;  2OYH A;  2IBZ D;  3IN6 A;  3AE7 C;  4QMA A;  5CJ4 A;  2OI5 A;  2JO1 A;  4HKZ H;  4XE5 B;  1H0T B;  1FDM A;  1YIT P;  2M0B A;  3A7O A;  4PJ0 E;  3FSC A;  1S3J A;  1YTZ T;  2A45 G;  2DW3 A;  5CCH D;  4J09 A;  1VQL P;  3V4Q A;  3R5B A;  3CX5 E;  3FSY A;  1GW3 A;  2IU9 A;  4PJ0 H;  1SSQ A;  1YBK A;  2P58 A;  1N86 A;  2C9N Y;  4M99 A;  1S5L X;  3GG2 A;  1Y8A A;  2E5Y A;  3H1I J;  3JSV C;  4M2A A;  5BU5 A;  1MFT A;  1H8A A;  5CCH A;  1SQX G;  5KKZ B;  2GUS A;  2IBZ I;  3L72 E;  2ZFC A;  5TJH A;  3VBM A;  3BCC G;  4Z1M H;  3CC2 P;  2M5A A;  2Y0C A;  4D6T G;  2L91 A;  1FJK A;  4RO0 A;  1LTA C;  2XV5 A;  5E79 E;  2ZYD A;  3CPW O;  3MP7 B;  2JP3 A;  1SSM A;  1IFJ A;  2YKP A;  3BSS A;  2IBZ E;  4E79 A;  2FBW C;  2NPS C;  1EXJ A;  3CWB E;  1X9V A;  1HUC A;  2FXO A;  3AE1 C;  3JQY A;  3CWB J;  4H44 D;  2IYO A;  2TDT A;  1IO4 A;  4WBA A;  3PP5 A;  4R4M A;  5KLV K;  2UWJ E;  3IF4 A;  1HJB A;  4HJG H;  1OXZ A;  1LT9 A;  1KV4 A;  4DOJ A;  1KK6 A;  3HD7 D;  1BE3 D;  2R32 A;  4IL6 E;  2OAR A;  2O01 N;  1FAV A;  1L2P A;  1BGY G;  1SQB J;  5CCH C;  2O3J A;  1URQ D;  1FZC C;  2BEZ F;  4ASW A;  5DG3 A;  3O6Q B;  1Q90 D;  2YKO A;  5AW7 B;  1VQM P;  2A06 D;  1JY3 O;  1IK7 A;  1NU1 D;  3MQG A;  4N6B A;  1NTZ K;  5KLV J;  1KTM A;  2Q4J A;  3AE3 C;  3D6Y A;  2R5B A;  2QA4 P;  3Q5S A;  3GOS A;  2C0W A;  3OGZ A;  1SS1 A;  4L75 A;  4C46 A;  1KQA A;  4UB8 E;  2Q3E A;  2M3E A;  4AA7 A;  1L0N G;  2E5T A;  1JMB A;  1QLE D;  2ICY A;  1BE3 E;  3WU2 E;  3CD6 P;  1KIL C;  1AVO A;  2WWW A;  3BCC J;  4U3F J;  1VQK P;  3GHG A;  4PV1 B;  1URQ A;  4H44 C;  5GTI H;  4HYT B;  3L71 J;  1Z90 A;  3TGU E;  2E76 C;  3SWK A;  2P2U A;  1FBM A;  3L74 E;  2JDI H;  2NPS A;  3OA7 A;  2OTJ P;  2AEJ A;  2E74 D;  3V6I A;  1FZE A;  1RE3 A;  5L6S A;  2KIK A;  2V0H A;  2G3A A;  2KLU A;  2IZ0 A;  2HG5 D;  4WY4 C;  1FXJ A;  2IC7 A;  1T2K D;  1FZG A;  4JYC A;  2KK7 A;  2AEM A;  1L4A B;  5KAF H;  4EGG A;  3R3R A;  3H6P A;  4KPZ A;  1LTB C;  4OH8 B;  2Q5U A;  3PLN A;  2YKQ A;  3CC4 P;  3I55 P;  1KIL E;  5APV A;  3BRT B;  2GM4 A;  3L72 J;  1FJP A;  