3C8VA

Crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
476
structure length
453
Chain Sequence
GMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGKNFTFNIIQPYQDGDPRGMYPTILIQPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (YP_390128.1) from Desulfovibrio desulfuricans G20 at 2.28 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
total genus 165
structure length 453
sequence length 476
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18776 Hexapep_loop Hexapeptide repeat including loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3c8vA04
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA03
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA02
2IUAA 1HM0A 1Z90A 4J18A 4IHFA 1HM9A 2TDTA 1XATA 3KWEA 4M28A 1SSQA 1G95A 3I3XA 3TIOA 4EA9A 4AA7A 5DEMA 2QJYC 1KRVA 2IC7A 3BXYA 4EAAA 3VNPA 3BFPA 1SSTA 1OCXA 3C8VA 1MRLA 4E6TA 4HCQA 5L8RJ 3F1XA 4EGGA 5ADXV 2YIUC 4IHHA 4K6RA 1XHDA 2WLGA 4R7PA 3VBIA 3VBNA 4HZDA 3TWDA 1FXJA 4MYOA 2D2CB 2QJKC 3FOQA 3VBLA 1G97A 1KRUA 1Q90D 3BSYA 5DEPA 4KT0J 5U2KA 2E75B 2QSIA 2ZT9B 2QIVX 1SSMA 4DCLA 2FYNC 5L6SA 2Q4JA 3TV0A 3FS8A 3FWWA 4R36A 3LW5J 2K9YA 2V0JA 3IXCA 4EABA 2WLFA 4J09A 1LXAA 3GVDA 1KK4A 3Q1XA 4KPXA 1TDTA 3PMOA 3DJ4A 5E3PA 3OTMA 3SPTA 4HURA 4N69A 3R5AA 2WPVB 2OEFA 4Y28J 3DK5A 4H0LB 3EEVA 1HV9A 3I3AA 2E74B 1ZRTE 4H44B 2W0WA 4KNXA 2E76B 1QRGA 4H13B 3GUEA 4MZUA 1S5LX 2ICXA 3D8VA 4IL6X 2WSCJ 2QIWA 2WLEA 4N27A 4R37A 4G3PA 4HZCA 2V0KA 1KHRA 2GGQA 2IU9A 1MR9A 2JF3A 4G3SA 4E1KA 1T3DA 4G87A 2V0HA 3IGJA 4E79A 2JF2A 3P1BA 4RKUJ 1KGTA 1YP2A 3GOSA 4N6AA 3EH0A 3NZ2A 5E3QA 5DG3A 4MFGA 3KWDA 3CJ8A 1KK5A 3EG4A 2NPOA 2VD4A 2P2OA 1V67A 3OUPA 3ECTA 1THJA 3BSWA 2QKXA 2I5KA 3MQGA 3R5BA 4EA8A 4KQLA 1QREA 3DHOA 4M9CA 5F42A 4EA7A 1QRLA 1YP4A 2V0IA 5E3RA 3OTZA 2QJPC 3FSBA 3MQHA 5AFUV 3R5CA 5KLIC 4AAWA 3T57A 4OGQB 1KGQA 2RIJA 3R0SA 4FCEA 1HM8A 2W0VA 4H7OA 3VBJA 2QIAA 3OU9A 1KRRA 1YP3A 3P47A 3TDTA 2WSFJ 2OI7A 1VF5B 4HUSA 3V4EA 2AQ9A 3KWCA 5ADXU 1MR7A 1KQAA 1JB0J 4KNRA 1J2ZA 2O01J 3R8YA 4I7ZB 2FKOA 3JQYA 3R2WA 4G3QA 3HJJA 1QQ0A 3D98A 4KPZA 3MC4A 2OEGA 5KKZC 3FSYA 3FSCA 3VBKA 2GGOA 2XATA 3FSXA 2ICYA 3FTTA 3ST8A 2OI5A 3R1WA 4M99A 4IHGA 3HSQA 4EQYA 3TK8A 2WSEJ 4ISXA 1S80A 4M2BA 4M98A 2WLDA 1QRMA 3R5DA 4E6UA 2WLCA 2V0LA 3SRTA 1KK6A 3BRKX 1QRFA 3TISA 4M2AA 3OW5A 1FWYA 2VHEA 3R3IA 5L6VA 4PV1B 2IU8A 3BSSA 5AFUU 3VBMA 3R3RA 1V3WA 3VBPA 4E75A 2OI6A 4AC3A 4N6BA
chains in the Genus database with same CATH superfamily
1CW5A 1M1KQ 3HD7A 3PRJA 1AVOA 2B87B 1NVOA 5APYA 4KT0J 3PHLA 2WSEH 4CPGA 1ZXGA 3H1JJ 4EOTA 3L73G 4KJMA 5KAFH 1S3JA 3HD7C 5AVYB 3AE1C 1KK4A 4IFDK 1J2JB 4H0LB 4H44B 2A45H 1WMKA 1BE3J 1KB9E 2QIWA 5BVZA 1KV4A 2JF3A 2FYNB 3CWBD 1J1DC 3RK2D 2WTYA 4O9BA 4I7ZC 3R5BA 4KQLA 1DH3A 4M9CA 2PFXA 5AW1B 3FGAD 3L75D 1RE3A 1XTCC 2E43A 1NTZD 1PGQA 3B71A 1E5WA 3FX0A 3L72G 3IAOA 2MKVA 3R2WA 1YBKA 2IZ0A 3FXEA 1RE3C 3M0AA 1SQXK 2FYUJ 1H89A 3MUDA 3OH0A 4Y99C 1VQMP 3IFMA 5APTA 4WBAA 1NU1D 1P84D 1KB9H 1IFPA 1SQBJ 1KRVA 3CX5D 3TSIA 1PGPA 2ZJSE 4MN4C 2P7JA 3MUDC 3EFGA 3V4QA 1QVGO 2D2CB 1Q90D 3T97B 3H1JE 2W6JH 1EXIA 2ZT9B 2I1KA 3CLQA 3TF5A 1SSMA 4R36A 1QX8A 2K9YA 1LXAA 2QJYB 1NTKJ 3DJ4A 4HH2A 3HUSB 1W2EA 3CMAP 1BE3E 3FWNA 1MKMA 1IFIA 1T6AA 1L0ND 2BASA 4NPEA 4G87A 3GHGA 5EFWB 3CCVP 3CXHH 3U1CA 3VTPC 2XKMA 3GLMA 1NU1J 3CJ8A 3TYYA 3VYIA 1JO5A 1EDJA 5AW3B 3H6PA 1G1IA 2H89C 2JDIH 3MQHA 3BRTB 1HF9A 2XNXA 1SQQJ 2OYIA 1LTSC 3GHGC 3AECC 1GW4A 1BCCJ 3PP5A 2PP6A 3Q5PA 3H1KJ 3G9RA 1NO4A 2FKOA 3P8CD 2R5BA 3FSYA 2FKWB 3IR9A 2XATA 2ICYA 1VQ8P 2OYIC 3HSQA 2FYUE 1KORA 2QEXP 2KNCA 3L74G 3R5DA 1KILD 5AVVB 2R3SA 1S5LE 1L0NJ 4M2AA 2HPCA 4PD4D 1FDIA 1KILA 2PRRA 3AEAC 5CHXA 1LP1A 3JSVC 3KWEA 4L74A 3I3XA 3H1HJ 1S4XA 5K5GB 3L75E 2XZRA 1K04A 3C1LA 5CCGD 1ZW0A 4EIJA 3VBLA 1S72P 1L0LK 1PP9D 5KLVG 1FJPA 1KILC 1HVVA 1IFMA 5KAIE 1ZMEC 3CC4P 2K9JA 2BCCJ 2N1TD 5CCHD 1CI6A 1JOCA 4K35A 3AE9C 1Y8AA 1USEA 2YIUB 1Q81Q 4GKGA 3CCLP 3RBZA 5CCHA 1N7LA 4RJTA 1NTKG 2IU9A 3V2RA 2Q9IA 2W90A 1MFTA 1KGTA 1NU1E 3EH0A 5TISE 1H0TB 1RHZB 4U3FG 2ZYDA 1OX3A 1T3JA 3FWLA 2I5KA 5E79E 1YP4A 2QJPC 3FSBA 1SQQE 5CCHC 2B87A 2WPQA 1JY3P 1BCCE 3E1RA 1T3UA 3H1KE 3L70D 3HJJA 1QQ0A 4H0LD 3UIAA 3FSXA 3OJAB 1KFNA 3G4SP 3C9IA 1OW7A 1L0NE 1LTTC 2WZ7A 4D6TJ 3SSUA 2ZXEB 2M0BA 3I55P 5L6VA 1JUNA 3HE4B 2W6AA 1AVYA 1XATA 1G95A 2KI7B 2Y9YA 1JY2O 3JC22 2QRXA 4H0LC 1P84H 5TISH 4H44C 3AEBC 4Z1MH 1SQVJ 3VBIA 3CX5H 2HODB 1UIIA 2P2UA 3M9QA 1G97A 3QWOC 3SWFA 5C39A 5BU5A 2E75B 3CCQP 2FYNC 2BCCE 2V0JA 4EABA 3PJSK 3RK2B 3SPTA 1SQPD 2BEQD 1LTGC 3GMAA 