3C8VA

Crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
476
structure length
453
Chain Sequence
GMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGKNFTFNIIQPYQDGDPRGMYPTILIQPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (YP_390128.1) from Desulfovibrio desulfuricans G20 at 2.28 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
molecule tags Transferase
total genus 165
structure length 453
sequence length 476
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18776 Hexapep_loop Hexapeptide repeat including loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3c8vA04
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA03
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA02
2VD4A 1G97A 3TISA 3EG4A 2QIAA 3VNPA 2P2OA 2E76B 2QJPC 3KWCA 4EGGA 2E74B 3BRKX 4M98A 1S80A 5E3PA 3OTMA 4G87A 5AFUV 4R37A 3FSYA 3I3AA 4FCEA 4AC3A 3D8VA 4M2BA 4MZUA 2OI5A 4KPXA 3BFPA 1MR9A 4H7OA 1G95A 1HM9A 5F42A 4KPZA 4HUSA 3SPTA 3FOQA 1YP4A 4HCQA 3NZ2A 3ECTA 3GOSA 2W0WA 4EQYA 1T3DA 4R7PA 1KK5A 3FSBA 3FS8A 3CJ8A 3LW5J 1HM8A 4IHFA 3ST8A 2TDTA 2JF3A 4E1KA 3HJJA 2Q4JA 2WLCA 3MQHA 3EEVA 4K6RA 3EH0A 5DEPA 5L6VA 4N6AA 2GGQA 2IU8A 5ADXU 2D2CB 3TIOA 3DJ4A 3GUEA 1KRRA 1KRUA 2E75B 2V0KA 4EA9A 3T57A 2GGOA 3SRTA 4M28A 4HZDA 1QREA 4M9CA 2I5KA 3OW5A 1KGTA 1QRGA 2WLDA 3R5CA 3VBIA 2WPVB 1MRLA 2V0HA 3VBMA 2WLGA 3VBJA 4DCLA 3FSCA 4G3QA 4J18A 5ADXV 1Z90A 2ICYA 3F1XA 4IL6X 3DK5A 2WLFA 2QIVX 5L8RJ 1SSMA 5E3QA 5KKZC 1HM0A 1KQAA 1YP2A 2WLEA 2V0JA 4E75A 1XATA 3P1BA 2IUAA 2RIJA 3BSWA 4KNRA 2FKOA 1LXAA 4N69A 3VBKA 2OEGA 3MC4A 4G3PA 5DG3A 1SSQA 3IGJA 3BXYA 2QIWA 4J09A 3OUPA 4EAAA 3TWDA 1YP3A 2VHEA 1KRVA 4E6TA 1HV9A 3KWDA 3TK8A 1ZRTE 3FWWA 1QRFA 3FTTA 4N27A 1QRMA 3VBLA 4M99A 3I3XA 2FYNC 1OCXA 3R5AA 3BSSA 4EA7A 1TDTA 3OU9A 4M2AA 4RKUJ 5KLIC 5E3RA 1THJA 4E6UA 2WSCJ 5DEMA 1Q90D 3HSQA 1VF5B 1MR7A 1KK4A 4AA7A 4KQLA 3IXCA 2QKXA 1V3WA 3R3IA 1FWYA 4H0LB 4KNXA 3V4EA 3BSYA 2V0IA 3KWEA 4EABA 2IU9A 3VBPA 3R3RA 1S5LX 1J2ZA 3JQYA 2ZT9B 4H13B 4I7ZB 3OTZA 3VBNA 3Q1XA 4OGQB 2O01J 4H44B 2NPOA 3R5BA 3R5DA 4ISXA 