3EFF K;  1SQP J;  1KOR A;  3PJS K;  1PPJ E;  2AEF A;  1M1J B;  4N6J A;  5AVQ B;  3AEF C;  1PIX A;  1KFN A;  2FY8 A;  2LXB A;  1N73 C;  5F42 A;  3CXH H;  5CMZ A;  5E3P A;  1D7M A;  3UIA A;  5KLV G;  2N9Y B;  2FFD B;  2WSS H;  2QSI A;  1L4A D;  3H1H E;  1J1E B;  1PP9 J;  1LWU A;  2NRG A;  2WLE A;  1GW4 A;  5KTB A;  1IC2 A;  1G1I A;  3G71 P;  2KNC A;  1KC8 Q;  3L36 A;  1PP9 G;  3RL0 D;  2FYN C;  1Q7Y Q;  3L4F A;  3P8M C;  1KQS O;  2JF2 A;  2R3C A;  1K9M Q;  2N1T C;  3AEG C;  1VQO P;  1N7S D;  1J1D C;  1MR9 A;  2KNC B;  2ZYG A;  2V0K A;  1SVF A;  4G3P A;  4KHX A;  2PAJ A;  3IGJ A;  1JNM A;  4KPX A;  1AA0 A;  3GQ9 A;  3B71 A;  1CI6 B;  3MZW B;  1NTZ G;  1L0N K;  5DJT B;  2WLG A;  1NYH A;  1FOS F;  1Z56 A;  1BSN A;  1ZW0 A;  3AE4 C;  4J18 A;  1JOC A;  1ZV8 A;  2SPZ A;  3KZI H;  4WY4 A;  3BXY A;  1M56 D;  1JTH B;  4M3L A;  4JBZ A;  1RE3 C;  3OAK A;  3BRK X;  1NTK D;  1KQL A;  3B5N A;  5APQ A;  1VQ9 P;  2OYH B;  2YXR B;  1R8E A;  1LXA A;  3BAT A;  3L70 J;  1HM8 A;  4GOF A;  2P10 A;  2JKV A;  1IZN B;  4HH2 A;  5APU A;  4EI2 A;  1ZR4 A;  2OTL P;  1LP1 A;  4WWI A;  3VN0 A;  2RN0 A;  2WIT A;  1KK5 A;  3HE5 A;  1JMM A;  2OI7 A;  1T3U A;  3HD7 B;  3GQ7 A;  1VF5 B;  4YXD C;  3T97 A;  1T8Z A;  1VQ4 P;  4WY4 B;  3D6Z A;  3K5B A;  1P84 D;  2WPR A;  3HSQ A;  3PRJ A;  3GQA A;  2W83 C;  1S80 A;  5AW8 B;  3CXH I;  1LGH B;  4IFD K;  3V4W A;  3EG4 A;  2R44 A;  3A2A A;  3MGN A;  3W68 A;  1UIX A;  2E76 B;  1SQV G;  2E75 B;  5DJU B;  3RL0 B;  3CMA P;  2O01 J;  2YO2 A;  4OVN F;  3SFD C;  3VBP A;  4CPG A;  1NTM G;  3R0S A;  2GGQ A;  4IOI H;  2OTK E;  2AQ9 A;  3ABV C;  1OZH A;  3BSY A;  1BCC E;  1VQ6 P;  3H1H G;  2J5U A;  1UII A;  4WY4 D;  1XTG B;  4NPE A;  1YTZ I;  1VF5 D;  3H1H D;  2IFN A;  1M7L A;  3H1L J;  3H32 B;  3RBZ A;  4H13 B;  3A0B E;  2V0J A;  5KJ7 D;  3L75 J;  1AQT A;  1KGQ A;  1NTK G;  2FYU J;  2BAS A;  1KB9 E;  4PD4 D;  2NPO A;  3B5N C;  4KNR A;  2HPC A;  1KZU B;  1LT9 C;  1RY3 A;  2M3B A;  5CJ0 A;  3SSU A;  1SQQ K;  1RQU A;  1M1J A;  2FYN B;  2OGU A;  4XA4 A;  3H1K J;  1KB9 H;  2JF3 A;  1J1D B;  2M8R