1OVUA 5AVZB 1KILE 1SQXG 1D7MA 2Y0CA 1S5LX 2AEJA 5AVQB 2YNYA 1J1EB 1T3DA 1MUUA 3TGUD 1JTHB 5DG3A 4OH8B 1K8AQ 3CCJP 3O8ZA 3D71A 2E76D 4C7NB 1PPJD 1PP9E 3N7NA 1NTMG 2N9BA 2ZT9D 3P8MC 1SFCD 5H2FE 1BGYD 3M06A 3V4EA 3T97A 1M8NA 1R8EA 2OYOA 3AEDC 4WB4A 1KQAA 4HB1A 1EDIA 1UIXA 1SLQA 1H8AA 1YITP 1VDFA 3R1WA 4M99A 3HUSA 2WSEJ 4ISXA 5AW8B 2O1KA 2NPSB 1VQNP 1VQ5P 4AQRD 4D6TE 2D2CC 2O3JA 2OYHB 3TGUJ 2ZT9C 1V3WA 2OTJP 2QJYC 4PD4H 4EAAA 3OGZA 1LT9A 3AEEC 3HUSC 1MRLA 3L73D 5L8RJ 1E79H 1SQVE 1X0TA 3MZWB 1VQLP 2WLGA 5CMZA 3OH4A 3WUVA 1AFOA 2A06G 1Q86Q 3Q1MA 3TV0A 3FS8A 3VN0A 2WT7B 1LT9C 2W27A 3JCUE 1BDDA 5H2FH 2W0WA 2KYVA 1IK7A 2FFDB 2CK3H 2CPSA 3GF3A 4JPZB 5GTIE 4N6AA 2GM4A 4I1LA 2OARA 3MGNA 3EG4A 2KSJA 3BSWA 2V0IA 5B66E 3L71D 4ZMDA 3L72D 3H1LJ 4AAWA 2IBZG 2RIJA 1VQ6P 3VBJA 1L0LG 3KXDA 3TNUA 2KP8A 3TDTA 1LTJB 1IJDB 2IZ1A 2WVRA 2L5GB 2FYUK 1K05A 3R8YA 1LT1A 1LWUB 2O1JA 1FZEA 3FSCA 3GG2A 4ZKPA 1OIPA 2OI5A 5KLIB 1U7JA 4EQYA 1YTZI 1BSNA 5AW9B 3SFEC 2V4HA 4M2BA 1SQBK 3TGUE 3CC2P 2YO3A 1FWYA 3R3IA 2A45I 3VBMA 4ZKUA 2DW3A 4E75A 4N6BA 3M0DA 5TJHA 3TIOA 1SSQA 1H0TA 3L71J 2HR3A 1YJNP 2N1TB 2YIUC 5CJ0A 1NTKK 5AVRB 3FOQA 1BGYE 1KRUA 1OMIA 3M0DC 3I5CA 2CPBA 5L6SA 1OVVA 2KLVA 2QM8A 3IXCA 4J09A 2P10A 5AW7B 4N69A 3USSA 3SWYA 3P7KA 2FXMA 3IF4A 2YXRB 3HTKB 4E1KA 3OW2O 2Q3IA 4MFGA 3KWDA 1BSHA 1SQQK 2KLUA 1RQUA 1EXJA 1G2CB 4NPFX 3HE4A 4H13D 2K1AA 3H1LE 3HE5B 3MTUE 1KB9I 4RESB 2WSSH 2E75D 3CI9A 3B5ND 2HODA 2W8ZA 3S4RA 3KWCA 1FZAA 3L74D 1KQGB 2OQQA 2WMMA 2C0WA 2Y9ZA 3EWKA 3NTNA 1N2DC 3PLNA 4OWFA 4H13C 2Q6QA 4JYCA 5AVSB 2QM7A 3TISA 1ZR2A 4BRYB 2E75C 3BASA 2R44A 4OVNF 2KZIA 1JTHA 3L71E 3WUTA 3LIEA 3RK2C 5KLVD 3CXHI 2XNDH 4C7RA 1QL1A 3P32A 4WVZA 2ZYGA 3CCEP 3CXHE 4EYYQ 4C7NA 2P1JA 4HZDA 1YYCA 1K9MQ 3MP7B 1J1EC 3CWBJ 3V6IA 4DCLA 1EDLA 2K88A 4KPXA 4IL6H 1NHLA 3O6QB 3PMOA 1FAVA 2NPSD 2C0XA 3L75J 2E76B 3D6YA 2QJKB 1FOSF 1NTMK 4G3PA 2GGQA 2NPSA 1NTZJ 3H1ID 1KC8Q 2GA1A 1YP2A 1SFCB 2OYHA 2IFMA 1KQLA 1AA0A 4GODA 1S2EA 2IX7C 1Q82Q 1QRLA 1EZVD 1VPCA 1X8YA 1EWWA 3H1JG 3GQ7A 1GW3A 2C9LY 2WPRA 2M3BA 2NPSC 4H7OA 5AW2B 1JM0A 1YP3A 2OYHC 3II6A 1IFDA 1LT9B 1URQD 3R2PA 1BE3G 5APVA 4WY4D 3CCSP 2WT7A 2JWDA 3FTTA 1IO4A 5AW6B 1AJYA 4M98A 1DD4A 1HJBA 3H1IJ 3OW5A 1NAFA 2FFDA 2OI6A 1LTIC 1SQVK 1N73B 1PFIA 1CZQA 5AVTB 4GT1A 1K73Q 5ADXV 5AVUB 5AW4B 4K6RA 3BRVB 1L4AD 3TWDA 2FXOA 2FFDC 3CWBE 2QSIA 1SQXD 1JY2N 3RK3B 2Y0EA 3VMXA 1NAYA 3Q5RA 1LTJA 1VQ7P 1LTBC 3AE2C 2FYUG 4GDOA 4RO0A 4TLFA 1LWUA 4KNXA 4HKZH 1FJKA 3MD0A 4JQ0D 3TNUB 1NTZE 1IC2A 1SQBG 1PV3A 2V0HA 3P1BA 1LTJC 4AYCA 5E3QA 5CCGA 2W83C 3L75G 3CC7P 1KK5A 2NPOA 3ZDMA 1V67A 2J58A 2E74D 1LWUC 2QVAA 3TDKA 2IFNA 3NMDA 5KLIC 2N1TA 4YPCA 5CCGC 3OU9A 1HUCA 1P84I 2ZVOB 4ZNCA 3CX5I 4HUSA 4EDFA 1P84E 3VMAA 1HJ0A 2IDBA 3CX5E 4DT0A 3D98A 4HYTB 1WRGA 3D70A 2N1TC 2E74C 3TK8A 2RKLA 3Q5SA 1NU1G 1KFMA 3E7KA 3H1IE 1PP9J 3WU2H 2OGUA 1U7MA 3HTKA 1BDCA 1SQQG 5KKZB 1EZVE 3VNPA 3SWKA 3M9BA 3SUCA 1G2CA 1BCCG 4L76A 2RH0A 3HE5A 3D6ZA 1DEEG 1JMBA 3H1KG 5AVXB 3BSYA 2JP3A 1Z2FA 3OAKA 4R4MA 3FWWA 5KJ7D 4N78D 3KYQA 3KPEA 1L0NG 3VP8A 4Y28J 2N9YB 3DK5A 1YI2P 2E42A 1QRGA 4H13B 1LTAC 1YTZT 2V7QH 2AEMA 3H1HG 5M1BA 3B4SA 3GOSA 1WT6A 2L91A 4BRYA 3B5NB 3L70J 3P8CE 2VD4A 2P2OA 3AE7C 2ZVNB 2QKXA 1L0LD 3RBXA 5F42A 1Q7YQ 3CD6P 4A7PA 3OA7A 1GTWA 1KGQA 3R0SA 1JY3O 4PD4I 2YMYA 2BCCG 3V2PA 2B89A 1LGHB 4WWIA 4PD4E 1KRRA 1ZP0C 3A3YB 2AQ9A 2Q1KA 1U57A 3KZIH 2H88C 5APUA 1XTGB 1JEKA 1OWAA 1YJ9P 1DD3A 2B88A 3O6QA 3ST8A 1QGKB 3F89A 1KQSO 2IYPA 2RMZA 2IPPA 3BCCD 3R3RA 4AC3A 1JMMA 2TDTA 5APXA 4K3AA 3H32B 1PP9G 1SFCA 1M57D 1SQPJ 1KTMA 5AW0B 5BU8B 2Z4EA 2I1JA 1M90Q 2JWAA 1NJIQ 2E76C 1XHDA 2QJKC 1FC2C 2H43A 2FXPA 1FU1A 3Q2YA 2Q4JA 4UB6H 1SFCC 3RL0D 1TDTA 5E3PA 4YTPC 4D6TG 2MJZA 2KSEA 3GUEA 4PJ0E 2ICXA 2YMKA 1NH4A 2JEEA 1YHQP 1ZLLA 3NFQA 1BGYJ 3IGJA 3NZ2A 3L70E 1YJWP 2J5UA 1SQVG 3ECTA 4EA8A 1N73A 1URQB 3OTZA 2Z5IA 2ZYAA 4UB8H 4WY4B 3RL0g 4M3LA 1A02F 2H8PD 3RK3D 4LC1A 4N78E 1L2PA 1M56D 2YKPA 1VQOP 1N73C 3AE5C 4JBZA 1X22A 3L73J 4DZOA 2HFED 5B5EH 1GK4A 1N86A 2KOGA 1MV8A 2M8RA 1ZRTD 1L0SA 3BRKX 2Q5UA 4GOEA 1L4AB 1Q2NA 3RK3C 3CMEP 3OH1A 4PJ0H 3ITKA 3AE4C 2WSFH 1SQPE 1X9VA 3AE6C 3C8VA 3U59A 1N7SD 1YQ4C 4HCQA 4PV1D 1FXJA 2P67A 1GMJA 1VQ9P 2KZJA 3GVDA 1PIXA 3OTMA 4IOIH 4HURA 1GL2D 1S9KD 1NTZK 4L73A 3L72J 2E74B 1PPJE 3TGUG 1OW8A 3EQ2A 2H7HA 3L36A 1RF0A 2JO1A 2A45G 3G3ZA 3BCCE 1MR9A 4YXDC 3H1JD 1AQ5A 2KB7P 4BWNA 2G3AA 3MQGA 1VL2A 3R4YA 1BGYG 1RF0C 1NU1K 3WMM0 1BE3D 1JCCA 4QMAA 1DIPA 3GW6A 3HD7D 1VF5B 2WSCH 1SP4A 3G71P 5KKZC 2YXQB 2ZAEB 3L73E 3I56P 1OZHA 