3C8VA

Crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
476
structure length
453
Chain Sequence
GMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGKNFTFNIIQPYQDGDPRGMYPTILIQPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (YP_390128.1) from Desulfovibrio desulfuricans G20 at 2.28 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
molecule tags Transferase
total genus 165
structure length 453
sequence length 476
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18776 Hexapep_loop Hexapeptide repeat including loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3c8vA04
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA03
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA02
1VF5B 1G95A 3KWCA 2OI6A 1HM0A 4M2BA 1S80A 1HM8A 4M9CA 4M98A 4H44B 3BSSA 2IUAA 1FXJA 5ADXU 1J2ZA 2WPVB 4KT0J 2OI7A 3TISA 4M28A 4AA7A 4EGGA 1T3DA 5L6SA 3OTMA 2IU8A 3FSXA 3I3XA 4OGQB 4H7OA 4E6UA 3PMOA 3GOSA 4IHHA 4N27A 2AQ9A 1KRUA 1THJA 4G3QA 2IC7A 1MRLA 4EA7A 3VBMA 3NZ2A 4J09A 2D2CB 2GGQA 2YIUC 3SRTA 3TDTA 1ZRTE 1MR7A 3TV0A 1G97A 2NPOA 1KRRA 4M99A 3KWDA 2E76B 3BSWA 2OI5A 4G87A 4R37A 1V3WA 2QIAA 4KPZA 3V4EA 1SSQA 3JQYA 3EG4A 4KNXA 4MYOA 1XHDA 2GGOA 3OW5A 3VBKA 4EA8A 2WSEJ 2QJPC 1QREA 1KK6A 2E75B 1QQ0A 2JF3A 3GUEA 3R2WA 3KWEA 3FOQA 4K6RA 2TDTA 3FSBA 4IHGA 1MR9A 2W0VA 2WSFJ 3EH0A 3R5AA 1YP3A 4KNRA 1QRGA 3OTZA 5L6VA 1QRLA 5ADXV 1KQAA 5F42A 1KGTA 4I7ZB 4EQYA 1HV9A 2V0HA 3FS8A 2FYNC 3I3AA 2QJYC 3R5BA 3VBPA 4MZUA 2V0IA 4E6TA 1KGQA 1Q90D 5AFUV 4FCEA 2E74B 2WLDA 2XATA 3OUPA 5E3PA 3VBIA 4ISXA 4HZDA 4AAWA 3SPTA 2W0WA 2VD4A 2K9YA 2QIWA 5E3QA 2QKXA 4H13B 1Z90A 2I5KA 2IU9A 3P47A 1JB0J 1V67A 3TK8A 1KK4A 4RKUJ 4R7PA 3VBJA 3DJ4A 5KLIC 4IL6X 2VHEA 3D98A 3OU9A 3R1WA 3R3RA 4KQLA 3TWDA 3VBLA 1YP4A 3BFPA 5KKZC 5DG3A 4HZCA 2WLGA 3C8VA 2ICXA 2ZT9B 2OEGA 3ECTA 3HSQA 3MQGA 2QIVX 3IGJA 1YP2A 2JF2A 2QJKC 3FSYA 4HURA 3GVDA 1KHRA 3FSCA 2V0KA 4E79A 2WLFA 1HM9A 3T57A 4PV1B 1LXAA 1QRFA 3P1BA 4G3PA 2QSIA 1SSMA 1KK5A 1KRVA 2FKOA 2V0LA 1XATA 3HJJA 2Q4JA 3IXCA 4H0LB 1QRMA 3BXYA 5L8RJ 3DK5A 4IHFA 2ICYA 3EEVA 3VNPA 3R3IA 4E1KA 3R8YA 1FWYA 3FWWA 4EAAA 3BSYA 4J18A 1OCXA 2RIJA 3F1XA 4R36A 4Y28J 4EABA 4M2AA 4EA9A 4MFGA 3MC4A 2O01J 4HUSA 3CJ8A 3MQHA 3ST8A 2WLCA 3D8VA 1S5LX 3DHOA 3R5DA 4HCQA 4KPXA 4N6BA 3Q1XA 5U2KA 4E75A 5AFUU 2OEFA 3R5CA 2P2OA 3FTTA 4AC3A 3LW5J 1TDTA 2WSCJ 5DEPA 3VBNA 2V0JA 4G3SA 4N69A 5E3RA 5DEMA 1SSTA 4DCLA 4N6AA 2WLEA 3BRKX 3TIOA 3R0SA
chains in the Genus database with same CATH superfamily
2BCCG 3M0DA 5AVXB 1BE3E 4M98A 1M8OB 1S1CX 3L73G 1URQA 1BDDA 3TISA 2I8DA 4WWIA 2JJLA 1SLQA 3O8ZA 1LTJB 4DCKA 1M7LA 1MRLA 3L72G 1NAFA 3TDTA 3SRTA 3BVHA 1LTBC 3BCCG 2QIAA 1VQ9P 1SQVK 4TLFA 2HG5D 2GUSA 2ZVOB 1Q86Q 1BE3D 4IHGA 3R5AA 4JQ0D 1RE3C 1VQMP 3R2PA 1SP4A 5AW1B 4I7ZB 3VTPC 3VBPA 2NPSC 3TGUJ 2R32A 1M8NA 3GHGA 3SPTA 1IFJA 1SQXE 2VD4A 1MZ9A 1KILA 3L70G 2IFMA 3VMXA 3TNUA 1P84E 3TSIA 2BEZF 3G6EP 3D98A 1Y8AA 2E76C 1Y9BA 2R5BA 1BCCG 3SFEC 1H0TA 3H1JE 3KQGA 4DT0A 2QJKC 1NU1J 4JBZA 1GD2E 4D6TG 3SUCA 1SQXD 3L74E 3P8MC 5AVRB 3PTZA 4J18A 4MFGA 2E74C 1K05A 5U2KA 3Q1XA 5AFUU 2NPSD 1NO4A 2KUBA 1YBKA 5CBNA 1HUCA 3Q5RA 1L4AB 2Y0EA 3Q5PA 4G3SA 3H1JD 5E3RA 3R0SA 4AQRD 1PP9E 3VYIA 2M3EA 3L74D 1ZV8A 3FXEA 4KT0J 1GL2C 3FSXA 1SQQK 4H7OA 4EA7A 1EZVE 2B87A 1Z56A 2E76B 1GK6A 3EG4A 3AEFC 4MYOA 3VBKA 2QJKB 3GQ9A 2A45H 3SWFA 2WMMA 2XNXA 1PP9D 3H1HE 1AVOA 1NTMD 2YKPA 1N73C 1QRGA 4EYYQ 4XFJA 4E6TA 1EZVD 2ZYGA 4FCEA 2E74B 3OUPA 1E5WA 1LWUC 2WT7A 4AAWA 1USDA 3L71D 1KQFB 2OYIC 1QVFO 2I5KA 1GL2D 3M0AA 3H1HD 2SPZA 5CCGC 3HTKB 2E75C 3WU2E 3WU2H 1KHRA 2WZ7A 4W7YA 3CMEP 3KPEA 1SQBK 1J1EC 1KFNA 4TT3H 4CPGA 1KK5A 4WY4D 2OTKE 1N8RQ 3Q5SA 3IXCA 3PP5A 2BCCJ 4JYCA 1FZAA 1JY3P 2ICYA 2NRGA 3H1IG 3R3IA 3OH1A 4GIFA 1JTHA 4R36A 3F1XA 1FC2C 4AUWA 1YJ9P 5CJ0A 2P2OA 2ZXXA 1RE3A 1NTZG 2C0XA 1CZQA 1PGJA 2L5GB 3EFFK 2NPSA 3CCVP 1LWUB 5AW8B 1S5LH 2OYIB 2Q1KA 1KD1Q 2IZ0A 2JWDA 1KFMA 3H1KG 1PPJE 1T2KC 2IDBA 1OMIA 4JF7A 3BRVB 1G2CB 3F89A 3PH0A 2IYPA 3GF7A 2E75B 1ZN5A 1NKNA 3L70J 3FOQA 3SFDC 1M90Q 2TDTA 2HODB 2V7QJ 3M06A 2PGDA 2MKVA 1VQOP 1KQAA 3AE5C 1YI2P 2V0HA 3NMDA 3R5BA 3RK2C 1DIPA 1NTKE 1BCCJ 4MN4C 1JOCA 2FYUG 4XA4A 1HVVA 3CX5I 2N9BA 4D6TJ 2AEFA 4DZOA 5CHXA 1Q7YQ 1LTIC 2YXRB 3TK8A 3VMZA 3Q1MA 2D2CC 1MV8A 4K3AA 2KNCB 3JCUE 3JCUH 3TWDA 3MHVA 3HTKA 3CCRP 3T97A 1GL2A 4I1LA 3RL0C 2PP6A 1BGYG 1ZW0A 2WSFH 1SSMA 1XATA 5BVZA 2Z5HA 1CSBA 5L8RJ 4UB6E 4UB6H 1GDTA 1BSNA 3BSYA 4OVNF 2MJZA 1HGVA 2R3CA 3IN6A 4WY4A 2KSEA 3OGZA 3VP8A 1VL2A 3QWOC 4H13C 1N73A 3VBNA 4R4MA 1NGMB 3RK2B 