A;  1VQ7 P;  3AE5 C;  4R37 A;  1DEE G;  3E1I A;  1J1E C;  3HJJ A;  3OH4 A;  2H89 C;  2I1J A;  1AFO A;  4ISX A;  1BGY J;  3R1W A;  3II6 A;  1FWY A;  3AED C;  2IX7 C;  2KI7 B;  3AE8 C;  1NAY A;  1KRR A;  3M0D A;  2IUA A;  1VQP P;  4M9C A;  4D6T J;  3L74 G;  3L75 G;  3AEE C;  3H1J D;  4Y99 C;  1PP9 E;  3H1L E;  1LTJ B;  3NMD A;  3OTM A;  1N7S B;  2E75 C;  4IHF A;  4IL6 H;  2N1T D;  4RKU J;  5CCG C;  3U1A A;  4KJM A;  3L73 D;  1IK9 A;  4IFF A;  3EH0 A;  2IYP A;  3KWC A;  4GIF A;  5E3Q A;  3CX5 I;  1ZR2 A;  2ZT9 C;  1RF1 C;  3IAO A;  1NWQ A;  4C7N B;  3AE6 C;  1L0L K;  2HLO A;  1LP1 B;  1JY2 O;  3M9Q A;  2FFD C;  2IBZ G;  1PZQ A;  5KKZ C;  2I8D A;  4BXL A;  1EDI A;  3I5C A;  1NHL A;  1N4I A;  1SQB D;  1URQ B;  1DIP A;  4E6T A;  1FZA A;  1FC2 C;  3B5N B;  3EWK A;  3JCU H;  3VBI A;  4EYY Q;  1MV8 A;  1IFN A;  2K1A A;  3M0D C;  1N7L A;  1QRM A;  3C1L A;  3FOQ A;  3RL0 C;  1PL5 A;  3KYQ A;  1BCC J;  1EC5 A;  1P84 I;  3R5A A;  3L70 E;  3TF5 A;  3D70 A;  3L71 E;  2QJP C;  1L0L D;  1MFZ A;  3B4S A;  3Q5R A;  3HUS C;  4YXW H;  1Z2F A;  2OQQ A;  3L37 A;  2QRX A;  3IR9 A;  1K05 A;  1NH4 A;  4EIJ A;  2K9J A;  4MYO A;  3S9O A;  1E79 H;  1ZME C;  2WSE J;  3TDK A;  1KGT A;  4HZC A;  3EEV A;  3WU2 H;  4H0L B;  2H88 C;  1SQV D;  1OVV A;  1WT6 A;  2A45 H;  2HYN A;  5KAF E;  2B88 A;  2WTY A;  1JO5 A;  3BSW A;  1R5S A;  1SQP G;  2KSJ A;  5AW1 B;  1XAT A;  1GU4 A;  2YO3 A;  5CBO A;  1BCC G;  3L70 G;  2ZYA A;  2Y9Y A;  3AE2 C;  1LJ2 A;  3L70 D;  3MC4 A;  2WSF J;  2Q3I A;  2BCC E;  2FYU D;  4LLH A;  3HE4 A;  1N73 A;  3LW5 J;  3N4X A;  4EOT A;  1GDT A;  4YTP C;  2ZXX A;  2CPS A;  3F5H A;  3Q2Y A;  3CI9 A;  1QVG O;  3FWL A;  1AJY A;  3BRV B;  2Q6Q A;  1W2B O;  4GDO A;  2C0X A;  2RKL A;  4R4L A;  4G87 A;  1M90 Q;  5ADX U;  1LWU B;  3RK2 C;  2P67 A;  2AXT H;  2QIW A;  1YP3 A;  3FX0 A;  1GTW A;  3KQG A;  1RH5 B;  5AVY B;  2WMM A;  1H89 A;  2K88 A;  4AUW A;  2WSF H;  3I3A A;  1NVO A;  4D6T D;  1NTM D;  2PRR A;  4I7Z C;  1SP4 A;  1FS0 E;  2Q7C A;  1KN7 A;  2QJK B;  1KRV A;  5DEM A;  3VP8 A;  1EZV I;  3M9H A;  3R2P A;  