1S80A 4IFFA 1FDOA 2WLCA 3SRTA 2IYOA 1QRFA 3OH3A 2AEFA 4IL6E 1GD2E 1PZQA 2R32A 2Y0DA 3VBPA 1W5CE 3H1LG 1HM0A 4EA9A 2IC7A 3A5TA 3B5NA 3BFPA 1L0NK 4KHXA 1Y9BA 1RF1B 4R7PA 2FYUD 3V5BA 3RK3E 2QG4A 3F5HA 2OTKE 3AE8C 1KD1Q 3W67A 3B5NC 1FZCA 1SQBD 2LR2A 3L72E 1FZFA 1PGOA 3EEVA 1HH0A 1ZRTE 4YXWH 4GIFA 1QVFO 4R37A 1S1CX 3L71G 4U7JA 3IN6A 1FZCC 2UWJE 3L74J 2J59M 2WQYC 1GDTA 2BEZF 2R3CA 1NTKD 2E5YA 3GQ8A 4I2LC 1AV1A 1PL5A 3LW5H 3AE3C 3H32A 5AFUV 1KMIZ 1T8ZA 4U3FD 3E1IA 2WITA 2W0VA 1QL2A 2E5TA 4R4LA 1JB0J 1J2ZA 5GTHE 1S9KE 1IFNA 2XDJA 5KLVJ 2FY8A 1M1JB 1RY3A 4XE5B 2KK7A 1SQQD 4E6UA 3AEFC 3FXDA 4DJGA 2K3RA 1BCCD 3BATA 3U1AA 5CBNA 4J18A 4IHFA 3H1KD 1HM9A 4AA7A 5AW5B 2QE7H 3QH9A 1W2BO 1OCXA 2WPSA 3RL0B 2V7QJ 1FBMA 4U3FJ 2ZFCA 3A2AA 3SFDC 1URQA 1ZN5A 3S9OA 3V4WA 4WY4A 3NXSA 2GUSA 5DEPA 5U2KA 2YKOA 3AEGC 4XFJA 1ZV8A 2C9NY 4JF7A 1MFZA 1N8RQ 2GUVA 1IZNB 1LJ2A 3H1HD 2ITAA 1G1JA 1AQTA 1URQC 2B9BA 2Z5HA 5GTHH 4WY4C 5DJTB 4IL6X 3RGUA 2V0KA 1HTLC 1HBWA 2NZ2A 2JF2A 4TT3H 3L74E 3L4FA 3M91A 1L4AA 1RE4A 1QEXA 2BCCD 2K37A 4EA7A 1FZGA 2AXTE 3WU2E 3VMZA 4W7ZA 3CWBG 1OW6A 5APSA 4GOFA 1NYHA 4OGQB 3GQAA 2OTLP 1NOHA 1EQ7A 4ASWA 3K5BA 1L4AC 2I8DA 1RE4C 5CJ4A 4C46A 3GF7A 1SQBE 1SVFA 2O01J 1NKZB 1NTMD 5KLVE 3MC4A 1ZR4A 1JY3N 1NTZG 2M5AB 1RH5B 1IK9A 1N7SB 4IFMA 1R5SA 4L75A 1KK6A 1SQPK 2WWWA 4PV1B 2VRSA 1SQXJ 1NTKE 1Z90A 1T2KD 1JNMA 5DEMA 3BXYA 2YO2A 1ZOYC 3GQ9A 1SSTA 1JY2P 4U3FE 1GL2B 2O01N 2HLOA 2P58A 4D6TD 1VF5D 2AXTH 3PTZA 2AXCA 1NGMB 2RN0A 3CPWO 1OVRA 1NTMJ 1EZVI 3PH0A 3Q1XA 1S5LH 1KYOD 2WPVB 2OEFA 1T2KC 5APWA 3H1IG 2A06D 3KHUA 3HRNA 1SQVD 1FOSE 4W80A 4MZUA 2KS1B 3KZIE 3H25A 4ASVA 3V2QA 1KHRA 3KQGA 4XA4A 4G3SA 1M8OB 1EZVG 1VF5C 2PAJA 1FZBA 3HD7B 3OUPA 1THJA 1KZUB 4H44D 1QREA 3DHOA 1QLED 5KAIH 3R5CA 5KJ7A 2M3EA 4NPDA 1HM8A 1RF1A 4DOJA 2QIAA 3P47A 3CL3D 2WSFJ 1RQVA 1J1DB 3VOPA 3G6EP 2KIKA 2IBZD 4KNRA 3H1HE 4I7ZB 4G3QA 3KDPB 2OEGA 5KJ7C 3VBKA 3MIWA 2JJLA 4JYBA 1LNQA 1RF1C 4UB6E 2XV5A 1QRMA 4W7YA 5E79H 1PGJA 1SQXE 3A7OA 1R5LA 1FZCB 2IUAA 4DCKA 4M28A 3B8EB 2Q7CA 5DJUB 2Q3EA 4E6TA 2POHA 4EGGA 3CCUP 4LGDE 3OH2A 3W68A 4IHHA 2KUBA 1VQ4P 3VBNA 1Y47A 4MYOA 1YIJP 4Y99B 1GK6A 3CCMP 4B86A 2QIVX 1NTME 1FS0E 3CCRP 4UB8E 1L0LJ 3R5AA 3A0BE 1OXZA 1HV9A 2D2CD 3I3AA 2O01H 2QA4P 1M1JA 3D8VA 2WSCJ 2WLEA 3L35A 5B5EE 1IFJA 1CSBA 4LLHA 1MZ9A 3M9HA 5E3RA 1M1JC 3T57A 3A0HE 4FCEA 3VP9A 1DEBA 1DX7A 2HYNA 1EDKA 3LIDA 2LXCB 3BCCJ 1KYOI 1MR7A 1EC5A 1HWTC 1KYOE 3Q3DA 1VQPP 2A06E 3MHVA 3RL0C 3H1LD 4BXLA 4I6MC 3L37A 1YQ3C 3L70G 1N4IA 3GHGB 5KTBA 1KB9D 3A0BH 2VHEA 2IU8A 3BSSA 2LKMA 5AFUU 2NRGA 4HJGH 2FBWC 2ZXXA 3N4XA 2OYIB 4OGQD 1TU3F 3F1XA 5APQA 2FYZA 2IBZI 2HG5D 1GU5A 2IBZE 1FDMA 3LW5J 3A0HH 2WLFA 4N6JA 1L0LE 1H88A 1KQFB 2KNCB 4EI2A 1HGVA 3CXHD 1KYOH 4OGQC 2M5AA 2HPCB 4N27A 4HZCA 1N7SA 2R5DA 3TK1A 3EFFK 1KILB 2SPZA 3WUUA 1SQPG 5CBOA 5AVWB 1VQKP 4E79A 4RKUJ 1LP1B 1HGZA 2PGDA 2JKVA 1X79B 1M7LA 1NKNA 4AUWA 2JR8A 1USDA 5KAFE 3ABVC 2LXBA 2W6BA 1N7SC 2YKQA 1KN7A 1NWQA 1GL2A 3JCUH 1A02J 5KLVK 2K9JB 4PV1C 2OI7A 5ADXU 3V2NA 1CI6B 1PPJG 2KXPB 3JQYA 4KPZA 1GZLA 2XU6A 2G8YA 2GGOA 5GTIH 1SS1A 2QJPB 3BCCG 4IHGA 3S1KA 1OFCX 1GL2C 1FE6A 2WLDA 1GU4A 2V0LA 5B66H 2KS1A 1JCDA 3VMYA 3BVHA 1Z56A 4N3YB
chains in the Genus database with same CATH topology
4J18A 4IHFA 1HM9A 4AA7A 2QJYC 4EAAA 3VNPA 1OCXA 3AEEC 1MRLA 5L8RJ 2V7QJ 3D6ZA 2WLGA 3SFDC 3S9OA 3BSYA 5DEPA 4KT0J 5U2KA 2JP3A 3AEGC 4XFJA 3Q1MA 3TV0A 3FS8A 4R4MA 3FWWA 3AE1C 1KK4A 4Y28J 3DK5A 4H0LB 4H44B 2W0WA 1WMKA 1QRGA 4H13B 4IL6X 1IK7A 2QIWA 2V0KA 2JF3A 3GF3A 2NZ2A 5M1BA 2JF2A 4TT3H 3GOSA 4N6AA 3EG4A 2VD4A 2P2OA 3AE7C 4I7ZC 3BSWA 3R5BA 2QKXA 4KQLA 4EA7A 4M9CA 5F42A 2V0IA 3FGAD 1OW6A 4AAWA 1NYHA 4OGQB 1KGQA 2RIJA 3R0SA 3VBJA 1KRRA 1ZP0C 3TDTA 3B71A 2AQ9A 3GF7A 1U57A 3IAOA 1K05A 2O01J 3R8YA 2H88C 2MKVA 3R2WA 3MC4A 3FSCA 1DD3A 3O6QA 2OI5A 3ST8A 4EQYA 3SFEC 4M2BA 1KK6A 1FWYA 3R3IA 4PV1B 3VBMA 3R3RA 4E75A 4AC3A 4N6BA 1Z90A 2TDTA 3TIOA 1SSQA 5DEMA 1KRVA 3BXYA 1ZOYC 1KTMA 1SSTA 2YIUC 2E76C 1XHDA 2D2CB 2QJKC 3FOQA 1KRUA 1Q90D 1VF5D 3T97B 1OMIA 2FXPA 1EXIA 1NGMB 2ZT9B 3Q2YA 1SSMA 5L6SA 2Q4JA 4R36A 2K9YA 3IXCA 4J09A 1LXAA 3Q1XA 2P10A 1TDTA 3DJ4A 5E3PA 4N69A 4YTPC 2WPVB 2OEFA 3GUEA 4MZUA 2ICXA 3H25A 1MKMA 2YMKA 1KHRA 4E1KA 4G3SA 4G87A 3IGJA 3NZ2A 1VF5C 3GLMA 4MFGA 3KWDA 3CJ8A 2J5UA 3OUPA 1RQUA 1EXJA 3ECTA 1THJA 4EA8A 4H44D 1QREA 3DHOA 4H13D 3OTZA 2H89C 3MQHA 3R5CA 1HF9A 1HM8A 2E75D 3RL0g 3AECC 2QIAA 3P47A 2WSFJ 1RQVA 3KWCA 3Q5PA 1KQGB 4KNRA 2OQQA 3G9RA 4I7ZB 2FKOA 4G3QA 3AE5C 2OEGA 3FSYA 3EWKA 3VBKA 2XATA 2ICYA 3HSQA 