5KAIE 5KAIH 4C7NB 1U7JA 1GU4A 1LWUA 1SQPG 4M28A 2D2CD 1T3DA 1N7LA 5GTHE 1THJA 1SFCA 1SQQD 2D2CB 1IFDA 1G97A 1FDMA 1DH3A 3JQYA 4K35A 1G2CA 3MIWA 1NTKJ 1ZR4A 3V5BA 3G4SP 3RL0B 2Q3EA 3KWEA 1OWAA 2ZT9D 1RQUA 2W0VA 2FY8A 4ASWA 1YP3A 2RMZA 5C39A 1J2JB 5APTA 3FXDA 5E79H 1FOSE 1KGQA 4H13D 1IC2A 1RF0A 3MZWB 3SWYA 4L76A 3H1LG 4H13B 1LP1B 1U7MA 3L36A 1LT9C 4NPFX 1TU3F 4HKZH 2L91A 2P10A 2JDIH 2OTJP 3P32A 5KKZC 3AE8C 3MQGA 3EQ2A 3M0DC 1NOHA 2YMKA 2Q9IA 4EIJA 2M0BA 3I56P 5B5EH 1SQBD 3VNPA 1U57A 4ZKPA 2WPSA 5KLVE 3USSA 5BU8B 1JY2P 3H1KJ 2LXCB 1LTGC 2Y0CA 3NFQA 3GW6A 2FKWB 1SSTA 3KWCA 5TJHA 5APXA 3BSSA 2W83C 2IUAA 3L75D 2A06E 3GHGC 1J1DC 3AE9C 1FZCC 3R4YA 1LT9B 1Q2NA 1KILC 3KWDA 1L0LG 5KKZB 2BASA 2FYUJ 4YXDC 2FYNB 2WSEJ 1A02F 2JF3A 2O01H 2PRRA 2RH0A 3CXHH 1PGOA 1NVOA 1KQLA 5AW6B 4KNRA 1JMMA 2WSCH 1EWWA 2A06D 1OIPA 4IOIH 3V2RA 2E5YA 2QIWA 1BGYJ 1JY2O 1MKMA 1EDJA 3AEGC 3NXSA 2WQYC 1JB0J 4RKUJ 2I1KA 3CXHD 4YPCA 3VBLA 3V2PA 5AVWB 1Q82Q 2QM7A 4YTPC 3ABVC 2JF2A 1KTMA 5KLVJ 3GHGB 1J1DB 2OYHA 1OXZA 1FZCB 1YJNP 1KILB 2J59M 3M9BA 3RL0g 2OTLP 2Q4JA 4M3LA 3TNUB 4RESB 3DK5A 4KJMA 2CK3H 1SQPJ 3GQ8A 4U3FG 1MFZA 5ADXV 3MUDC 3B5NC 3AE2C 2PAJA 4KPXA 4HCQA 1EXIA 4E75A 3WUUA 1ZR2A 1H0TB 5DEPA 3EWKA 2IBZE 2GUVA 2ZYAA 1LJ2A 1IJDB 2QE7H 3B71A 5ADXU 3HD7D 2E43A 4BXLA 4C7RA 1T3JA 5L6SA 1K73Q 1KYOE 1N7SC 2FXMA 4IHHA 4N27A 1NU1E 3TGUD 2GGQA 3CCMP 3VP9A 1MUUA 2ZVNB 2WPQA 2CPBA 1USEA 2IBZD 2WVRA 4EA8A 2WWWA 2WSSH 3CCJP 1KB9I 1RHZB 1DD3A 5CCHD 2W6JH 3B5ND 1GTWA 2O1KA 2O1JA 1NU1D 1JY3N 2B87B 5KLIB 2XATA 2WLDA 4ISXA 5CJ4A 1E79H 1YTZT 1EZVI 1V67A 3L4FA 1NTMG 4WBAA 3VN0A 1N7SD 1FAVA 3CWBG 5DG3A 3B8EB 3G3ZA 4N3YB 3FSYA 2A45I 1N7SB 2WT7B 3IAOA 3LIDA 1FZCA 2V0LA 3W67A 1P84H 2H88C 1OZHA 4EA9A 4YXWH 3II6A 1OVUA 2W90A 1NAYA 1NTKK 2OEFA 3R5CA 3FWLA 2RN0A 5KJ7C 1L0LJ 2G8YA 2XV5A 2LXBA 3A5TA 1G95A 4EOTA 3KYQA 2ZFCA 1JTHB 1P84D 4N78E 1VQLP 3HD7A 4J09A 1EDIA 2YIUC 1FZGA 1EQ7A 4HYTB 3BSWA 2BCCE 4G87A 2KLVA 2YKQA 2BEQD 3L73E 2NPSB 1KK6A 2ZAEB 2Z4EA 2FFDA 1AA0A 4K6RA 3Q2YA 1YQ4C 3SSUA 5AW2B 1EDLA 1N4IA 3L72E 1X8YA 2AEMA 5DJTB 4L75A 4IFMA 2QA4P 3BCCE 3M91A 5CCHA 1Q90D 1XTCC 3PLNA 3MUDA 5KJ7D 1UIXA 3B5NA 2BCCD 1HF9A 4PJ0E 4WY4C 3GF3A 1SQVG 3MGNA 4R7PA 3VBJA 3CLQA 1DEBA 2VHEA 3R3RA 4U3FJ 3CC2P 2H89C 4ASVA 1YP4A 1L0SA 1M57D 2M5AB 1HJ0A 3BCCD 1N7SA 3L70E 1BSHA 3BASA 4JPZB 2V7QH 1LXAA 2QRXA 2YIUB 1AV1A 3BXYA 1SFCC 1KV4A 3AE1C 1LTAC 1FBMA 2XU6A 1BCCE 4OH8B 1S5LX 2O01N 2YO2A 1ZXGA 2Q5UA 2IPPA 4D6TE 1GL2B 3T97B 1AFOA 1QL1A 1R8EA 3PJSK 2J58A 3A3YB 3L70D 1IFIA 1FDOA 3CC7P 4GT1A 2OI6A 2W8ZA 2B88A 2YO3A 3CD6P 1FE6A 3L73J 4PD4E 4PD4H 1Q81Q 3V4WA 1RF0C 4WY4B 1BCCD 4A7PA 3LIEA 2KOGA 2KB7P 3P8CE 3E1IA 1IZNB 3GG2A 3L72J 3TV0A 1N73B 1KRRA 4D6TD 4R37A 2Q3IA 3S9OA 3BCCJ 3AE3C 3KDPB 1JM0A 1QQ0A 1SFCD 2IFNA 2IZ1A 2W6AA 2XDJA 1MR9A 3AE7C 1LNQA 3D6ZA 3IR9A 5KLVK 1SFCB 4PD4D 3OH4A 4EQYA 4KHXA 3CWBJ 1SQQG 3M9HA 3HE4B 2WPRA 1X9VA 3P8CD 1W5CE 1X0TA 2W0WA 2K9YA 1GZLA 1JY2N 4ZMDA 3CL3D 2K1AA 3D70A 5KJ7A 2Z5IA 4KQLA 2GM4A 1J1EB 1T8ZA 1OVRA 3HUSC 5H2FE 5H2FH 3VMAA 3C8VA 3JSVC 2ZXEB 1PPJD 2M5AA 3GVDA 2V0KA 4E79A 4DOJA 3EFGA 4OGQD 2KP8A 1QRFA 1KC8Q 1NJIQ 3KZIE 3KZIH 3N7NA 4E1KA 3R8YA 5AVQB 2WLCA 1IFPA 1VQKP 3F5HA 4AC3A 1NTKD 3CPWO 1UIIA 3H1IE 1S80A 4M9CA 1WRGA 3CCEP 4GOFA 1SQBG 3I55P 2ZT9C 2O3JA 2KSJA 1VQ5P 1HBWA 3PMOA 1K04A 1NTZE 2K37A 4PV1C 1L2PA 2QG4A 1RE4C 1JMBA 1SSQA 1QX8A 1XHDA 3OW5A 1DEEG 2QJPC 2UWJE 3U1CA 1NWQA 3G9RA 4UB8E 3L75G 2QEXP 1DD4A 3H1KE 1SQVJ 4R4LA 1YHQP 4RO0A 5B66E 1QRLA 1S3JA 3CI9A 1GW4A 5GTHH 1S72P 1S9KE 3FS8A 2OYHC 2QJYC 5E3PA 3HE4A 1LTTC 1L0NG 2KYVA 5AVYB 3P47A 3GLMA 3R1WA 1NU1K 3H1KD 4PV1D 1JEKA 1VF5D 2FYUE 2ZT9B 2AXTE 2AXTH 3U59A 1S9KD 4HURA 3N4XA 2WSEH 2FXOA 3CXHI 4PV1B 3PHLA 2H43A 4G3PA 2QSIA 4LC1A 4IL6E 4IL6H 1RQVA 1OX3A 3CX5E 3CX5H 3CCQP 1S2EA 3A2AA 3UIAA 2ZYDA 3H1IJ 4EABA 1S4XA 3D8VA 4GKGA 3DHOA 2E5TA 1AQ5A 3FX0A 3S1KA 3LW5J 1BGYE 4EDFA 2FYUD 2Y0DA 5APWA 1LTSC 4N6AA 1NTZJ 2OYHB 2QJYB 5APSA 1HM8A 4LLHA 2OYOA 2WPVB 1HWTC 3CX5D 3OTMA 1ZP0C 1FZBA 1PL5A 3AEAC 1M56D 4H0LC 1BGYD 3HUSA 2RKLA 3V4EA 1SQPE 2HFED 2Q6QA 4JYBA 2YKOA 4AYCA 1FZFA 5L6VA 5CMZA 5KAFE 5KAFH 5F42A 3TGUG 2IBZI 1IFMA 1VQNP 2JR8A 5KLVD 3BATA 2KLUA 5E3QA 2QKXA 1DX7A 3IFMA 4DJGA 1SQPD 1X79B 1KORA 3H32A 3DJ4A 2N1TC 1YIJP 3L37A 3IGJA 4L73A 3H1LE 4H0LD 2KXPB 3HE5B 1EXJA 2P1JA 4H0LB 1YITP 2OQQA 1RE4A 3HD7C 1BE3G 2AXCA 1KN7A 2R3SA 4LGDE 3R5DA 1KQGB 3S4RA 2FFDC 1IK9A 2ZJSE 1PGPA 5APUA 3TIOA 2LR2A 3TYYA 1HM0A 3RBZA 3HRNA 1NYHA 1YJWP 4NPDA 4AA7A 5CCHC 1PV3A 2N1TD 2IC7A 1ZRTE 1MFTA 1OVVA 1P84I 