1K8A Q;  3T57 A;  1RF1 A;  1QVF O;  1SQP K;  1N8R Q;  3L73 J;  2WPS A;  2L5G B;  3TNU A;  3CCE P;  3DK5 A;  1G2C A;  2B89 A;  4JF7 A;  2I5K A;  1FZC A;  1ZOY C;  5BU8 B;  1BSH A;  1SQX D;  2Y0D A;  3FTT A;  4UB6 E;  3L71 G;  3HUS A;  1Q82 Q;  3VMY A;  2H43 A;  2P2O A;  2NZ2 A;  1BE3 G;  5DEP A;  1CW5 A;  3NFQ A;  1RQV A;  3GF3 A;  2JWD A;  2OI6 A;  2BEQ D;  3OH2 A;  3TYY A;  5AW3 B;  3HUS B;  4L76 A;  3T97 B;  1OW8 A;  3AEA C;  2V4H A;  4R36 A;  1HJ0 A;  3MUD A;  3VBK A;  4EDF A;  3D8V A;  3V2P A;  2BCC J;  1WMK A;  2I1K A;  1GD2 E;  1VQ5 P;  3QWO C;  3KPE A;  2WPV B;  3H1K G;  3OUP A;  1PGP A;  3FSX A;  1OFC X;  5E3R A;  1SFC B;  2VRS A;  4IHG A;  2ZT9 B;  5AVS B;  4RJT A;  3RK3 C;  1YP4 A;  2POH A;  4NPF X;  1OW6 A;  2HR3 A;  1RHZ B;  2V7Q J;  3F89 A;  4A7P A;  5B66 E;  1RF0 A;  4N6A A;  1T3D A;  2P7J A;  2MKV A;  3EQ2 A;  2Z5H A;  3M91 A;  2OEF A;  1KD1 Q;  3GLM A;  3LIE A;  1URQ C;  1CSB A;  4YPC A;  1H88 A;  4MZU A;  2GA1 A;  1YHQ P;  2K9J B;  2WSE H;  1GK4 A;  1KFM A;  1TDT A;  4ZKP A;  1KYO E;  3VYI A;  3TSI A;  5APX A;  1IFM A;  3VTP C;  1SST A;  1ZP0 C;  1L0N D;  3V2N A;  2OYI A;  1HV9 A;  2B87 B;  2QIA A;  4JPZ B;  3TV0 A;  1ZXG A;  2KXP B;  3E1R A;  3TGU G;  4JQ0 D;  3Q1X A;  4HUS A;  5KLI B;  2G8Y A;  1NU1 K;  1DH3 A;  3L75 D;  4U7J A;  2R5D A;  3CX5 D;  1THJ A;  2A06 E;  2ZAE B;  1NTK E;  4W7Y A;  4EA7 A;  1SQB E;  1OVU A;  3NZ2 A;  3D71 A;  4H0L C;  1KMI Z;  5APT A;  1NU1 J;  4I2L C;  1MUU A;  1EDL A;  3IFM A;  1L0N E;  1EZV E;  3B5N D;  2QEX P;  1S5L H;  1AQ5 A;  2WVR A;  5AFU U;  3H32 A;  1KYO D;  3R5C A;  1LT1 A;  4HB1 A;  2E74 C;  2CPB A;  3D98 A;  1JY3 P;  1ZLL A;  1S5L E;  1MZ9 A;  1PPJ G;  3NTN A;  1SLQ A;  1W2E A;  1A02 J;  1SQV E;  1FE6 A;  1X79 B;  3U59 A;  5E79 H;  2QE7 H;  5B5E H;  1KK4 A;  1CZQ A;  1NTZ E;  1A02 F;  1YP2 A;  2W6A A;  4C7N A;  2YIU B;  3H25 A;  2KS1 B;  3IXC A;  5AVW B;  2NPS D;  3KDP B;  2Y0E A;  2BCC G;  1HM0 A;  3RL0 g;  5GTH E;  1DD4 A;  4U3F E;  4OGQ D;  3SFE C;  5H2F E;  1KQG B;  3L71 D;  3OJA B;  5M1B A;  3JCU E;  4E6U A;  2FKO A;  2A45 