1KORA 4H13C 1QRMA 3R5DA 3BRKX 3TISA 4M2AA 2E75C 1FDIA 2IUAA 3AEAC 4M28A 3KWEA 3AE4C 3I3XA 3AE6C 3C8VA 4E6TA 1YQ4C 4HCQA 4EGGA 1K04A 4IHHA 3VBNA 4PV1D 4HZDA 1FXJA 4MYOA 3VBLA 2QIVX 1GMJA 1ZMEC 4DCLA 3GVDA 1PIXA 4KPXA 3PMOA 3OTMA 4HURA 3R5AA 3AE9C 1HV9A 2D2CD 3I3AA 2E74B 1OW8A 2E76B 3D6YA 3D8VA 2WSCJ 2WLEA 2JO1A 4G3PA 2IU9A 2GGQA 1MR9A 4YXDC 1KGTA 1YP2A 3EH0A 2G3AA 3MQGA 2I5KA 1VL2A 3R4YA 1QRLA 1YP4A 5E3RA 2QJPC 3FSBA 3T57A 4FCEA 4H7OA 1DIPA 1YP3A 1VF5B 1MR7A 3HJJA 1QQ0A 3Q3DA 4H0LD 5KKZC 3FSXA 3FTTA 1AJYA 1S80A 4M98A 1YQ3C 1OW7A 1DD4A 1FDOA 2WLCA 3SRTA 1QRFA 3OW5A 2VHEA 5L6VA 2IU8A 3BSSA 5AFUU 3VBPA 2OI6A 1HM0A 1XATA 2FBWC 4EA9A 1G95A 2IC7A 3BFPA 4OGQD 1TU3F 1Y9BA 4H0LC 3F1XA 5ADXV 4H44C 3AEBC 4Z1MH 4K6RA 3VBIA 4R7PA 3TWDA 3RK3E 1G97A 3AE8C 2E75B 2QSIA 2FYNC 3LW5J 2V0JA 4EABA 3Q5RA 2WLFA 3AE2C 4GDOA 3SPTA 2BEQD 1KQFB 3GMAA 3EEVA 4KNXA 1ZRTE 1KILE 1S5LX 4OGQC 4N27A 4R37A 4HZCA 1S1CX 1PV3A 1T3DA 4U7JA 2V0HA 3IN6A 4E79A 3P1BA 4RKUJ 5E3QA 5DG3A 1KK5A 2WQYC 2NPOA 2BEZF 1V67A 2E74D 3D71A 2E76D 1PL5A 3AE3C 5AFUV 1KMIZ 3ABVC 5KLIC 2W0VA 2ZT9D 3OU9A 4PV1C 2OI7A 4HUSA 3V4EA 5ADXU 4R4LA 1R8EA 1JB0J 3AEDC 1KQAA 1J2ZA 1HJ0A 2IDBA 1UIXA 3JQYA 3D98A 4KPZA 2G8YA 3D70A 2GGOA 2E74C 3R1WA 4M99A 4IHGA 3TK8A 2WSEJ 4ISXA 3Q5SA 2WLDA 4E6UA 3AEFC 2V0LA 2D2CC 2ZT9C 1V3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUA A;  1HM0 A;  1Z90 A;  4J18 A;  4IHF A;  1HM9 A;  2TDT A;  1XAT A;  3KWE A;  4M28 A;  1SSQ A;  1G95 A;  3I3X A;  3TIO A;  4EA9 A;  4AA7 A;  5DEM A;  2QJY C;  1KRV A;  2IC7 A;  3BXY A;  4EAA A;  3VNP A;  3BFP A;  1SST A;  1OCX A;  3C8V A;  1MRL A;  4E6T A;  4HCQ A;  5L8R J;  3F1X A;  4EGG A;  5ADX V;  2YIU C;  4IHH A;  4K6R A;  1XHD A;  2WLG A;  4R7P A;  3VBI A;  3VBN A;  4HZD A;  3TWD A;  1FXJ A;  4MYO A;  2D2C B;  2QJK C;  3FOQ A;  3VBL A;  1G97 A;  1KRU A;  1Q90 D;  3BSY A;  5DEP A;  4KT0 J;  5U2K A;  2E75 B;  2QSI A;  2ZT9 B;  2QIV X;  1SSM A;  4DCL A;  2FYN C;  5L6S A;  2Q4J A;  3TV0 A;  3FS8 A;  3FWW A;  4R36 A;  3LW5 J;  2K9Y A;  2V0J A;  3IXC A;  4EAB A;  2WLF A;  4J09 A;  1LXA A;  3GVD A;  1KK4 A;  3Q1X A;  4KPX A;  1TDT A;  3PMO A;  3DJ4 A;  5E3P A;  3OTM A;  3SPT A;  4HUR A;  4N69 A;  3R5A A;  2WPV B;  2OEF A;  4Y28 J;  3DK5 A;  4H0L B;  3EEV A;  1HV9 A;  3I3A A;  2E74 B;  1ZRT E;  4H44 B;  2W0W A;  4KNX A;  2E76 B;  1QRG A;  4H13 B;  3GUE A;  4MZU A;  1S5L X;  2ICX A;  3D8V A;  4IL6 X;  2WSC J;  2QIW A;  2WLE A;  4N27 A;  4R37 A;  4G3P A;  4HZC A;  2V0K A;  1KHR A;  2GGQ A;  2IU9 A;  1MR9 A;  2JF3 A;  4G3S A;  4E1K A;  1T3D A;  4G87 A;  2V0H A;  3IGJ A;  4E79 A;  2JF2 A;  3P1B A;  4RKU J;  1KGT A;  1YP2 A;  3GOS A;  4N6A A;  3EH0 A;  3NZ2 A;  5E3Q A;  5DG3 A;  4MFG A;  3KWD A;  3CJ8 A;  1KK5 A;  3EG4 A;  2NPO A;  2VD4 A;  2P2O A;  1V67 A;  3OUP A;  3ECT A;  1THJ A;  3BSW A;  2QKX A;  2I5K A;  3MQG A;  3R5B A;  4EA8 A;  4KQL A;  1QRE A;  3DHO A;  4M9C A;  5F42 A;  4EA7 A;  1QRL A;  1YP4 A;  2V0I A;  5E3R A;  3OTZ A;  2QJP C;  3FSB A;  3MQH A;  5AFU V;  3R5C A;  5KLI C;  4AAW A;  3T57 A;  4OGQ B;  1KGQ A;  2RIJ A;  3R0S A;  4FCE A;  1HM8 A;  2W0V A;  4H7O A;  3VBJ A;  2QIA A;  3OU9 A;  1KRR A;  1YP3 A;  3P47 A;  3TDT A;  2WSF J;  2OI7 A;  1VF5 B;  4HUS A;  3V4E A;  2AQ9 A;  3KWC A;  5ADX U;  1MR7 A;  1KQA A;  1JB0 J;  4KNR A;  1J2Z A;  2O01 J;  3R8Y A;  4I7Z B;  2FKO A;  3JQY A;  3R2W A;  4G3Q A;  3HJJ A;  1QQ0 A;  3D98 A;  4KPZ A;  3MC4 A;  2OEG A;  5KKZ C;  3FSY A;  3FSC A;  3VBK A;  2GGO A;  2XAT A;  3FSX A;  2ICY A;  3FTT A;  3ST8 A;  2OI5 A;  3R1W A;  4M99 A;  4IHG A;  3HSQ A;  4EQY A;  3TK8 A;  2WSE J;  4ISX A;  1S80 A;  4M2B A;  4M98 A;  2WLD A;  1QRM A;  3R5D A;  4E6U A;  2WLC A;  2V0L A;  3SRT A;  1KK6 A;  3BRK X;  1QRF A;  3TIS A;  4M2A A;  3OW5 A;  1FWY A;  2VHE A;  3R3I A;  5L6V A;  4PV1 B;  2IU8 A;  3BSS A;  5AFU U;  3VBM A;  3R3R A;  1V3W A;  3VBP A;  4E75 A;  2OI6 A;  4AC3 A;  4N6B A; 
#chains in the Genus database with same CATH topology