1L0NJ 3AEDC 1H88A 1LTJC 3A0BE 3A0BH 1SQXG 3RGUA 4O9BA 1BDCA 3FSBA 1FU1A 3FWNA 1IO4A 2JO1A 1KYOH 1YTZI 4I6MC 1L0LE 3HD7B 2V0IA 1FOSF 5AW4B 3H1JG 3OH0A 2FFDB 3H1LJ 2KS1B 3G71P 1QVGO 3L74G 3VMYA 3OU9A 3I5CA 1ZLLA 1KYOD 3C9IA 4WVZA 2ICXA 3HSQA 1WMKA 1N86A 1L0LD 3FSCA 2G3AA 1T6AA 1GMJA 3B5NB 4W7ZA 3D71A 2NZ2A 3HE5A 4WB4A 3CCSP 2AEJA 2CPSA 4BRYA 1QEXA 3E7KA 1PP9G 1HTLC 4M2AA 4HUSA 3TF5A 1H8AA 3W68A 2V0JA 1EZVG 2XNDH 1OFCX 1JCCA 1R5SA 2YXQB 3L71G 4U3FE 1FXJA 2W27A 2A45G 1L4AC 3H1HG 1NHLA 3VBMA 1FJKA 2NPOA 4M99A 2N1TA 1FS0E 4HJGH 1OW6A 1V3WA 5CBOA 1GU5A 1JO5A 4U3FD 3V2QA 2HPCA 4ZNCA 4MZUA 5AFUV 3GQAA 1VQ4P 2YNYA 2M8RA 3OH3A 4PD4I 2KS1A 1PFIA 1EDKA 2IX7C 1L4AD 1BE3J 2FYZA 1KB9E 1KB9H 1YQ3C 1NTZK 5AVSB 3TK1A 4N78D 3H25A 3SWKA 2KIKA 1N2DC 1K8AQ 1M1JC 2XZRA 3P1BA 1KRVA 1NTME 4PJ0H 3RK3C 3V6IA 3L73D 4IFFA 4IHFA 4OWFA 3CWBE 3FWWA 4EAAA 3D6YA 2E76D 3GQ7A 1T3UA 1LTJA 4GODA 2P58A 3L72D 1G1IA 1KB9D 3L71E 1PPJG 2H8PD 5BU5A 5APYA 2HLOA 3RK3E 3JC22 1JCDA 1RY3A 5AVTB 1SQXJ 2OI7A 2IU8A 2E74D 4E6UA 1G1JA 3CWBD 3GOSA 2AQ9A 1SS1A 2FYUK 4N6JA 4GOEA 1NTKG 3H1JJ 4W80A 5DJUB 2GGOA 1JNMA 3TDKA 1QREA 1Y47A 1M1JB 3RK3D 3FGAD 3EH0A 4Z1MH 1D7MA 2OGUA 3L74J 5GTIE 5GTIH 3OTZA 1AVYA 3M9QA 3RK3B 1ZOYC 1FDIA 3I3AA 2B9BA 3OH2A 5AW7B 4HZDA 1VQPP 2LKMA 4OGQC 1Z90A 2K9JB 2QVAA 3K5BA 1PP9J 1NTMJ 3OW2O 3BFPA 5AW0B 5M1BA 1PZQA 1FJPA 1L4AA 3AE4C 1HM9A 5KTBA 1KZUB 2FXPA 3GMAA 1SQPK 1VQ8P 1SQVE 2HYNA 1KMIZ 2YMYA 3L71J 1W2BO 1S5LE 1AJYA 3C1LA 3BRTB 3WUTA 1VQ6P 5CCGD 1VPCA 3MC4A 1HJBA 1L0NK 3H1HJ 2E75D 3WUVA 1KQSO 2KZIA 4HB1A 2Q7CA 1SQVD 2PFXA 2I1JA 5AVVB 3PRJA 3A7OA 4EGGA 4OGQB 4ZKUA 2VRSA 2POHA 1JY3O 1OW8A 4EI2A 3NZ2A 2DW3A 1MR7A 2C9LY 1FZEA 2OI5A 4KPZA 3OAKA 2K88A 3R2WA 3V4QA 1K9MQ 1M1JA 3LW5H 2V4HA 1T2KD 3H6PA 1VF5C 5TISE 5TISH 3VBIA 3HUSB 2K3RA 2H7HA 4IFDK 2W6BA 4RJTA 1X22A 2IU9A 1RH5B 3H1ID 1QL2A 2K9JA 1KK4A 4UB8H 4C46A 4IL6X 1SQQE 2HR3A 4B86A 2IYOA 5B66H 3RK2D 3ECTA 3OA7A 1R5LA 2QIVX 2KI7B 5KLVG 2GA1A 1NTZD 3ITKA 2WLFA 2OARA 3T57A 1RF1C 1HGZA 1W2EA 1CI6B 3ZDMA 1GW3A 3MTUE 2E42A 1IK7A 3H32B 2OYIA 1OCXA 2RIJA 2Y9YA 3ST8A 4XE5B 2A06G 1L0LK 1QGKB 2JEEA 3AEEC 3RL0D 1YYCA 3MD0A 1TDTA 2P2UA 5CCGA 4DCLA 2WLEA 3BRKX 5AW5B 1VF5B 5AW3B 2FBWC 2N9YB 1VDFA 2HODA 4BWNA 5AVUB 1A02J 3I3XA 2QJPB 1LT1A 3MP7B 5E79E 2WITA 3AECC 1SQBE 3O6QB 2P7JA 5EFWB 3GUEA 2WSFJ 2WTYA 1RF1B 5AW9B 2KNCA 1KGTA 1HV9A 3IF4A 2FYNC 3L35A 1SQQJ 1Z2FA 4H44C 1URQC 3Q3DA 2JWAA 3L75E 5B5EE 2XKMA 2B89A 1HH0A 2OEGA 1L0NE 3KHUA 1YP2A 2Y9ZA 2KK7A 1GK4A 3B4SA 1SQXK 1CW5A 5APQA 2JP3A 1LGHB 4Y99C 2JKVA 3OJAB 2IBZG 1KYOI 1QRMA 1CI6A 3EEVA 4C7NA 4U7JA 3CC4P 4NPEA 3CJ8A 3MQHA 3WMM0 3NTNA 1IFNA 3V2NA 3KXDA 1NU1G 4I2LC 2M3BA 1L0ND 4H44D 4N69A 5DEMA 1URQD 1JUNA 3P7KA 1NKZB 1PIXA 4M2BA 3QH9A 3CMAP 2C0WA 1WT6A 3CXHE 4H44B 4BRYB 1URQB 1J2ZA 3A0HE 3A0HH 1SQBJ 1H89A 5APVA 2R5DA 1KILE 4GDOA 1KRUA 4G3QA 4HH2A 1SVFA 4QMAA 2P67A 4KNXA 3H1LD 3AEBC 2ITAA 1NTMK 3O6QA 1PGQA 1QLED 1LP1A 4Y99B 5K5GB 1XTGB 1RF1A 1ZMEC 3L75J 2R44A 1KILD 3AE6C 2N1TB 4L74A 5AVZB 1EC5A 1VQ7P 3TGUE 2QM8A 5KLIC 3VOPA 1AQTA 2HPCB 4HZCA 2WLGA 1OW7A 1M1KQ 1ZRTD 3U1AA 2J5UA 3RBXA 3E1RA 2FKOA 3HJJA 3CCLP 4I7ZC 1FWYA 4Y28J 2O01J 3CCUP 4N6BA 1NH4A 3FTTA 1LT9A 2WSCJ 2C9NY 2KZJA
chains in the Genus database with same CATH topology
3RK3E 3KWCA 1S80A 4M9CA 4M98A 3BSSA 2IUAA 1S1CX 2OI7A 3TISA 2ZT9C 2IU8A 2E74D 4E6UA 3PMOA 3GOSA 2AQ9A 1K04A 1MRLA 4PV1C 3AE9C 3TDTA 3R4YA 3SRTA 3KWDA 2QIAA 4YXDC 1SSQA 1XHDA 2GGOA 3OW5A 2WSEJ 2QJPC 1QREA 2JF3A 3G9RA 3FGAD 4IHGA 3EH0A 3R5AA 1DD4A 4Z1MH 4R4LA 4KNRA 3OTZA 1QRLA 1ZOYC 4I7ZB 3FS8A 1FDIA 3I3AA 2QJYC 3VBPA 5E3PA 4HZDA 3SPTA 2VD4A 2QIWA 4OGQC 1MKMA 1Z90A 3AEGC 2WQYC 3P47A 1JB0J 2BEZF 4RKUJ 3GLMA 3D98A 3R1WA 2E76C 3VBLA 1Y9BA 3BFPA 4PV1D 5M1BA 1VF5D 2ZT9B 3SFEC 4YTPC 3ABVC 2JF2A 2QJKC 1KTMA 4HURA 3AE4C 1HM9A 4PV1B 2FXPA 3GMAA 4G3PA 2QSIA 1KMIZ 3RL0g 2Q4JA 1RQVA 3DK5A 1AJYA 4J18A 4EABA 5ADXV 4MFGA 2E74C 3MC4A 1K05A 3AE2C 3D8VA 3DHOA 4KPXA 4HCQA 5U2KA 1EXIA 3Q1XA 4E75A 5AFUU 3LW5J 2E75D 5DEPA 3Q5RA 3Q5PA 4G3SA 5E3RA 3EWKA 4N6AA 3R0SA 1HM8A 3B71A 5ADXU 2WPVB 4KT0J 4EGGA 5L6SA 3OTMA 3FSXA 4H7OA 4OGQB 4IHHA 4N27A 4EA7A 1OW8A 1ZP0C 3NZ2A 2GGQA 1PL5A 3AEAC 1MR7A 4H0LC 2E76B 2OI5A 4KPZA 3V4EA 3EG4A 3AEFC 4MYOA 3VBKA 4EA8A 3R2WA 1DD3A 1QRGA 5L6VA 5F42A 4XFJA 4E6TA 1VF5C 4FCEA 2E74B 2WLDA 2XATA 3OUPA 3VBIA 4ISXA 4AAWA 1KQFB 5E3QA 2QKXA 2I5KA 2IU9A 1V67A 1KK4A 1KORA 3DJ4A 4IL6X 5DG3A 3ECTA 2QIVX 3IGJA 3FSYA 2E75C 4H0LD 1KHRA 2WLFA 3T57A 4TT3H 3IAOA 1EXJA 1KK5A 2V0LA 3Q5SA 3IXCA 4H0LB 2OQQA 2ICYA 3R3IA 1IK7A 2H88C 1OCXA 2RIJA 3F1XA 4R36A 4EA9A 3ST8A 3R5DA 1KQGB 2OEFA 3R5CA 2P2OA 3AEEC 1TDTA 4DCLA 2G8YA 2WLEA 3BRKX 3TIOA 1VF5B 1G95A 1HM0A 2FBWC 1NYHA 4AA7A 3I3XA 1PV3A 2IC7A 4J09A 2YIUC 1ZRTE 2IDBA 1OMIA 3BSWA 4G87A 3AECC 2BEQD 3AEDC 3GF7A 1KK6A 2E75B 3GUEA 3FOQA 4K6RA 3SFDC 3Q2YA 1YQ4C 2TDTA 3FSBA 2V7QJ 2WSFJ 2MKVA 2JO1A 1KQAA 3AE5C 1KGTA 1HV9A 2V0HA 2FYNC 3R5BA 1DIPA 2V0IA 1Q90D 4H44C 1UIXA 3Q3DA 1HF9A 3GF3A 3TK8A 3Q1MA 2D2CC 4R7PA 3VBJA 3OU9A 2VHEA 3R3RA 3TWDA 2H89C 1YP4A 2ICXA 2OEGA 3HSQA 1WMKA 1YP2A 1HJ0A 3FSCA 2G3AA 1GMJA 3D71A 2JP3A 2NZ2A 1LXAA 1SSMA 1XATA 1QRMA 3BXYA 5L8RJ 3AE1C 3EEVA 4U7JA 3BSYA 4M2AA 3IN6A 4HUSA 3CJ8A 3MQHA 1S5LX 3T97B 1VL2A 4H13C 1R8EA 4H44D 2V0JA 3VBNA 4N69A 5DEMA 4R4MA 1NGMB 1FDOA 1PIXA 4M2BA 2OI6A 4H44B 1FXJA 1J2ZA 4M28A 2D2CD 1T3DA 1KILE 4GDOA 1KRUA 1THJA 4G3QA 3VBMA 2D2CB 3TV0A 1G97A 2NPOA 1KRRA 4M99A 4R37A 1OW6A 3S9OA 1V3WA 3JQYA 4KNXA 3AEBC 3AE3C 3O6QA 1QQ0A 3KWEA 2ZT9D 1RQUA 1MR9A 2W0VA 3AE7C 1YP3A 3D6ZA 1ZMEC 4EQYA 4MZUA 1KGQA 5AFUV 3AE6C 4H13D 2W0WA 2K9YA 4H13B 3D70A 5KLIC 4KQLA 1TU3F 2P10A 1YQ3C 5KKZC 4HZCA 3AE8C 3C8VA 2WLGA 3MQGA 3H25A 1OW7A 3GVDA 2V0KA 2YMKA 4E79A 4OGQD 1QRFA 3P1BA 1KRVA 2J5UA 2FKOA 3HJJA 4I7ZC 4IHFA 3VNPA 4E1KA 3R8YA 1U57A 1FWYA 3FWWA 4EAAA 3D6YA 2E76D 4Y28J 2O01J 2WLCA 4N6BA 3FTTA 4AC3A 2WSCJ 1SSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 B;  1G95 A;  3KWC A;  2OI6 A;  1HM0 A;  4M2B A;  1S80 A;  1HM8 A;  4M9C A;  4M98 A;  4H44 B;  3BSS A;  2IUA A;  1FXJ A;  5ADX U;  1J2Z A;  2WPV B;  4KT0 J;  2OI7 A;  3TIS A;  4M28 A;  4AA7 A;  4EGG A;  1T3D A;  5L6S A;  3OTM A;  2IU8 A;  3FSX A;  3I3X A;  4OGQ B;  4H7O A;  4E6U A;  3PMO A;  3GOS A;  4IHH A;  4N27 A;  2AQ9 A;  1KRU A;  1THJ A;  4G3Q A;  2IC7 A;  1MRL A;  4EA7 A;  3VBM A;  3NZ2 A;  4J09 A;  2D2C B;  2GGQ A;  2YIU C;  3SRT A;  3TDT A;  1ZRT E;  1MR7 A;  3TV0 A;  1G97 A;  2NPO A;  1KRR A;  4M99 A;  3KWD A;  2E76 B;  3BSW A;  2OI5 A;  4G87 A;  4R37 A;  1V3W A;  2QIA A;  4KPZ A;  3V4E A;  1SSQ A;  3JQY A;  3EG4 A;  4KNX A;  4MYO A;  1XHD A;  2GGO A;  3OW5 A;  3VBK A;  4EA8 A;  2WSE J;  2QJP C;  1QRE A;  1KK6 A;  2E75 B;  1QQ0 A;  2JF3 A;  3GUE A;  3R2W A;  3KWE A;  3FOQ A;  4K6R A;  2TDT A;  3FSB A;  4IHG A;  1MR9 A;  2W0V A;  2WSF J;  3EH0 A;  3R5A A;  1YP3 A;  4KNR A;  1QRG A;  3OTZ A;  5L6V A;  1QRL A;  5ADX V;  1KQA A;  5F42 A;  1KGT A;  4I7Z B;  4EQY A;  1HV9 A;  2V0H A;  3FS8 A;  2FYN C;  3I3A A;  2QJY C;  3R5B A;  3VBP A;  4MZU A;  2V0I A;  4E6T A;  1KGQ A;  1Q90 D;  5AFU V;  4FCE A;  2E74 B;  2WLD A;  2XAT A;  3OUP A;  5E3P A;  3VBI A;  4ISX A;  4HZD A;  4AAW A;  3SPT A;  2W0W A;  2VD4 A;  2K9Y A;  2QIW A;  5E3Q A;  2QKX A;  4H13 B;  1Z90 A;  2I5K A;  2IU9 A;  3P47 A;  1JB0 J;  1V67 A;  3TK8 A;  1KK4 A;  4RKU J;  4R7P A;  3VBJ A;  3DJ4 A;  5KLI C;  4IL6 X;  2VHE A;  3D98 A;  3OU9 A;  3R1W A;  3R3R A;  4KQL A;  3TWD A;  3VBL A;  1YP4 A;  3BFP A;  5KKZ C;  5DG3 A;  4HZC A;  2WLG A;  3C8V A;  2ICX A;  2ZT9 B;  2OEG A;  3ECT A;  3HSQ A;  3MQG A;  2QIV X;  3IGJ A;  1YP2 A;  2JF2 A;  2QJK C;  3FSY A;  4HUR A;  3GVD A;  1KHR A;  3FSC A;  2V0K A;  4E79 A;  2WLF A;  1HM9 A;  3T57 A;  4PV1 B;  1LXA A;  1QRF A;  3P1B A;  4G3P A;  2QSI A;  1SSM A;  1KK5 A;  1KRV A;  2FKO A;  2V0L A;  1XAT A;  3HJJ A;  2Q4J A;  3IXC A;  4H0L B;  1QRM A;  3BXY A;  5L8R J;  3DK5 A;  4IHF A;  2ICY A;  3EEV A;  3VNP A;  3R3I A;  4E1K A;  3R8Y A;  1FWY A;  3FWW A;  4EAA A;  3BSY A;  4J18 A;  1OCX A;  2RIJ A;  3F1X A;  4R36 A;  4Y28 J;  4EAB A;  4M2A A;  4EA9 A;  4MFG A;  3MC4 A;  2O01 J;  4HUS A;  3CJ8 A;  3MQH A;  3ST8 A;  2WLC A;  3D8V A;  1S5L X;  3DHO A;  3R5D A;  4HCQ A;  4KPX A;  4N6B A;  3Q1X A;  5U2K A;  4E75 A;  5AFU U;  2OEF A;  3R5C A;  2P2O A;  3FTT A;  4AC3 A;  3LW5 J;  1TDT A;  2WSC J;  5DEP A;  3VBN A;  2V0J A;  4G3S A;  4N69 A;  5E3R A;  5DEM A;  1SST A;  4DCL A;  4N6A A;  2WLE A;  3BRK X;  3TIO A;  3R0S A; 
#chains in the Genus database with same CATH topology