I;  1SQQ G;  1G2C B;  5CBN A;  4I7Z B;  3A0H H;  1YI2 P;  4IL6 X;  3GUE A;  1YJW P;  1G1J A;  2FKW B;  2XNX A;  3M0A A;  1GL2 C;  2KP8 A;  5KLV E;  3LID A;  1YJ9 P;  2JEE A;  2VD4 A;  2JWA A;  1PFI A;  4N27 A;  5TIS E;  1EDJ A;  1Q81 Q;  4M98 A;  2OEG A;  3A0H E;  3OW5 A;  1DD3 A;  3HTK B;  3OH0 A;  1Q2N A;  2KLV A;  1SQP D;  1SFC C;  1WRG A;  4ZNC A;  1SQQ E;  4KNX A;  3RBX A;  2YMK A;  1ZRT D;  2V7Q H;  2B9B A;  5CHX A;  3BCC E;  2WPQ A;  2HPC B;  5EFW B;  5AVR B;  3FXD A;  3V5B A;  1LNQ A;  1BE3 J;  1NTM K;  3A3Y B;  1NTZ D;  3F1X A;  1GU5 A;  4ZKU A;  3KWE A;  3M06 A;  1RE4 A;  2HOD A;  3Q3D A;  1G97 A;  5AW6 B;  3CCQ P;  5CCG A;  3WUV A;  1SQV J;  2V0L A;  3FSB A;  3WUU A;  1EDK A;  3GHG C;  5GTI E;  1QL1 A;  2RMZ A;  2W8Z A;  1HBW A;  1EZV G;  1T6A A;  3GF7 A;  2OYH C;  3OH3 A;  1EZV D;  3AE9 C;  5AW9 B;  3H1K D;  2E42 A;  4EQY A;  1YQ4 C;  2QG4 A;  3TWD A;  1S4X A;  1N7S A;  3CCS P;  1OVR A;  3Q1M A;  4I6M C;  2XZR A;  3V2R A;  3CCR P;  5KLV D;  3P1B A;  1EQ7 A;  1LTG C;  1Y47 A;  2AXT E;  3BVH A;  4HZD A;  3R3I A;  1KB9 D;  4PD4 E;  4Y99 B;  3H1L G;  2QM8 A;  1M1K Q;  2KUB A;  3OH1 A;  1ZN5 A;  3P8C D;  1FZC B;  1JY2 P;  1JUN A;  2IPP A;  5KAI H;  1FOS E;  3L73 G;  1HVV A;  1SQX E;  1RF1 B;  3NXS A;  3RK3 D;  2E74 B;  2WLF A;  3TIS A;  4AAW A;  3FS8 A;  2ZVN B;  1BGY E;  1LTJ A;  2WQY C;  2QM7 A;  3P47 A;  3L74 D;  1HGV A;  2K9Y A;  4KT0 J;  3ITK A;  1XTC C;  2M5A B;  3GQ8 A;  1QRG A;  1NOH A;  1HM9 A;  3SUC A;  1RF0 C;  3PH0 A;  1SQB G;  5KLI C;  3RGU A;  3O6Q A;  3VMA A;  4N69 A;  1LTS C;  3MUD C;  4M28 A;  1Y9B A;  1IFP A;  3RK2 D;  1P84 E;  1OIP A;  4OGQ C;  1T3J A;  5AW4 B;  3R2W A;  4H44 B;  2FFD A;  1L0L E;  4BRY A;  1N7S C;  1KQF B;  1USE A;  1XHD A;  3L72 D;  2WZ7 A;  2QKX A;  1QGK B;  1L4A A;  2LR2 A;  2KYV A;  3HE5 B;  4WVZ A;  3HE4 B;  1W5C E;  3HD7 A;  1K04 A;  3SWF A;  3TK1 A;  4E75 A;  3A5T A;  1OWA A;  2O1J A;  5AVZ B;  2Z5I A;  1SQQ J;  2WT7 B;  1S9K D;  1QEX A;  4I1L A;  1R5L A;  2W90 A;  2PFX A;  1NU1 G;  1YQ3 C;  3ZDM A;  4ASV A;  1M8O B;  3VBJ A;  3KHU A;  2WT7 A;  2IDB A;  2CK3 H;  1S2E A;  2RH0 A;  1KIL A;  5B66 H;  2W27 A;  2PP6 A;  3MQH A;  2Q1K A;  3CCV P;  1OX3 A;  1QRL A;  3I3X A;  3AEB C;  4M2B A;  3N7N A;  1LTI C;  4GKG A;  3TGU J; 