 1CW5 A;  1M1K Q;  3HD7 A;  3PRJ A;  1AVO A;  2B87 B;  1NVO A;  5APY A;  4KT0 J;  3PHL A;  2WSE H;  4CPG A;  1ZXG A;  3H1J J;  4EOT A;  3L73 G;  4KJM A;  5KAF H;  1S3J A;  3HD7 C;  5AVY B;  3AE1 C;  1KK4 A;  4IFD K;  1J2J B;  4H0L B;  4H44 B;  2A45 H;  1WMK A;  1BE3 J;  1KB9 E;  2QIW A;  5BVZ A;  1KV4 A;  2JF3 A;  2FYN B;  3CWB D;  1J1D C;  3RK2 D;  2WTY A;  4O9B A;  4I7Z C;  3R5B A;  4KQL A;  1DH3 A;  4M9C A;  2PFX A;  5AW1 B;  3FGA D;  3L75 D;  1RE3 A;  1XTC C;  2E43 A;  1NTZ D;  1PGQ A;  3B71 A;  1E5W A;  3FX0 A;  3L72 G;  3IAO A;  2MKV A;  3R2W A;  1YBK A;  2IZ0 A;  3FXE A;  1RE3 C;  3M0A A;  1SQX K;  2FYU J;  1H89 A;  3MUD A;  3OH0 A;  4Y99 C;  1VQM P;  3IFM A;  5APT A;  4WBA A;  1NU1 D;  1P84 D;  1KB9 H;  1IFP A;  1SQB J;  1KRV A;  3CX5 D;  3TSI A;  1PGP A;  2ZJS E;  4MN4 C;  2P7J A;  3MUD C;  3EFG A;  3V4Q A;  1QVG O;  2D2C B;  1Q90 D;  3T97 B;  3H1J E;  2W6J H;  1EXI A;  2ZT9 B;  2I1K A;  3CLQ A;  3TF5 A;  1SSM A;  4R36 A;  1QX8 A;  2K9Y A;  1LXA A;  2QJY B;  1NTK J;  3DJ4 A;  4HH2 A;  3HUS B;  1W2E A;  3CMA P;  1BE3 E;  3FWN A;  1MKM A;  1IFI A;  1T6A A;  1L0N D;  2BAS A;  4NPE A;  4G87 A;  3GHG A;  5EFW B;  3CCV P;  3CXH H;  3U1C A;  3VTP C;  2XKM A;  3GLM A;  1NU1 J;  3CJ8 A;  3TYY A;  3VYI A;  1JO5 A;  1EDJ A;  5AW3 B;  3H6P A;  1G1I A;  2H89 C;  2JDI H;  3MQH A;  3BRT B;  1HF9 A;  2XNX A;  1SQQ J;  2OYI A;  1LTS C;  3GHG C;  3AEC C;  1GW4 A;  1BCC J;  3PP5 A;  2PP6 A;  3Q5P A;  3H1K J;  3G9R A;  1NO4 A;  2FKO A;  3P8C D;  2R5B A;  3FSY A;  2FKW B;  3IR9 A;  2XAT A;  2ICY A;  1VQ8 P;  2OYI C;  3HSQ A;  2FYU E;  1KOR A;  2QEX P;  2KNC A;  3L74 G;  3R5D A;  1KIL D;  5AVV B;  2R3S A;  1S5L E;  1L0N J;  4M2A A;  2HPC A;  4PD4 D;  1FDI A;  1KIL A;  2PRR A;  3AEA C;  5CHX A;  1LP1 A;  3JSV C;  3KWE A;  4L74 A;  3I3X A;  3H1H J;  1S4X A;  5K5G B;  3L75 E;  2XZR A;  1K04 A;  3C1L A;  5CCG D;  1ZW0 A;  4EIJ A;  3VBL A;  1S72 P;  1L0L K;  1PP9 D;  5KLV G;  1FJP A;  1KIL C;  1HVV A;  1IFM A;  5KAI E;  1ZME C;  3CC4 P;  2K9J A;  2BCC J;  2N1T D;  5CCH D;  1CI6 A;  1JOC A;  4K35 A;  3AE9 C;  1Y8A A;  1USE A;  2YIU B;  1Q81 Q;  4GKG A;  3CCL P;  3RBZ A;  5CCH A;  1N7L A;  4RJT A;  1NTK G;  2IU9 A;  3V2R A;  2Q9I A;  2W90 A;  1MFT A;  1KGT A;  1NU1 E;  3EH0 A;  5TIS E;  1H0T B;  1RHZ B;  4U3F G;  2ZYD A;  1OX3 A;  1T3J A;  3FWL A;  2I5K A;  5E79 E;  1YP4 A;  2QJP C;  3FSB A;  1SQQ E;  5CCH C;  2B87 A;  2WPQ A;  1JY3 P;  1BCC E;  3E1R A;  1T3U A;  3H1K E;  3L70 D;  3HJJ A;  1QQ0 A;  4H0L D;  3UIA A;  3FSX A;  3OJA B;  1KFN A;  3G4S P;  3C9I A;  1OW7 A;  1L0N E;  1LTT C;  2WZ7 A;  4D6T J;  3SSU A;  2ZXE B;  2M0B A;  3I55 P;  5L6V A;  1JUN A;  3HE4 B;  2W6A A;  1AVY A;  1XAT A;  1G95 A;  2KI7 B;  2Y9Y A;  1JY2 O;  3JC2 2;  2QRX A;  4H0L C;  1P84 H;  5TIS H;  4H44 C;  3AEB C;  4Z1M H;  1SQV J;  3VBI A;  3CX5 H;  2HOD B;  1UII A;  2P2U A;  3M9Q A;  1G97 A;  3QWO C;  3SWF A;  5C39 A;  5BU5 A;  2E75 B;  3CCQ P;  2FYN C;  2BCC E;  2V0J A;  4EAB A;  3PJS K;  3RK2 B;  3SPT A;  1SQP D;  2BEQ D;  1LTG C;  3GMA A;  1OVU A;  5AVZ B;  1KIL E;  1SQX G;  1D7M A;  2Y0C A;  1S5L X;  2AEJ A;  5AVQ B;  2YNY A;  1J1E B;  1T3D A;  1MUU A;  3TGU D;  1JTH B;  5DG3 A;  4OH8 B;  1K8A Q;  3CCJ P;  3O8Z A;  3D71 A;  2E76 D;  4C7N B;  1PPJ D;  1PP9 E;  3N7N A;  1NTM G;  2N9B A;  2ZT9 D;  3P8M C;  1SFC D;  5H2F E;  1BGY D;  3M06 A;  3V4E A;  3T97 A;  1M8N A;  1R8E A;  2OYO A;  3AED C;  4WB4 A;  1KQA A;  4HB1 A;  1EDI A;  1UIX A;  1SLQ A;  1H8A A;  1YIT P;  1VDF A;  3R1W A;  4M99 A;  3HUS A;  2WSE J;  4ISX A;  5AW8 B;  2O1K A;  2NPS B;  1VQN P;  1VQ5 P;  4AQR D;  4D6T E;  2D2C C;  2O3J A;  2OYH B;  3TGU J;  2ZT9 C;  1V3W A;  2OTJ P;  2QJY C;  4PD4 H;  4EAA A;  3OGZ A;  1LT9 A;  3AEE C;  3HUS C;  1MRL A;  3L73 D;  5L8R J;  1E79 H;  1SQV E;  1X0T A;  3MZW B;  1VQL P;  2WLG A;  5CMZ A;  3OH4 A;  3WUV A;  1AFO A;  2A06 G;  1Q86 Q;  3Q1M A;  3TV0 A;  3FS8 A;  3VN0 A;  2WT7 B;  1LT9 C;  2W27 A;  3JCU E;  1BDD A;  5H2F H;  2W0W A;  2KYV A;  1IK7 A;  2FFD B;  2CK3 H;  2CPS A;  3GF3 A;  4JPZ B;  5GTI E;  4N6A A;  2GM4 A;  4I1L A;  2OAR A;  3MGN A;  3EG4 A;  2KSJ A;  3BSW A;  2V0I A;  5B66 E;  3L71 D;  4ZMD A;  3L72 D;  3H1L J;  4AAW A;  2IBZ G;  2RIJ A;  1VQ6 P;  3VBJ A;  1L0L G;  3KXD A;  3TNU A;  2KP8 A;  3TDT A;  1LTJ B;  1IJD B;  2IZ1 A;  2WVR A;  2L5G B;  2FYU K;  1K05 A;  3R8Y A;  1LT1 A;  1LWU B;  2O1J A;  1FZE A;  3FSC A;  3GG2 A;  4ZKP A;  1OIP A;  2OI5 A;  5KLI B;  1U7J A;  4EQY A;  1YTZ I;  1BSN A;  5AW9 B;  3SFE C;  2V4H A;  4M2B A;  1SQB K;  3TGU E;  3CC2 P;  2YO3 A;  1FWY A;  3R3I A;  2A45 I;  3VBM A;  4ZKU A;  2DW3 A;  4E75 A;  4N6B A;  3M0D A;  5TJH A;  3TIO A;  1SSQ A;  1H0T A;  3L71 J;  2HR3 A;  1YJN P;  2N1T B;  2YIU C;  5CJ0 A;  1NTK K;  5AVR B;  3FOQ A;  1BGY E;  1KRU A;  1OMI A;  3M0D C;  3I5C A;  2CPB A;  5L6S A;  1OVV A;  2KLV A;  2QM8 A;  3IXC A;  4J09 A;  2P10 A;  5AW7 B;  4N69 A;  3USS A;  3SWY A;  3P7K A;  2FXM A;  3IF4 A;  2YXR B;  3HTK B;  4E1K A;  3OW2 O;  2Q3I A;  4MFG A;  3KWD A;  1BSH A;  1SQQ K;  2KLU A;  1RQU A;  1EXJ A;  1G2C B;  4NPF X;  3HE4 A;  4H13 D;  2K1A A;  3H1L E;  3HE5 B;  3MTU E;  1KB9 I;  4RES B;  2WSS H;  2E75 D;  3CI9 A;  3B5N D;  2HOD A;  2W8Z A;  3S4R A;  3KWC A;  1FZA A;  3L74 D;  1KQG B;  2OQQ A;  2WMM A;  2C0W A;  2Y9Z A;  3EWK A;  3NTN A;  1N2D C;  3PLN A;  4OWF A;  4H13 C;  2Q6Q A;  4JYC A;  5AVS B;  2QM7 A;  3TIS A;  1ZR2 A;  4BRY B;  2E75 C;  3BAS A;  2R44 A;  4OVN F;  2KZI A;  1JTH A;  3L71 E;  3WUT A;  3LIE A;  3RK2 C;  5KLV D;  3CXH I;  2XND H;  4C7R A;  1QL1 A;  3P32 A;  4WVZ A;  2ZYG A;  3CCE P;  3CXH E;  4EYY Q;  4C7N A;  2P1J A;  4HZD A;  1YYC A;  1K9M Q;  3MP7 B;  1J1E C;  3CWB J;  3V6I A;  4DCL A;  1EDL A;  2K88 A;  4KPX A;  4IL6 H;  1NHL A;  3O6Q B;  3PMO A;  1FAV A;  2NPS D;  2C0X A;  3L75 J;  2E76 B;  3D6Y A;  2QJK B;  1FOS F;  1NTM K;  4G3P A;  2GGQ A;  2NPS A;  1NTZ J;  3H1I D;  1KC8 Q;  2GA1 A;  1YP2 A;  1SFC B;  2OYH A;  2IFM A;  1KQL A;  1AA0 A;  4GOD A;  1S2E A;  2IX7 C;  1Q82 Q;  1QRL A;  1EZV D;  1VPC A;  1X8Y A;  1EWW A;  3H1J G;  3GQ7 A;  1GW3 A;  2C9L Y;  2WPR A;  2M3B A;  2NPS C;  4H7O A;  5AW2 B;  1JM0 A;  1YP3 A;  2OYH C;  3II6 A;  1IFD A;  1LT9 B;  1URQ D;  3R2P A;  1BE3 G;  5APV A;  4WY4 D;  3CCS P;  2WT7 A;  2JWD A;  3FTT A;  1IO4 A;  5AW6 B;  1AJY A;  4M98 A;  1DD4 A;  1HJB A;  3H1I J;  3OW5 A;  1NAF A;  2FFD A;  2OI6 A;  1LTI C;  1SQV K;  1N73 B;  1PFI A;  1CZQ A;  5AVT B;  4GT1 A;  1K73 Q;  5ADX V;  5AVU B;  5AW4 B;  4K6R A;  3BRV B;  1L4A D;  3TWD A;  2FXO A;  2FFD C;  3CWB E;  2QSI A;  1SQX D;  1JY2 N;  3RK3 B;  2Y0E A;  3VMX A;  1NAY A;  3Q5R A;  1LTJ A;  1VQ7 P;  1LTB C;  3AE2 C;  2FYU G;  4GDO A;  4RO0 A;  4TLF A;  1LWU A;  4KNX A;  4HKZ H;  1FJK A;  3MD0 A;  4JQ0 D;  3TNU B;  1NTZ E;  1IC2 A;  1SQB G;  1PV3 A;  2V0H A;  3P1B A;  1LTJ C;  4AYC A;  5E3Q A;  5CCG A;  2W83 C;  3L75 G;  3CC7 P;  1KK5 A;  2NPO A;  3ZDM A;  1V67 A;  2J58 A;  2E74 D;  1LWU C;  2QVA A;  3TDK A;  2IFN A;  3NMD A;  5KLI C;  2N1T A;  4YPC A;  5CCG C;  3OU9 A;  1HUC A;  1P84 I;  2ZVO B;  4ZNC A;  3CX5 I;  4HUS A;  4EDF A;  1P84 E;  3VMA A;  1HJ0 A;  2IDB A;  3CX5 E;  4DT0 A;  3D98 A;  4HYT B;  1WRG A;  3D70 A;  2N1T C;  2E74 C;  3TK8 A;  2RKL A;  3Q5S A;  1NU1 G;  1KFM A;  3E7K A;  3H1I E;  1PP9 J;  3WU2 H;  2OGU A;  1U7M A;  3HTK A;  1BDC A;  1SQQ G;  5KKZ B;  1EZV E;  3VNP A;  3SWK A;  3M9B A;  3SUC A;  1G2C A;  1BCC G;  4L76 A;  2RH0 A;  3HE5 A;  3D6Z A;  1DEE G;  1JMB A;  3H1K G;  5AVX B;  3BSY A;  2JP3 A;  1Z2F A;  3OAK A;  4R4M A;  3FWW A;  5KJ7 D;  4N78 D;  3KYQ A;  3KPE A;  1L0N G;  3VP8 A;  4Y28 J;  2N9Y B;  3DK5 A;  1YI2 P;  2E42 A;  1QRG A;  4H13 B;  1LTA C;  1YTZ T;  2V7Q H;  2AEM A;  3H1H G;  5M1B A;  3B4S A;  3GOS A;  1WT6 A;  2L91 A;  4BRY A;  3B5N B;  3L70 J;  3P8C E;  2VD4 A;  2P2O A;  3AE7 C;  2ZVN B;  2QKX A;  1L0L D;  3RBX A;  5F42 A;  1Q7Y Q;  3CD6 P;  4A7P A;  3OA7 A;  1GTW A;  1KGQ A;  3R0S A;  1JY3 O;  4PD4 I;  2YMY A;  2BCC G;  3V2P A;  2B89 A;  1LGH B;  4WWI A;  4PD4 E;  1KRR A;  1ZP0 C;  3A3Y B;  2AQ9 A;  2Q1K A;  1U57 A;  3KZI H;  2H88 C;  5APU A;  1XTG B;  1JEK A;  1OWA A;  1YJ9 P;  1DD3 A;  2B88 A;  3O6Q A;  3ST8 A;  1QGK B;  3F89 A;  1KQS O;  2IYP A;  2RMZ A;  2IPP A;  3BCC D;  3R3R A;  4AC3 A;  1JMM A;  2TDT A;  5APX A;  4K3A A;  3H32 B;  1PP9 G;  1SFC A;  1M57 D;  1SQP J;  1KTM A;  5AW0 B;  5BU8 B;  2Z4E A;  2I1J A;  1M90 Q;  2JWA A;  1NJI Q;  2E76 C;  1XHD A;  2QJK C;  1FC2 C;  2H43 A;  2FXP A;  1FU1 A;  3Q2Y A;  2Q4J A;  4UB6 H;  1SFC C;  3RL0 D;  1TDT A;  5E3P A;  4YTP C;  4D6T G;  2MJZ A;  2KSE A;  3GUE A;  4PJ0 E;  2ICX A;  2YMK A;  1NH4 A;  2JEE A;  1YHQ P;  1ZLL A;  3NFQ A;  1BGY J;  3IGJ A;  3NZ2 A;  3L70 E;  1YJW P;  2J5U A;  1SQV G;  3ECT A;  4EA8 A;  1N73 A;  1URQ B;  3OTZ A;  2Z5I A;  2ZYA A;  4UB8 H;  4WY4 B;  3RL0 g;  4M3L A;  1A02 F;  2H8P D;  3RK3 D;  4LC1 A;  4N78 E;  1L2P A;  1M56 D;  2YKP A;  1VQO P;  1N73 C;  3AE5 C;  4JBZ A;  1X22 A;  3L73 J;  4DZO A;  2HFE D;  5B5E H;  1GK4 A;  1N86 A;  2KOG A;  1MV8 A;  2M8R A;  1ZRT D;  1L0S A;  3BRK X;  2Q5U A;  4GOE A;  1L4A B;  1Q2N A;  3RK3 C;  3CME P;  3OH1 A;  4PJ0 H;  3ITK A;  3AE4 C;  2WSF H;  1SQP E;  1X9V A;  3AE6 C;  3C8V A;  3U59 A;  1N7S D;  1YQ4 C;  4HCQ A;  4PV1 D;  1FXJ A;  2P67 A;  1GMJ A;  1VQ9 P;  2KZJ A;  3GVD A;  1PIX A;  3OTM A;  4IOI H;  4HUR A;  1GL2 D;  1S9K D;  1NTZ K;  4L73 A;  3L72 J;  2E74 B;  1PPJ E;  3TGU G;  1OW8 A;  3EQ2 A;  2H7H A;  3L36 A;  1RF0 A;  2JO1 A;  2A45 G;  3G3Z A;  3BCC E;  1MR9 A;  4YXD C;  