 2BCC G;  3M0D A;  5AVX B;  1BE3 E;  4M98 A;  1M8O B;  1S1C X;  3L73 G;  1URQ A;  1BDD A;  3TIS A;  2I8D A;  4WWI A;  2JJL A;  1SLQ A;  3O8Z A;  1LTJ B;  4DCK A;  1M7L A;  1MRL A;  3L72 G;  1NAF A;  3TDT A;  3SRT A;  3BVH A;  1LTB C;  3BCC G;  2QIA A;  1VQ9 P;  1SQV K;  4TLF A;  2HG5 D;  2GUS A;  2ZVO B;  1Q86 Q;  1BE3 D;  4IHG A;  3R5A A;  4JQ0 D;  1RE3 C;  1VQM P;  3R2P A;  1SP4 A;  5AW1 B;  4I7Z B;  3VTP C;  3VBP A;  2NPS C;  3TGU J;  2R32 A;  1M8N A;  3GHG A;  3SPT A;  1IFJ A;  1SQX E;  2VD4 A;  1MZ9 A;  1KIL A;  3L70 G;  2IFM A;  3VMX A;  3TNU A;  1P84 E;  3TSI A;  2BEZ F;  3G6E P;  3D98 A;  1Y8A A;  2E76 C;  1Y9B A;  2R5B A;  1BCC G;  3SFE C;  1H0T A;  3H1J E;  3KQG A;  4DT0 A;  2QJK C;  1NU1 J;  4JBZ A;  1GD2 E;  4D6T G;  3SUC A;  1SQX D;  3L74 E;  3P8M C;  5AVR B;  3PTZ A;  4J18 A;  4MFG A;  2E74 C;  1K05 A;  5U2K A;  3Q1X A;  5AFU U;  2NPS D;  1NO4 A;  2KUB A;  1YBK A;  5CBN A;  1HUC A;  3Q5R A;  1L4A B;  2Y0E A;  3Q5P A;  4G3S A;  3H1J D;  5E3R A;  3R0S A;  4AQR D;  1PP9 E;  3VYI A;  2M3E A;  3L74 D;  1ZV8 A;  3FXE A;  4KT0 J;  1GL2 C;  3FSX A;  1SQQ K;  4H7O A;  4EA7 A;  1EZV E;  2B87 A;  1Z56 A;  2E76 B;  1GK6 A;  3EG4 A;  3AEF C;  4MYO A;  3VBK A;  2QJK B;  3GQ9 A;  2A45 H;  3SWF A;  2WMM A;  2XNX A;  1PP9 D;  3H1H E;  1AVO A;  1NTM D;  2YKP A;  1N73 C;  1QRG A;  4EYY Q;  4XFJ A;  4E6T A;  1EZV D;  2ZYG A;  4FCE A;  2E74 B;  3OUP A;  1E5W A;  1LWU C;  2WT7 A;  4AAW A;  1USD A;  3L71 D;  1KQF B;  2OYI C;  1QVF O;  2I5K A;  1GL2 D;  3M0A A;  3H1H D;  2SPZ A;  5CCG C;  3HTK B;  2E75 C;  3WU2 E;  3WU2 H;  1KHR A;  2WZ7 A;  4W7Y A;  3CME P;  3KPE A;  1SQB K;  1J1E C;  1KFN A;  4TT3 H;  4CPG A;  1KK5 A;  4WY4 D;  2OTK E;  1N8R Q;  3Q5S A;  3IXC A;  3PP5 A;  2BCC J;  4JYC A;  1FZA A;  1JY3 P;  2ICY A;  2NRG A;  3H1I G;  3R3I A;  3OH1 A;  4GIF A;  1JTH A;  4R36 A;  3F1X A;  1FC2 C;  4AUW A;  1YJ9 P;  5CJ0 A;  2P2O A;  2ZXX A;  1RE3 A;  1NTZ G;  2C0X A;  1CZQ A;  1PGJ A;  2L5G B;  3EFF K;  2NPS A;  3CCV P;  1LWU B;  5AW8 B;  1S5L H;  2OYI B;  2Q1K A;  1KD1 Q;  2IZ0 A;  2JWD A;  1KFM A;  3H1K G;  1PPJ E;  1T2K C;  2IDB A;  1OMI A;  4JF7 A;  3BRV B;  1G2C B;  3F89 A;  3PH0 A;  2IYP A;  3GF7 A;  2E75 B;  1ZN5 A;  1NKN A;  3L70 J;  3FOQ A;  3SFD C;  1M90 Q;  2TDT A;  2HOD B;  2V7Q J;  3M06 A;  2PGD A;  2MKV A;  1VQO P;  1KQA A;  3AE5 C;  1YI2 P;  2V0H A;  3NMD A;  3R5B A;  3RK2 C;  1DIP A;  1NTK E;  1BCC J;  4MN4 C;  1JOC A;  2FYU G;  4XA4 A;  1HVV A;  3CX5 I;  2N9B A;  4D6T J;  2AEF A;  4DZO A;  5CHX A;  1Q7Y Q;  1LTI C;  2YXR B;  3TK8 A;  3VMZ A;  3Q1M A;  2D2C C;  1MV8 A;  4K3A A;  2KNC B;  3JCU E;  3JCU H;  3TWD A;  3MHV A;  3HTK A;  3CCR P;  3T97 A;  1GL2 A;  4I1L A;  3RL0 C;  2PP6 A;  1BGY G;  1ZW0 A;  2WSF H;  1SSM A;  1XAT A;  5BVZ A;  2Z5H A;  1CSB A;  5L8R J;  4UB6 E;  4UB6 H;  1GDT A;  1BSN A;  3BSY A;  4OVN F;  2MJZ A;  1HGV A;  2R3C A;  3IN6 A;  4WY4 A;  2KSE A;  3OGZ A;  3VP8 A;  1VL2 A;  3QWO C;  4H13 C;  1N73 A;  3VBN A;  4R4M A;  1NGM B;  3RK2 B;  5KAI E;  5KAI H;  4C7N B;  1U7J A;  1GU4 A;  1LWU A;  1SQP G;  4M28 A;  2D2C D;  1T3D A;  1N7L A;  5GTH E;  1THJ A;  1SFC A;  1SQQ D;  2D2C B;  1IFD A;  1G97 A;  1FDM A;  1DH3 A;  3JQY A;  4K35 A;  1G2C A;  3MIW A;  1NTK J;  1ZR4 A;  3V5B A;  3G4S P;  3RL0 B;  2Q3E A;  3KWE A;  1OWA A;  2ZT9 D;  1RQU A;  2W0V A;  2FY8 A;  4ASW A;  1YP3 A;  2RMZ A;  5C39 A;  1J2J B;  5APT A;  3FXD A;  5E79 H;  1FOS E;  1KGQ A;  4H13 D;  1IC2 A;  1RF0 A;  3MZW B;  3SWY A;  4L76 A;  3H1L G;  4H13 B;  1LP1 B;  1U7M A;  3L36 A;  1LT9 C;  4NPF X;  1TU3 F;  4HKZ H;  2L91 A;  2P10 A;  2JDI H;  2OTJ P;  3P32 A;  5KKZ C;  3AE8 C;  3MQG A;  3EQ2 A;  3M0D C;  1NOH A;  2YMK A;  2Q9I A;  4EIJ A;  2M0B A;  3I56 P;  5B5E H;  1SQB D;  3VNP A;  1U57 A;  4ZKP A;  2WPS A;  5KLV E;  3USS A;  5BU8 B;  1JY2 P;  3H1K J;  2LXC B;  1LTG C;  2Y0C A;  3NFQ A;  3GW6 A;  2FKW B;  1SST A;  3KWC A;  5TJH A;  5APX A;  3BSS A;  2W83 C;  2IUA A;  3L75 D;  2A06 E;  3GHG C;  1J1D C;  3AE9 C;  1FZC C;  3R4Y A;  1LT9 B;  1Q2N A;  1KIL C;  3KWD A;  1L0L G;  5KKZ B;  2BAS A;  2FYU J;  4YXD C;  2FYN B;  2WSE J;  1A02 F;  2JF3 A;  2O01 H;  2PRR A;  2RH0 A;  3CXH H;  1PGO A;  1NVO A;  1KQL A;  5AW6 B;  4KNR A;  1JMM A;  2WSC H;  1EWW A;  2A06 D;  1OIP A;  4IOI H;  3V2R A;  2E5Y A;  2QIW A;  1BGY J;  1JY2 O;  1MKM A;  1EDJ A;  3AEG C;  3NXS A;  2WQY C;  1JB0 J;  4RKU J;  2I1K A;  3CXH D;  4YPC A;  3VBL A;  3V2P A;  5AVW B;  1Q82 Q;  2QM7 A;  4YTP C;  3ABV C;  2JF2 A;  1KTM A;  5KLV J;  3GHG B;  1J1D B;  2OYH A;  1OXZ A;  1FZC B;  1YJN P;  1KIL B;  2J59 M;  3M9B A;  3RL0 g;  2OTL P;  2Q4J A;  4M3L A;  3TNU B;  4RES B;  3DK5 A;  4KJM A;  2CK3 H;  1SQP J;  3GQ8 A;  4U3F G;  1MFZ A;  5ADX V;  3MUD C;  3B5N C;  3AE2 C;  2PAJ A;  4KPX A;  4HCQ A;  1EXI A;  4E75 A;  3WUU A;  1ZR2 A;  1H0T B;  5DEP A;  3EWK A;  2IBZ E;  2GUV A;  2ZYA A;  1LJ2 A;  1IJD B;  2QE7 H;  3B71 A;  5ADX U;  3HD7 D;  2E43 A;  4BXL A;  4C7R A;  1T3J A;  5L6S A;  1K73 Q;  1KYO E;  1N7S C;  2FXM A;  4IHH A;  4N27 