#chains in the Genus database with same CATH homology
 1MR7 A;  4N6A A;  3VBN A;  1NGM B;  1T3D A;  3EG4 A;  3SRT A;  2MKV A;  1UIX A;  1OCX A;  2E76 B;  3G9R A;  2OEF A;  2E75 B;  2WSC J;  3GLM A;  2O01 J;  4H0L D;  1JB0 J;  3IN6 A;  3SFD C;  3VBP A;  3AE7 C;  2OI5 A;  4AC3 A;  2JO1 A;  4MZU A;  4HCQ A;  3R0S A;  2GGQ A;  3OU9 A;  2AQ9 A;  1TDT A;  3ABV C;  3BSY A;  5L6V A;  2J5U A;  1VF5 D;  1SST A;  1ZP0 C;  2IU8 A;  1HV9 A;  4PV1 C;  3FSC A;  3TIO A;  4H13 B;  2QIA A;  3TV0 A;  4J09 A;  2V0J A;  1KGQ A;  5AFU V;  3V4E A;  4KQL A;  3Q1X A;  2NPO A;  3R5B A;  4HUS A;  3FSY A;  5L8R J;  2G8Y A;  4KNR A;  2IU9 A;  1TU3 F;  4U7J A;  1SSQ A;  1THJ A;  1G95 A;  4M99 A;  1S1C X;  1RQU A;  1S5L X;  4EA7 A;  3NZ2 A;  3D71 A;  4H0L C;  1KMI Z;  2WLC A;  3AEC C;  4M2A A;  2JF3 A;  3AE5 C;  3R5D A;  3VBM A;  4R37 A;  3HJJ A;  4Z1M H;  2H89 C;  5AFU U;  2E75 D;  3R5C A;  4ISX A;  2E76 D;  3R1W A;  4OGQ B;  1FWY A;  3AED C;  2E74 C;  2JP3 A;  3D98 A;  1SSM A;  3AE8 C;  1KRR A;  3BSS A;  4E79 A;  2FBW C;  4H7O A;  2IUA A;  1EXJ A;  4M9C A;  1V3W A;  4G3Q A;  3AEE C;  3VBL A;  4EAA A;  3AE1 C;  3JQY A;  4H44 D;  1QQ0 A;  2TDT A;  4XFJ A;  3OTM A;  1KK4 A;  2E75 C;  4IHF A;  4R4M A;  1YP2 A;  4RKU J;  3EH0 A;  3H25 A;  1MKM A;  3IXC A;  3KWC A;  5E3Q A;  1ZRT E;  2ZT9 C;  1KK6 A;  4E1K A;  1HM0 A;  3RL0 g;  1DD4 A;  3IAO A;  4OGQ D;  3AE6 C;  3SFE C;  1KQG B;  5M1B A;  3ST8 A;  2D2C B;  5KKZ C;  4E6U A;  2FKO A;  2BEZ F;  5U2K A;  1EXI A;  5DG3 A;  3KWD A;  1DIP A;  4I7Z B;  4MFG A;  1Q90 D;  4E6T A;  4IL6 X;  3GUE A;  1IK7 A;  3EWK A;  3VBI A;  3MQG A;  1VF5 C;  4N6B A;  1KTM A;  2Q4J A;  3AE3 C;  3Q5P A;  3D6Y A;  2GGO A;  2VD4 A;  4N27 A;  2W0W A;  3Q5S A;  3GOS A;  1QRM A;  4M98 A;  3FOQ A;  2OEG A;  2QJK C;  1PL5 A;  1KQA A;  3OW5 A;  3SPT A;  1DD3 A;  3OTZ A;  3R5A A;  4AA7 A;  3TDT A;  3D70 A;  2QJP C;  