3H1J D;  1AQ5 A;  2KB7 P;  4BWN A;  2G3A A;  3MQG A;  1VL2 A;  3R4Y A;  1BGY G;  1RF0 C;  1NU1 K;  3WMM 0;  1BE3 D;  1JCC A;  4QMA A;  1DIP A;  3GW6 A;  3HD7 D;  1VF5 B;  2WSC H;  1SP4 A;  3G71 P;  5KKZ C;  2YXQ B;  2ZAE B;  3L73 E;  3I56 P;  1OZH A;  1S80 A;  4IFF A;  1FDO A;  2WLC A;  3SRT A;  2IYO A;  1QRF A;  3OH3 A;  2AEF A;  4IL6 E;  1GD2 E;  1PZQ A;  2R32 A;  2Y0D A;  3VBP A;  1W5C E;  3H1L G;  1HM0 A;  4EA9 A;  2IC7 A;  3A5T A;  3B5N A;  3BFP A;  1L0N K;  4KHX A;  1Y9B A;  1RF1 B;  4R7P A;  2FYU D;  3V5B A;  3RK3 E;  2QG4 A;  3F5H A;  2OTK E;  3AE8 C;  1KD1 Q;  3W67 A;  3B5N C;  1FZC A;  1SQB D;  2LR2 A;  3L72 E;  1FZF A;  1PGO A;  3EEV A;  1HH0 A;  1ZRT E;  4YXW H;  4GIF A;  1QVF O;  4R37 A;  1S1C X;  3L71 G;  4U7J A;  3IN6 A;  1FZC C;  2UWJ E;  3L74 J;  2J59 M;  2WQY C;  1GDT A;  2BEZ F;  2R3C A;  1NTK D;  2E5Y A;  3GQ8 A;  4I2L C;  1AV1 A;  1PL5 A;  3LW5 H;  3AE3 C;  3H32 A;  5AFU V;  1KMI Z;  1T8Z A;  4U3F D;  3E1I A;  2WIT A;  2W0V A;  1QL2 A;  2E5T A;  4R4L A;  1JB0 J;  1J2Z A;  5GTH E;  1S9K E;  1IFN A;  2XDJ A;  5KLV J;  2FY8 A;  1M1J B;  1RY3 A;  4XE5 B;  2KK7 A;  1SQQ D;  4E6U A;  3AEF C;  3FXD A;  4DJG A;  2K3R A;  1BCC D;  3BAT A;  3U1A A;  5CBN A;  4J18 A;  4IHF A;  3H1K D;  1HM9 A;  4AA7 A;  5AW5 B;  2QE7 H;  3QH9 A;  1W2B O;  1OCX A;  2WPS A;  3RL0 B;  2V7Q J;  1FBM A;  4U3F J;  2ZFC A;  3A2A A;  3SFD C;  1URQ A;  1ZN5 A;  3S9O A;  3V4W A;  4WY4 A;  3NXS A;  2GUS A;  5DEP A;  5U2K A;  2YKO A;  3AEG C;  4XFJ A;  1ZV8 A;  2C9N Y;  4JF7 A;  1MFZ A;  1N8R Q;  2GUV A;  1IZN B;  1LJ2 A;  3H1H D;  2ITA A;  1G1J A;  1AQT A;  1URQ C;  2B9B A;  2Z5H A;  5GTH H;  4WY4 C;  5DJT B;  4IL6 X;  3RGU A;  2V0K A;  1HTL C;  1HBW A;  2NZ2 A;  2JF2 A;  4TT3 H;  3L74 E;  3L4F A;  3M91 A;  1L4A A;  1RE4 A;  1QEX A;  2BCC D;  2K37 A;  4EA7 A;  1FZG A;  2AXT E;  3WU2 E;  3VMZ A;  4W7Z A;  3CWB G;  1OW6 A;  5APS A;  4GOF A;  1NYH A;  4OGQ B;  3GQA A;  2OTL P;  1NOH A;  1EQ7 A;  4ASW A;  3K5B A;  1L4A C;  2I8D A;  1RE4 C;  5CJ4 A;  4C46 A;  3GF7 A;  1SQB E;  1SVF A;  2O01 J;  1NKZ B;  1NTM D;  5KLV E;  3MC4 A;  1ZR4 A;  1JY3 N;  1NTZ G;  2M5A B;  1RH5 B;  1IK9 A;  1N7S B;  4IFM A;  1R5S A;  4L75 A;  1KK6 A;  1SQP K;  2WWW A;  4PV1 B;  2VRS A;  1SQX J;  1NTK E;  1Z90 A;  1T2K D;  1JNM A;  5DEM A;  3BXY A;  2YO2 A;  1ZOY C;  3GQ9 A;  1SST A;  1JY2 P;  4U3F E;  1GL2 B;  2O01 N;  2HLO A;  2P58 A;  4D6T D;  1VF5 D;  2AXT H;  3PTZ A;  2AXC A;  1NGM B;  2RN0 A;  3CPW O;  1OVR A;  1NTM J;  1EZV I;  3PH0 A;  3Q1X A;  1S5L H;  1KYO D;  2WPV B;  2OEF A;  1T2K C;  5APW A;  3H1I G;  2A06 D;  3KHU A;  3HRN A;  1SQV D;  1FOS E;  4W80 A;  4MZU A;  2KS1 B;  3KZI E;  3H25 A;  4ASV A;  3V2Q A;  1KHR A;  3KQG A;  4XA4 A;  4G3S A;  1M8O B;  1EZV G;  1VF5 C;  2PAJ A;  1FZB A;  3HD7 B;  3OUP A;  1THJ A;  1KZU B;  4H44 D;  1QRE A;  3DHO A;  1QLE D;  5KAI H;  3R5C A;  5KJ7 A;  2M3E A;  4NPD A;  1HM8 A;  1RF1 A;  4DOJ A;  2QIA A;  3P47 A;  3CL3 D;  2WSF J;  1RQV A;  1J1D B;  3VOP A;  3G6E P;  2KIK A;  2IBZ D;  4KNR A;  3H1H E;  4I7Z B;  4G3Q A;  3KDP B;  2OEG A;  5KJ7 C;  3VBK A;  3MIW A;  2JJL A;  4JYB A;  1LNQ A;  1RF1 C;  4UB6 E;  2XV5 A;  1QRM A;  4W7Y A;  5E79 H;  1PGJ A;  1SQX E;  3A7O A;  1R5L A;  1FZC B;  2IUA A;  4DCK A;  4M28 A;  3B8E B;  2Q7C A;  5DJU B;  2Q3E A;  4E6T A;  2POH A;  4EGG A;  3CCU P;  4LGD E;  3OH2 A;  3W68 A;  4IHH A;  2KUB A;  1VQ4 P;  3VBN A;  1Y47 A;  4MYO A;  1YIJ P;  4Y99 B;  1GK6 A;  3CCM P;  4B86 A;  2QIV X;  1NTM E;  1FS0 E;  3CCR P;  4UB8 E;  1L0L J;  3R5A A;  3A0B E;  1OXZ A;  1HV9 A;  2D2C D;  3I3A A;  2O01 H;  2QA4 P;  1M1J A;  3D8V A;  2WSC J;  2WLE A;  3L35 A;  5B5E E;  1IFJ A;  1CSB A;  4LLH A;  1MZ9 A;  3M9H A;  5E3R A;  1M1J C;  3T57 A;  3A0H E;  4FCE A;  3VP9 A;  1DEB A;  1DX7 A;  2HYN A;  1EDK A;  3LID A;  2LXC B;  3BCC J;  1KYO I;  1MR7 A;  1EC5 A;  1HWT C;  1KYO E;  3Q3D A;  1VQP P;  2A06 E;  3MHV A;  3RL0 C;  3H1L D;  4BXL A;  4I6M C;  3L37 A;  1YQ3 C;  3L70 G;  1N4I A;  3GHG B;  5KTB A;  1KB9 D;  3A0B H;  2VHE A;  2IU8 A;  3BSS A;  2LKM A;  5AFU U;  2NRG A;  4HJG H;  2FBW C;  2ZXX A;  3N4X A;  2OYI B;  4OGQ D;  1TU3 F;  3F1X A;  5APQ A;  2FYZ A;  2IBZ I;  2HG5 D;  1GU5 A;  2IBZ E;  1FDM A;  3LW5 J;  3A0H H;  2WLF A;  4N6J A;  1L0L E;  1H88 A;  1KQF B;  2KNC B;  4EI2 A;  1HGV A;  3CXH D;  1KYO H;  4OGQ C;  2M5A A;  2HPC B;  4N27 A;  4HZC A;  1N7S A;  2R5D A;  3TK1 A;  3EFF K;  1KIL B;  2SPZ A;  3WUU A;  1SQP G;  5CBO A;  5AVW B;  1VQK P;  4E79 A;  4RKU J;  1LP1 B;  1HGZ A;  2PGD A;  2JKV A;  1X79 B;  1M7L A;  1NKN A;  4AUW A;  2JR8 A;  1USD A;  5KAF E;  3ABV C;  2LXB A;  2W6B A;  1N7S C;  2YKQ A;  1KN7 A;  1NWQ A;  1GL2 A;  3JCU H;  1A02 J;  5KLV K;  2K9J B;  4PV1 C;  2OI7 A;  5ADX U;  3V2N A;  1CI6 B;  1PPJ G;  2KXP B;  3JQY A;  4KPZ A;  1GZL A;  2XU6 A;  2G8Y A;  2GGO A;  5GTI H;  1SS1 A;  2QJP B;  3BCC G;  4IHG A;  3S1K A;  1OFC X;  1GL2 C;  1FE6 A;  2WLD A;  1GU4 A;  2V0L A;  5B66 H;  2KS1 A;  1JCD A;  3VMY A;  3BVH A;  1Z56 A;  4N3Y B; 