A;  1NU1 E;  3TGU D;  2GGQ A;  3CCM P;  3VP9 A;  1MUU A;  2ZVN B;  2WPQ A;  2CPB A;  1USE A;  2IBZ D;  2WVR A;  4EA8 A;  2WWW A;  2WSS H;  3CCJ P;  1KB9 I;  1RHZ B;  1DD3 A;  5CCH D;  2W6J H;  3B5N D;  1GTW A;  2O1K A;  2O1J A;  1NU1 D;  1JY3 N;  2B87 B;  5KLI B;  2XAT A;  2WLD A;  4ISX A;  5CJ4 A;  1E79 H;  1YTZ T;  1EZV I;  1V67 A;  3L4F A;  1NTM G;  4WBA A;  3VN0 A;  1N7S D;  1FAV A;  3CWB G;  5DG3 A;  3B8E B;  3G3Z A;  4N3Y B;  3FSY A;  2A45 I;  1N7S B;  2WT7 B;  3IAO A;  3LID A;  1FZC A;  2V0L A;  3W67 A;  1P84 H;  2H88 C;  1OZH A;  4EA9 A;  4YXW H;  3II6 A;  1OVU A;  2W90 A;  1NAY A;  1NTK K;  2OEF A;  3R5C A;  3FWL A;  2RN0 A;  5KJ7 C;  1L0L J;  2G8Y A;  2XV5 A;  2LXB A;  3A5T A;  1G95 A;  4EOT A;  3KYQ A;  2ZFC A;  1JTH B;  1P84 D;  4N78 E;  1VQL P;  3HD7 A;  4J09 A;  1EDI A;  2YIU C;  1FZG A;  1EQ7 A;  4HYT B;  3BSW A;  2BCC E;  4G87 A;  2KLV A;  2YKQ A;  2BEQ D;  3L73 E;  2NPS B;  1KK6 A;  2ZAE B;  2Z4E A;  2FFD A;  1AA0 A;  4K6R A;  3Q2Y A;  1YQ4 C;  3SSU A;  5AW2 B;  1EDL A;  1N4I A;  3L72 E;  1X8Y A;  2AEM A;  5DJT B;  4L75 A;  4IFM A;  2QA4 P;  3BCC E;  3M91 A;  5CCH A;  1Q90 D;  1XTC C;  3PLN A;  3MUD A;  5KJ7 D;  1UIX A;  3B5N A;  2BCC D;  1HF9 A;  4PJ0 E;  4WY4 C;  3GF3 A;  1SQV G;  3MGN A;  4R7P A;  3VBJ A;  3CLQ A;  1DEB A;  2VHE A;  3R3R A;  4U3F J;  3CC2 P;  2H89 C;  4ASV A;  1YP4 A;  1L0S A;  1M57 D;  2M5A B;  1HJ0 A;  3BCC D;  1N7S A;  3L70 E;  1BSH A;  3BAS A;  4JPZ B;  2V7Q H;  1LXA A;  2QRX A;  2YIU B;  1AV1 A;  3BXY A;  1SFC C;  1KV4 A;  3AE1 C;  1LTA C;  1FBM A;  2XU6 A;  1BCC E;  4OH8 B;  1S5L X;  2O01 N;  2YO2 A;  1ZXG A;  2Q5U A;  2IPP A;  4D6T E;  1GL2 B;  3T97 B;  1AFO A;  1QL1 A;  1R8E A;  3PJS K;  2J58 A;  3A3Y B;  3L70 D;  1IFI A;  1FDO A;  3CC7 P;  4GT1 A;  2OI6 A;  2W8Z A;  2B88 A;  2YO3 A;  3CD6 P;  1FE6 A;  3L73 J;  4PD4 E;  4PD4 H;  1Q81 Q;  3V4W A;  1RF0 C;  4WY4 B;  1BCC D;  4A7P A;  3LIE A;  2KOG A;  2KB7 P;  3P8C E;  3E1I A;  1IZN B;  3GG2 A;  3L72 J;  3TV0 A;  1N73 B;  1KRR A;  4D6T D;  4R37 A;  2Q3I A;  3S9O A;  3BCC J;  3AE3 C;  3KDP B;  1JM0 A;  1QQ0 A;  1SFC D;  2IFN A;  2IZ1 A;  2W6A A;  2XDJ A;  1MR9 A;  3AE7 C;  1LNQ A;  3D6Z A;  3IR9 A;  5KLV K;  1SFC B;  4PD4 D;  3OH4 A;  4EQY A;  4KHX A;  3CWB J;  1SQQ G;  3M9H A;  3HE4 B;  2WPR A;  1X9V A;  3P8C D;  1W5C E;  1X0T A;  2W0W A;  2K9Y A;  1GZL A;  1JY2 N;  4ZMD A;  3CL3 D;  2K1A A;  3D70 A;  5KJ7 A;  2Z5I A;  4KQL A;  2GM4 A;  1J1E B;  1T8Z A;  1OVR A;  3HUS C;  5H2F E;  5H2F H;  3VMA A;  3C8V A;  3JSV C;  2ZXE B;  1PPJ D;  2M5A A;  3GVD A;  2V0K A;  4E79 A;  4DOJ A;  3EFG A;  4OGQ D;  2KP8 A;  1QRF A;  1KC8 Q;  1NJI Q;  3KZI E;  3KZI H;  3N7N A;  4E1K A;  3R8Y A;  5AVQ B;  2WLC A;  1IFP A;  1VQK P;  3F5H A;  4AC3 A;  1NTK D;  3CPW O;  1UII A;  3H1I E;  1S80 A;  4M9C A;  1WRG A;  3CCE P;  4GOF A;  1SQB G;  3I55 P;  2ZT9 C;  2O3J A;  2KSJ A;  1VQ5 P;  1HBW A;  3PMO A;  1K04 A;  1NTZ E;  2K37 A;  4PV1 C;  1L2P A;  2QG4 A;  1RE4 C;  1JMB A;  1SSQ A;  1QX8 A;  1XHD A;  3OW5 A;  1DEE G;  2QJP C;  2UWJ E;  3U1C A;  1NWQ A;  3G9R A;  4UB8 E;  3L75 G;  2QEX P;  1DD4 A;  3H1K E;  1SQV J;  4R4L A;  1YHQ P;  4RO0 A;  5B66 E;  1QRL A;  1S3J A;  3CI9 A;  1GW4 A;  5GTH H;  1S72 P;  1S9K E;  3FS8 A;  2OYH C;  2QJY C;  5E3P A;  3HE4 A;  1LTT C;  1L0N G;  2KYV A;  5AVY B;  3P47 A;  3GLM A;  3R1W A;  1NU1 K;  3H1K D;  4PV1 D;  1JEK A;  1VF5 D;  2FYU E;  2ZT9 B;  2AXT E;  2AXT H;  3U59 A;  1S9K D;  4HUR A;  3N4X A;  2WSE H;  2FXO A;  3CXH I;  4PV1 B;  3PHL A;  2H43 A;  4G3P A;  2QSI A;  4LC1 A;  4IL6 E;  4IL6 H;  1RQV A;  1OX3 A;  3CX5 E;  3CX5 H;  3CCQ P;  1S2E A;  3A2A A;  3UIA A;  2ZYD A;  3H1I J;  4EAB A;  1S4X A;  3D8V A;  4GKG A;  3DHO A;  2E5T A;  1AQ5 A;  3FX0 A;  3S1K A;  3LW5 J;  1BGY E;  4EDF A;  2FYU D;  2Y0D A;  5APW A;  1LTS C;  4N6A A;  1NTZ J;  2OYH B;  2QJY B;  5APS A;  1HM8 A;  4LLH A;  2OYO A;  2WPV B;  1HWT C;  3CX5 D;  3OTM A;  1ZP0 C;  1FZB A;  1PL5 A;  3AEA C;  1M56 D;  4H0L C;  1BGY D;  3HUS A;  2RKL A;  3V4E A;  1SQP E;  2HFE D;  2Q6Q A;  4JYB A;  2YKO A;  4AYC A;  1FZF A;  5L6V A;  5CMZ A;  5KAF E;  5KAF H;  5F42 A;  3TGU G;  2IBZ I;  1IFM A;  1VQN P;  2JR8 A;  5KLV D;  3BAT A;  2KLU A;  5E3Q A;  2QKX A;  1DX7 A;  3IFM A;  4DJG A;  1SQP D;  1X79 B;  1KOR A;  3H32 A;  3DJ4 A;  2N1T C;  1YIJ P;  3L37 A;  3IGJ A;  4L73 A;  3H1L E;  4H0L D;  2KXP B;  3HE5 B;  1EXJ A;  2P1J A;  4H0L B;  1YIT P;  2OQQ A;  1RE4 A;  3HD7 C;  1BE3 G;  2AXC A;  1KN7 A;  2R3S A;  4LGD E;  3R5D