2QJYC 4HZCA 4PV1B 1KK6A 3FSXA 4G3SA 3R2WA 4E79A 2OEFA 3R0SA 2JF2A 2OI7A 4R36A 3P47A 2AQ9A 2OI6A 2K9YA 4KT0J 1QQ0A 2V0LA 3MQGA 1QRLA 1SSTA 2XATA 3GVDA 3R1WA 2WSFJ 4Y28J 4IHHA 3PMOA 1FXJA 2WSEJ 4MFGA 5U2KA 3DHOA 4N6BA 4AAWA 4HURA 3R8YA 1XHDA 4EA8A 3C8VA 3TDTA 2ICXA 3TV0A 4IHGA 1JB0J 5AFUU 2QSIA 1V67A 1KHRA 2IC7A 2QJKC 2W0VA 3D98A 2YIUC 4MYOA 1KGQA 5L6SA
chains in the Genus database with same CATH superfamily
3LIDA 5AW6B 3SFEC 1DD3A 1VL2A 4XA4A 3RL0B 5E3PA 4IL6E 1RF1B 3B4SA 4BRYB 1GK6A 1SQXD 3FOQA 3NTNA 3EFGA 3ECTA 3CC2P 3E7KA 4R7PA 1KK5A 3ST8A 2FFDA 2WLCA 1H0TB 4IL6H 2A06E 5EFWB 1N8RQ 3IN6A 1QREA 3OW5A 2H43A 2ZFCA 1DIPA 4G3QA 1VQKP 3M9QA 3D6ZA 1P84E 3M9HA 1IO4A 1BE3G 1BGYG 1RF1A 1FE6A 3P32A 1BDDA 3VYIA 1AVYA 2OYHC 1P84H 4E6TA 1H0TA 3FWWA 1OCXA 2FBWC 1GDTA 2QJKB 3PLNA 3H1HE 1VDFA 2O1JA 2ZXEB 5AW7B 1URQA 1OVRA 1J2ZA 3L70D 2QE7H 2W27A 4HH2A 4HZCA 1SQBK 4PV1B 2Q6QA 2OEFA 2FKWB 2OYOA 1N7SD 2E5TA 1LT1A 1L0LK 3CWBJ 3TDTA 1SQBG 4N78E 3OW2O 2KSEA 1NTKG 3CCRP 1BSHA 2FYNB 3L74D 3JSVC 3TISA 2AEMA 3VNPA 1L0LG 3KQGA 3L4FA 2IX7C 3FWLA 2L5GB 3L73G 3H1KE 3HE5B 4H0LD 1GD2E 4FCEA 1IK9A 5KLVG 3Q5PA 4HUSA 1QX8A 5K5GB 2QVAA 3IAOA 3GOSA 4EQYA 3CJ8A 2M0BA 2Q4JA 3EEVA 3P8CD 5KLIB 1M1JC 3DJ4A 2ZYGA 4M28A 1SQPJ 1OZHA 3RBXA 2YKOA 4ZKPA 3HE5A 2W6BA 1PGQA 1KORA 3G6EP 1Z2FA 1ZR4A 2N9BA 1XATA 5APVA 1AQ5A 4KNRA 2GUVA 3AEBC 2L91A 3FXEA 4N69A 2IBZG 4PJ0H 3IGJA 3BXYA 4J09A 1LTJB 3OUPA 1GL2D 1EDKA 2KZIA 1L4AB 5AVYB 3I3XA 3H25A 2AEJA 3M91A 4OH8B 1OW7A 2QRXA 1BSNA 3H1LG 4AA7A 3CWBE 3KWEA 4WBAA 1JM0A 3KDPB 5CCHA 1N7SC 1KK6A 3L71J 1SP4A 3TGUD 2OI7A 3H1JD 2OI6A 1LTJA 2GM4A 3EFFK 1OX3A 2XATA 3GVDA 2JJLA 2LXCB 1GZLA 1L4AA 1KV4A 1KILD 5AFUU 5H2FE 3L75G 1K05A 3VTPC 4KHXA 2IZ1A 2H7HA 4H0LC 3HTKA 3BRKX 2MJZA 2WPRA 2KS1B 4GKGA 1NTMK 3FSYA 2NPSB 1RY3A 1W2BO 2FYZA 5H2FH 1SQPE 1VQPP 2WWWA 1KTMA 2W8ZA 1SFCB 1FOSE 4DZOA 1J1EC 1YTZT 3RK2B 3MTUE 1OWAA 3V2NA 5DJUB 1VQ9P 3AE5C 3L36A 2WZ7A 1KGTA 2IZ0A 1CW5A 1YQ4C 3H1IJ 1SLQA 2KS1A 3CCVP 3I55P 1FDMA 2NPSA 3R2PA 3KZIE 5L8RJ 1KQFB 1OFCX 2A06D 1L0NK 2RIJA 3TNUB 3P7KA 1GL2C 1SFCA 