#chains in the Genus database with same CATH homology
 4J18 A;  4IHF A;  1HM9 A;  4AA7 A;  2QJY C;  4EAA A;  3VNP A;  1OCX A;  3AEE C;  1MRL A;  5L8R J;  2V7Q J;  3D6Z A;  2WLG A;  3SFD C;  3S9O A;  3BSY A;  5DEP A;  4KT0 J;  5U2K A;  2JP3 A;  3AEG C;  4XFJ A;  3Q1M A;  3TV0 A;  3FS8 A;  4R4M A;  3FWW A;  3AE1 C;  1KK4 A;  4Y28 J;  3DK5 A;  4H0L B;  4H44 B;  2W0W A;  1WMK A;  1QRG A;  4H13 B;  4IL6 X;  1IK7 A;  2QIW A;  2V0K A;  2JF3 A;  3GF3 A;  2NZ2 A;  5M1B A;  2JF2 A;  4TT3 H;  3GOS A;  4N6A A;  3EG4 A;  2VD4 A;  2P2O A;  3AE7 C;  4I7Z C;  3BSW A;  3R5B A;  2QKX A;  4KQL A;  4EA7 A;  4M9C A;  5F42 A;  2V0I A;  3FGA D;  1OW6 A;  4AAW A;  1NYH A;  4OGQ B;  1KGQ A;  2RIJ A;  3R0S A;  3VBJ A;  1KRR A;  1ZP0 C;  3TDT A;  3B71 A;  2AQ9 A;  3GF7 A;  1U57 A;  3IAO A;  1K05 A;  2O01 J;  3R8Y A;  2H88 C;  2MKV A;  3R2W A;  3MC4 A;  3FSC A;  1DD3 A;  3O6Q A;  2OI5 A;  3ST8 A;  4EQY A;  3SFE C;  4M2B A;  1KK6 A;  1FWY A;  3R3I A;  4PV1 B;  3VBM A;  3R3R A;  4E75 A;  4AC3 A;  4N6B A;  1Z90 A;  2TDT A;  3TIO A;  1SSQ A;  5DEM A;  1KRV A;  3BXY A;  1ZOY C;  1KTM A;  1SST A;  2YIU C;  2E76 C;  1XHD A;  2D2C B;  2QJK C;  3FOQ A;  1KRU A;  1Q90 D;  1VF5 D;  3T97 B;  1OMI A;  2FXP A;  1EXI A;  1NGM B;  2ZT9 B;  3Q2Y A;  1SSM A;  5L6S A;  2Q4J A;  4R36 A;  2K9Y A;  3IXC A;  4J09 A;  1LXA A;  3Q1X A;  2P10 A;  1TDT A;  3DJ4 A;  5E3P A;  4N69 A;  4YTP C;  2WPV B;  2OEF A;  3GUE A;  4MZU A;  2ICX A;  3H25 A;  1MKM A;  2YMK A;  1KHR A;  4E1K A;  4G3S A;  4G87 A;  3IGJ A;  3NZ2 A;  1VF5 C;  3GLM A;  4MFG A;  3KWD A;  3CJ8 A;  2J5U A;  3OUP A;  1RQU A;  1EXJ A;  3ECT A;  1THJ A;  4EA8 A;  4H44 D;  1QRE A;  3DHO A;  4H13 D;  3OTZ A;  2H89 C;  3MQH A;  3R5C A;  1HF9 A;  1HM8 A;  2E75 D;  3RL0 g;  3AEC C;  2QIA A;  3P47 A;  2WSF J;  1RQV A;  3KWC A;  3Q5P A;  1KQG B;  4KNR A;  2OQQ A;  3G9R A;  4I7Z B;  2FKO A;  4G3Q A;  3AE5 C;  2OEG A;  3FSY A;  3EWK A;  3VBK A;  2XAT A;  2ICY A;  3HSQ A;  1KOR A;  4H13 C;  1QRM A;  3R5D A;  3BRK X;  3TIS A;  4M2A A;  2E75 C;  1FDI A;  2IUA A;  3AEA C;  4M28 A;  3KWE A;  3AE4 C;  3I3X A;  3AE6 C;  3C8V A;  4E6T A;  1YQ4 C;  4HCQ A;  4EGG A;  1K04 A;  4IHH A;  3VBN A;  4PV1 D;  4HZD A;  1FXJ A;  4MYO A;  3VBL A;  2QIV X;  1GMJ A;  1ZME C;  4DCL A;  3GVD A;  1PIX A;  4KPX A;  3PMO A;  3OTM A;  4HUR A;  3R5A A;  3AE9 C;  1HV9 A;  2D2C D;  3I3A A;  2E74 B;  1OW8 A;  2E76 B;  3D6Y A;  3D8V A;  2WSC J;  2WLE A;  2JO1 A;  4G3P A;  2IU9 A;  2GGQ A;  1MR9 A;  4YXD C;  1KGT A;  1YP2 A;  3EH0 A;  2G3A A;  3MQG A;  2I5K A;  1VL2 A;  3R4Y A;  1QRL A;  1YP4 A;  5E3R A;  2QJP C;  3FSB A;  3T57 A;  4FCE A;  4H7O A;  1DIP A;  1YP3 A;  1VF5 B;  1MR7 A;  3HJJ A;  1QQ0 A;  3Q3D A;  4H0L D;  5KKZ C;  3FSX A;  3FTT A;  1AJY A;  1S80 A;  4M98 A;  1YQ3 C;  1OW7 A;  1DD4 A;  1FDO A;  2WLC A;  3SRT A;  1QRF A;  3OW5 A;  2VHE A;  5L6V A;  2IU8 A;  3BSS A;  5AFU U;  3VBP A;  2OI6 A;  1HM0 A;  1XAT A;  2FBW C;  4EA9 A;  1G95 A;  2IC7 A;  3BFP A;  4OGQ D;  1TU3 F;  1Y9B A;  4H0L C;  3F1X A;  5ADX V;  4H44 C;  3AEB C;  4Z1M H;  4K6R A;  3VBI A;  4R7P A;  3TWD A;  3RK3 E;  1G97 A;  3AE8 C;  2E75 B;  2QSI A;  2FYN C;  3LW5 J;  2V0J A;  4EAB A;  3Q5R A;  2WLF A;  3AE2 C;  4GDO A;  3SPT A;  2BEQ D;  1KQF B;  3GMA A;  3EEV A;  4KNX A;  1ZRT E;  1KIL E;  1S5L X;  4OGQ C;  4N27 A;  4R37 A;  4HZC A;  1S1C X;  1PV3 A;  1T3D A;  4U7J A;  2V0H A;  3IN6 A;  4E79 A;  3P1B A;  4RKU J;  5E3Q A;  5DG3 A;  1KK5 A;  2WQY C;  2NPO A;  2BEZ F;  1V67 A;  2E74 D;  3D71 A;  2E76 D;  1PL5 A;  3AE3 C;  5AFU V;  1KMI Z;  3ABV C;  5KLI C;  2W0V A;  2ZT9 D;  3OU9 A;  4PV1 C;  2OI7 A;  4HUS A;  3V4E A;  5ADX U;  4R4L A;  1R8E A;  1JB0 J;  3AED C;  1KQA A;  1J2Z A;  1HJ0 A;  2IDB A;  1UIX A;  3JQY A;  3D98 A;  4KPZ A;  2G8Y A;  3D70 A;  2GGO A;  2E74 C;  3R1W A;  4M99 A;  4IHG A;  3TK8 A;  2WSE J;  4ISX A;  3Q5S A;  2WLD A;  4E6U A;  3AEF C;  2V0L A;  2D2C C;  2ZT9 C;  1V3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...