A;  1KQG B;  3S4R A;  2FFD C;  1IK9 A;  2ZJS E;  1PGP A;  5APU A;  3TIO A;  2LR2 A;  3TYY A;  1HM0 A;  3RBZ A;  3HRN A;  1NYH A;  1YJW P;  4NPD A;  4AA7 A;  5CCH C;  1PV3 A;  2N1T D;  2IC7 A;  1ZRT E;  1MFT A;  1OVV A;  1P84 I;  1L0N J;  3AED C;  1H88 A;  1LTJ C;  3A0B E;  3A0B H;  1SQX G;  3RGU A;  4O9B A;  1BDC A;  3FSB A;  1FU1 A;  3FWN A;  1IO4 A;  2JO1 A;  1KYO H;  1YTZ I;  4I6M C;  1L0L E;  3HD7 B;  2V0I A;  1FOS F;  5AW4 B;  3H1J G;  3OH0 A;  2FFD B;  3H1L J;  2KS1 B;  3G71 P;  1QVG O;  3L74 G;  3VMY A;  3OU9 A;  3I5C A;  1ZLL A;  1KYO D;  3C9I A;  4WVZ A;  2ICX A;  3HSQ A;  1WMK A;  1N86 A;  1L0L D;  3FSC A;  2G3A A;  1T6A A;  1GMJ A;  3B5N B;  4W7Z A;  3D71 A;  2NZ2 A;  3HE5 A;  4WB4 A;  3CCS P;  2AEJ A;  2CPS A;  4BRY A;  1QEX A;  3E7K A;  1PP9 G;  1HTL C;  4M2A A;  4HUS A;  3TF5 A;  1H8A A;  3W68 A;  2V0J A;  1EZV G;  2XND H;  1OFC X;  1JCC A;  1R5S A;  2YXQ B;  3L71 G;  4U3F E;  1FXJ A;  2W27 A;  2A45 G;  1L4A C;  3H1H G;  1NHL A;  3VBM A;  1FJK A;  2NPO A;  4M99 A;  2N1T A;  1FS0 E;  4HJG H;  1OW6 A;  1V3W A;  5CBO A;  1GU5 A;  1JO5 A;  4U3F D;  3V2Q A;  2HPC A;  4ZNC A;  4MZU A;  5AFU V;  3GQA A;  1VQ4 P;  2YNY A;  2M8R A;  3OH3 A;  4PD4 I;  2KS1 A;  1PFI A;  1EDK A;  2IX7 C;  1L4A D;  1BE3 J;  2FYZ A;  1KB9 E;  1KB9 H;  1YQ3 C;  1NTZ K;  5AVS B;  3TK1 A;  4N78 D;  3H25 A;  3SWK A;  2KIK A;  1N2D C;  1K8A Q;  1M1J C;  2XZR A;  3P1B A;  1KRV A;  1NTM E;  4PJ0 H;  3RK3 C;  3V6I A;  3L73 D;  4IFF A;  4IHF A;  4OWF A;  3CWB E;  3FWW A;  4EAA A;  3D6Y A;  2E76 D;  3GQ7 A;  1T3U A;  1LTJ A;  4GOD A;  2P58 A;  3L72 D;  1G1I A;  1KB9 D;  3L71 E;  1PPJ G;  2H8P D;  5BU5 A;  5APY A;  2HLO A;  3RK3 E;  3JC2 2;  1JCD A;  1RY3 A;  5AVT B;  1SQX J;  2OI7 A;  2IU8 A;  2E74 D;  4E6U A;  1G1J A;  3CWB D;  3GOS A;  2AQ9 A;  1SS1 A;  2FYU K;  4N6J A;  4GOE A;  1NTK G;  3H1J J;  4W80 A;  5DJU B;  2GGO A;  1JNM A;  3TDK A;  1QRE A;  1Y47 A;  1M1J B;  3RK3 D;  3FGA D;  3EH0 A;  4Z1M H;  1D7M A;  2OGU A;  3L74 J;  5GTI E;  5GTI H;  3OTZ A;  1AVY A;  3M9Q A;  3RK3 B;  1ZOY C;  1FDI A;  3I3A A;  2B9B A;  3OH2 A;  5AW7 B;  4HZD A;  1VQP P;  2LKM A;  4OGQ C;  1Z90 A;  2K9J B;  2QVA A;  3K5B A;  1PP9 J;  1NTM J;  3OW2 O;  3BFP A;  5AW0 B;  5M1B A;  1PZQ A;  1FJP A;  1L4A A;  3AE4 C;  1HM9 A;  5KTB A;  1KZU B;  2FXP A;  3GMA A;  1SQP K;  1VQ8 P;  1SQV E;  2HYN A;  1KMI Z;  2YMY A;  3L71 J;  1W2B O;  1S5L E;  1AJY A;  3C1L A;  3BRT B;  3WUT A;  1VQ6 P;  5CCG D;  1VPC A;  3MC4 A;  1HJB A;  1L0N K;  3H1H J;  2E75 D;  3WUV A;  1KQS O;  2KZI A;  4HB1 A;  2Q7C A;  1SQV D;  2PFX A;  2I1J A;  5AVV B;  3PRJ A;  3A7O A;  4EGG A;  4OGQ B;  4ZKU A;  2VRS A;  2POH A;  1JY3 O;  1OW8 A;  4EI2 A;  3NZ2 A;  2DW3 A;  1MR7 A;  2C9L Y;  1FZE A;  2OI5 A;  4KPZ A;  3OAK A;  2K88 A;  3R2W A;  3V4Q A;  1K9M Q;  1M1J A;  3LW5 H;  2V4H A;  1T2K D;  3H6P A;  1VF5 C;  5TIS E;  5TIS H;  3VBI A;  3HUS B;  2K3R A;  2H7H A;  4IFD K;  2W6B A;  4RJT A;  1X22 A;  2IU9 A;  1RH5 B;  3H1I D;  1QL2 A;  2K9J A;  1KK4 A;  4UB8 H;  4C46 A;  4IL6 X;  1SQQ E;  2HR3 A;  4B86 A;  2IYO A;  5B66 H;  3RK2 D;  3ECT A;  3OA7 A;  1R5L A;  2QIV X;  2KI7 B;  5KLV G;  2GA1 A;  1NTZ D;  3ITK A;  2WLF A;  2OAR A;  3T57 A;  1RF1 C;  1HGZ A;  1W2E A;  1CI6 B;  3ZDM A;  1GW3 A;  3MTU E;  2E42 A;  1IK7 A;  3H32 B;  2OYI A;  1OCX A;  2RIJ A;  2Y9Y A;  3ST8 A;  4XE5 B;  2A06 G;  1L0L K;  1QGK B;  2JEE A;  3AEE C;  3RL0 D;  1YYC A;  3MD0 A;  1TDT A;  2P2U A;  5CCG A;  4DCL A;  2WLE A;  3BRK X;  5AW5 B;  1VF5 B;  5AW3 B;  2FBW C;  2N9Y B;  1VDF A;  2HOD A;  4BWN A;  5AVU B;  1A02 J;  3I3X A;  2QJP B;  1LT1 A;  3MP7 B;  5E79 E;  2WIT A;  3AEC C;  1SQB E;  3O6Q B;  2P7J A;  5EFW B;  3GUE A;  2WSF J;  2WTY A;  1RF1 B;  5AW9 B;  2KNC A;  1KGT A;  1HV9 A;  3IF4 A;  2FYN C;  3L35 A;  1SQQ J;  1Z2F A;  4H44 C;  1URQ C;  3Q3D A;  2JWA A;  3L75 E;  5B5E E;  2XKM A;  2B89 A;  1HH0 A;  2OEG A;  1L0N E;  3KHU A;  1YP2 A;  2Y9Z A;  2KK7 A;  1GK4 A;  3B4S A;  1SQX K;  1CW5 A;  5APQ A;  2JP3 A;  1LGH B;  4Y99 C;  2JKV A;  3OJA B;  2IBZ G;  1KYO I;  1QRM A;  1CI6 A;  3EEV A;  4C7N A;  4U7J A;  3CC4 P;  4NPE A;  3CJ8 A;  3MQH A;  3WMM 0;  3NTN A;  1IFN A;  3V2N A;  3KXD A;  1NU1 G;  4I2L C;  2M3B A;  1L0N D;  4H44 D;  4N69 A;  5DEM A;  1URQ D;  1JUN A;  3P7K A;  1NKZ B;  1PIX A;  4M2B A;  3QH9 A;  3CMA P;  2C0W A;  1WT6 A;  3CXH E;  4H44 B;  4BRY B;  1URQ B;  1J2Z A;  3A0H E;  3A0H H;  1SQB J;  1H89 A;  5APV A;  2R5D A;  1KIL E;  4GDO A;  1KRU A;  4G3Q A;  4HH2 A;  1SVF A;  4QMA A;  2P67 A;  4KNX A;  3H1L D;  3AEB C;  2ITA A;  1NTM K;  3O6Q A;  1PGQ A;  1QLE D;  1LP1 A;  4Y99 B;  5K5G B;  1XTG B;  1RF1 A;  1ZME C;  3L75 J;  2R44 A;  1KIL D;  3AE6 C;  2N1T B;  4L74 A;  5AVZ B;  1EC5 A;  1VQ7 P;  3TGU E;  2QM8 A;  5KLI C;  3VOP A;  1AQT A;  2HPC B;  4HZC A;  2WLG A;  1OW7 A;  1M1K Q;  1ZRT D;  3U1A A;  2J5U A;  3RBX A;  3E1R A;  2FKO A;  3HJJ A;  3CCL P;  4I7Z C;  1FWY A;  4Y28 J;  2O01 J;  3CCU P;  4N6B A;  1NH4 A;  3FTT A;  1LT9 A;  2WSC J;  2C9N Y;  2KZJ A; 