2ICY A;  3Q5R A;  4KNX A;  1PV3 A;  4EAB A;  2OQQ A;  2YMK A;  4G3S A;  1K05 A;  4MYO A;  3S9O A;  1ZME C;  2WSE J;  4PV1 B;  3F1X A;  1KGT A;  4HZC A;  3EEV A;  4H44 C;  2FXP A;  4H0L B;  1Z90 A;  3KWE A;  2H88 C;  2E76 C;  3Q3D A;  3GVD A;  1G97 A;  3BSW A;  2E74 D;  1MRL A;  4H13 C;  5L6S A;  1OMI A;  2V0L A;  2V0H A;  3FSB A;  2G3A A;  3DJ4 A;  1QRF A;  1XAT A;  3PMO A;  1FXJ A;  2IC7 A;  1FDI A;  3GF7 A;  2XAT A;  4EGG A;  3AE2 C;  3R3R A;  3R4Y A;  5ADX V;  3MC4 A;  4KPZ A;  2WSF J;  3AE9 C;  4EQY A;  4TT3 H;  1YQ4 C;  3LW5 J;  3TWD A;  4Y28 J;  1KIL E;  2ZT9 D;  3ECT A;  3Q1M A;  2D2C D;  4YTP C;  1HF9 A;  3P1B A;  3R8Y A;  3Q2Y A;  4DCL A;  1AJY A;  4HZD A;  1KOR A;  2QJY C;  3R3I A;  2QIV X;  3VNP A;  3GMA A;  4GDO A;  4IHH A;  2W0V A;  3AEF C;  1PIX A;  4EA8 A;  4R4L A;  4H13 D;  5F42 A;  4G87 A;  5ADX U;  5E3P A;  3DHO A;  3C8V A;  4R7P A;  2QIW A;  1YP3 A;  2QSI A;  2YIU C;  1VL2 A;  2WLE A;  3I3A A;  4I7Z C;  2E74 B;  2WLF A;  3TIS A;  4AAW A;  3FS8 A;  1KRV A;  2V0I A;  1OW7 A;  5DEM A;  2WQY C;  2D2C C;  2FYN C;  3P47 A;  1V67 A;  3T57 A;  2K9Y A;  2JF2 A;  1J2Z A;  4KT0 J;  3AEG C;  1QRG A;  3FGA D;  1MR9 A;  3DK5 A;  2V0K A;  1GMJ A;  1HM9 A;  4G3P A;  3IGJ A;  2VHE A;  5KLI C;  4EA9 A;  4KPX A;  3O6Q A;  4N69 A;  2I5K A;  3B71 A;  1ZOY C;  4M28 A;  1Y9B A;  1FDO A;  3RK3 E;  4OGQ C;  2WLG A;  2ICX A;  3R2W A;  1NYH A;  4H44 B;  2RIJ A;  3FTT A;  1KQF B;  2P2O A;  1XHD A;  2NZ2 A;  3AE4 C;  4J18 A;  5DEP A;  2QKX A;  4PV1 D;  3BXY A;  1RQV A;  3GF3 A;  2OI6 A;  2BEQ D;  1QRE A;  3T97 B;  1K04 A;  1OW8 A;  4E75 A;  3BRK X;  3AEA C;  4R36 A;  1HJ0 A;  3VBK A;  3D8V A;  1R8E A;  1LXA A;  3FWW A;  1WMK A;  2WLD A;  1HM8 A;  2P10 A;  1YQ3 C;  3VBJ A;  4HUR A;  2IDB A;  4K6R A;  4FCE A;  3CJ8 A;  2WPV B;  1KHR A;  3OUP A;  1KK5 A;  2OI7 A;  3FSX A;  3MQH A;  1KRU A;  5E3R A;  1U57 A;  1VF5 B;  4IHG A;  3TK8 A;  4YXD C;  2ZT9 B;  1QRL A;  3D6Z A;  3I3X A;  1YP4 A;  3HSQ A;  1OW6 A;  3AEB C;  3BFP A;  2V7Q J;  4M2B A;  1S80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...