#chains in the Genus database with same CATH homology
 3RK3 E;  3KWC A;  1S80 A;  4M9C A;  4M98 A;  3BSS A;  2IUA A;  1S1C X;  2OI7 A;  3TIS A;  2ZT9 C;  2IU8 A;  2E74 D;  4E6U A;  3PMO A;  3GOS A;  2AQ9 A;  1K04 A;  1MRL A;  4PV1 C;  3AE9 C;  3TDT A;  3R4Y A;  3SRT A;  3KWD A;  2QIA A;  4YXD C;  1SSQ A;  1XHD A;  2GGO A;  3OW5 A;  2WSE J;  2QJP C;  1QRE A;  2JF3 A;  3G9R A;  3FGA D;  4IHG A;  3EH0 A;  3R5A A;  1DD4 A;  4Z1M H;  4R4L A;  4KNR A;  3OTZ A;  1QRL A;  1ZOY C;  4I7Z B;  3FS8 A;  1FDI A;  3I3A A;  2QJY C;  3VBP A;  5E3P A;  4HZD A;  3SPT A;  2VD4 A;  2QIW A;  4OGQ C;  1MKM A;  1Z90 A;  3AEG C;  2WQY C;  3P47 A;  1JB0 J;  2BEZ F;  4RKU J;  3GLM A;  3D98 A;  3R1W A;  2E76 C;  3VBL A;  1Y9B A;  3BFP A;  4PV1 D;  5M1B A;  1VF5 D;  2ZT9 B;  3SFE C;  4YTP C;  3ABV C;  2JF2 A;  2QJK C;  1KTM A;  4HUR A;  3AE4 C;  1HM9 A;  4PV1 B;  2FXP A;  3GMA A;  4G3P A;  2QSI A;  1KMI Z;  3RL0 g;  2Q4J A;  1RQV A;  3DK5 A;  1AJY A;  4J18 A;  4EAB A;  5ADX V;  4MFG A;  2E74 C;  3MC4 A;  1K05 A;  3AE2 C;  3D8V A;  3DHO A;  4KPX A;  4HCQ A;  5U2K A;  1EXI A;  3Q1X A;  4E75 A;  5AFU U;  3LW5 J;  2E75 D;  5DEP A;  3Q5R A;  3Q5P A;  4G3S A;  5E3R A;  3EWK A;  4N6A A;  3R0S A;  1HM8 A;  3B71 A;  5ADX U;  2WPV B;  4KT0 J;  4EGG A;  5L6S A;  3OTM A;  3FSX A;  4H7O A;  4OGQ B;  4IHH A;  4N27 A;  4EA7 A;  1OW8 A;  1ZP0 C;  3NZ2 A;  2GGQ A;  1PL5 A;  3AEA C;  1MR7 A;  4H0L C;  2E76 B;  2OI5 A;  4KPZ A;  3V4E A;  3EG4 A;  3AEF C;  4MYO A;  3VBK A;  4EA8 A;  3R2W A;  1DD3 A;  1QRG A;  5L6V A;  5F42 A;  4XFJ A;  4E6T A;  1VF5 C;  4FCE A;  2E74 B;  2WLD A;  2XAT A;  3OUP A;  3VBI A;  4ISX A;  4AAW A;  1KQF B;  5E3Q A;  2QKX A;  2I5K A;  2IU9 A;  1V67 A;  1KK4 A;  1KOR A;  3DJ4 A;  4IL6 X;  5DG3 A;  3ECT A;  2QIV X;  3IGJ A;  3FSY A;  2E75 C;  4H0L D;  1KHR A;  2WLF A;  3T57 A;  4TT3 H;  3IAO A;  1EXJ A;  1KK5 A;  2V0L A;  3Q5S A;  3IXC A;  4H0L B;  2OQQ A;  2ICY A;  3R3I A;  1IK7 A;  2H88 C;  1OCX A;  2RIJ A;  3F1X A;  4R36 A;  4EA9 A;  3ST8 A;  3R5D A;  1KQG B;  2OEF A;  3R5C A;  2P2O A;  3AEE C;  1TDT A;  4DCL A;  2G8Y A;  2WLE A;  3BRK X;  3TIO A;  1VF5 B;  1G95 A;  1HM0 A;  2FBW C;  1NYH A;  4AA7 A;  3I3X A;  1PV3 A;  2IC7 A;  4J09 A;  2YIU C;  1ZRT E;  2IDB A;  1OMI A;  3BSW A;  4G87 A;  3AEC C;  2BEQ D;  3AED C;  3GF7 A;  1KK6 A;  2E75 B;  3GUE A;  3FOQ A;  4K6R A;  3SFD C;  3Q2Y A;  1YQ4 C;  2TDT A;  3FSB A;  2V7Q J;  2WSF J;  2MKV A;  2JO1 A;  1KQA A;  3AE5 C;  1KGT A;  1HV9 A;  2V0H A;  2FYN C;  3R5B A;  1DIP A;  2V0I A;  1Q90 D;  4H44 C;  1UIX A;  3Q3D A;  1HF9 A;  3GF3 A;  3TK8 A;  3Q1M A;  2D2C C;  4R7P A;  3VBJ A;  3OU9 A;  2VHE A;  3R3R A;  3TWD A;  2H89 C;  1YP4 A;  2ICX A;  2OEG A;  3HSQ A;  1WMK A;  1YP2 A;  1HJ0 A;  3FSC A;  2G3A A;  1GMJ A;  3D71 A;  2JP3 A;  2NZ2 A;  1LXA A;  1SSM A;  1XAT A;  1QRM A;  3BXY A;  5L8R J;  3AE1 C;  3EEV A;  4U7J A;  3BSY A;  4M2A A;  3IN6 A;  4HUS A;  3CJ8 A;  3MQH A;  1S5L X;  3T97 B;  1VL2 A;  4H13 C;  1R8E A;  4H44 D;  2V0J A;  3VBN A;  4N69 A;  5DEM A;  4R4M A;  1NGM B;  1FDO A;  1PIX A;  4M2B A;  2OI6 A;  4H44 B;  1FXJ A;  1J2Z A;  4M28 A;  2D2C D;  1T3D A;  1KIL E;  4GDO A;  1KRU A;  1THJ A;  4G3Q A;  3VBM A;  2D2C B;  3TV0 A;  1G97 A;  2NPO A;  1KRR A;  4M99 A;  4R37 A;  1OW6 A;  3S9O A;  1V3W A;  3JQY A;  4KNX A;  3AEB C;  3AE3 C;  3O6Q A;  1QQ0 A;  3KWE A;  2ZT9 D;  1RQU A;  1MR9 A;  2W0V A;  3AE7 C;  1YP3 A;  3D6Z A;  1ZME C;  4EQY A;  4MZU A;  1KGQ A;  5AFU V;  3AE6 C;  4H13 D;  2W0W A;  2K9Y A;  4H13 B;  3D70 A;  5KLI C;  4KQL A;  1TU3 F;  2P10 A;  1YQ3 C;  5KKZ C;  4HZC A;  3AE8 C;  3C8V A;  2WLG A;  3MQG A;  3H25 A;  1OW7 A;  3GVD A;  2V0K A;  2YMK A;  4E79 A;  4OGQ D;  1QRF A;  3P1B A;  1KRV A;  2J5U A;  2FKO A;  3HJJ A;  4I7Z C;  4IHF A;  3VNP A;  4E1K A;  3R8Y A;  1U57 A;  1FWY A;  3FWW A;  4EAA A;  3D6Y A;  2E76 D;  4Y28 J;  2O01 J;  2WLC A;  4N6B A;  3FTT A;  4AC3 A;  2WSC J;  1SST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...