5KJ7D 3R4YA 1P84D 1VQMP 4U3FG 3U1CA 2JWAA 3KZIH 2XDJA 1BCCD 3TYYA 1L0NG 3OU9A 1NU1J 1SQQG 4GT1A 3CMEP 1NTMD 2KYVA 1T2KD 3V2QA 3TNUA 4I7ZB 1S2EA 1QVFO 3Q2YA 4N3YB 3R0SA 2JF2A 3M9BA 3O8ZA 1QQ0A 3T97B 2Y9YA 1KILC 5CBNA 3PP5A 2N9YB 2IDBA 3C8VA 1NJIQ 2OYHB 3MIWA 1QEXA 2E75D 1PIXA 2W0VA 1NH4A 3G71P 1JY2N 4ZKUA 1MZ9A 3L70J 4ASVA 4N78D 1AA0A 1AQTA 3I3AA 2FYUK 4KPZA 3GW6A 3VMZA 3H1IE 3T97A 1EWWA 3H1KD 2K3RA 2OYHA 1LTIC 2FYUG 3TIOA 4EA9A 1LT9C 1YJNP 4DCLA 5ADXV 4IL6X 3CCMP 2I8DA 5TJHA 3AE7C 5KKZC 1NU1E 1YP2A 5KJ7C 3CCUP 1J1DC 2W83C 1ZMEC 5AVQB 3MC4A 4YTPC 5AVZB 4G3PA 2C9LY 1FZCC 4WY4D 1PP9E 3HRNA 4GOFA 1T2KC 1EDIA 2KLVA 3BSYA 3V4EA 5AW3B 1VQLP 3VBNA 2QM7A 4OGQB 3Q1XA 2B9BA 3FSXA 3R2WA 4E79A 1IFMA 4YPCA 1LTGC 1GW4A 1L0LJ 2VRSA 4LGDE 1QL2A 3L70E 3AEFC 4RJTA 2E75C 3R8YA 2Y0EA 1GK4A 3SWFA 3Q5RA 1OVVA 1NTZK 1JY2O 1Q2NA 2E76B 2QJPC 1S80A 1R8EA 4D6TG 1NTZG 5AW9B 3TGUJ 3H1JJ 4H44D 4RESB 2BCCG 1GU5A 2OYIB 4M3LA 4IHFA 2R5BA 2WVRA 2JF3A 1NAYA 2GGQA 2IU8A 2D2CB 2W6AA 3A5TA 3A0HE 3E1IA 1KYOI 2FXOA 1MRLA 1RHZB 2N1TD 1Z90A 2ICYA 1MFTA 2V0JA 3HD7B 1K73Q 1S5LE 1LXAA 3A0HH 3WUTA 1AV1A 3VBKA 1E79H 5AVRB 2ITAA 3VOPA 3BRTB 1JY3O 4WY4C 1SQBE 4EI2A 1QRFA 2WSEH 4K35A 4EA7A 1QL1A 3CCLP 1JY2P 1L0LE 2YIUB 1J1EB 1VF5B 1MR7A 2AXCA 2AEFA 3L73E 3CC4P 3TK1A 1D7MA 3OGZA 3V6IA 4IFFA 2O01J 2QJYC 2YMKA 3AE1C 2G3AA 5AVSB 2AQ9A 2IYOA 4TT3H 1M8NA 2ZAEB 4MFGA 1EZVG 1G1JA 1BCCJ 3SWYA 5BVZA 4AAWA 3FWNA 3TV0A 1DH3A 3SWKA 1W5CE 2QSIA 1R5SA 2Q7CA 5CMZA 2QA4P 2Q9IA 1NTMJ 4M98A 3B71A 4G87A 2JEEA 5C39A 4EOTA 1X8YA 3VN0A 4H44C 2IBZE 3CCJP 1SQXG 3M0AA 2P1JA 3M06A 1JY3P 1GL2A 1S1CX 2C9NY 3CXHI 2KNCB 1HWTC 1KILB 3H1LE 3H1ID 2XNXA 3GMAA 1L2PA 1HF9A 2WLGA 1Y8AA 1GW3A 2JDIH 3VP9A 1HGZA 3O6QA 3AEAC 2YKQA 4H13D 3VP8A 3P1BA 2LR2A 1PP9G 3AE6C 2OEGA 2KNCA 3MUDC 1JEKA 3H1KJ 3TWDA 1NU1D 1HVVA 2IYPA 3CLQA 1KILA 3BATA 2GA1A 3L75E 3PHLA 4M2AA 1TU3F 1KK4A 1URQB 3IXCA 3BCCG 1BCCE 1SQVG 2O01H 3AEEC 2NRGA 4OWFA 1PP9D 2J59M 5KKZB 3PH0A 1VQOP 4LLHA 1YITP 1NTME 1J1DB 2R44A 1NVOA 2WSFJ 3GHGC 4N6BA 1IFDA 4IOIH 5CHXA 1M7LA 3II6A 1FZCB 3L74G 3HUSB 2C0WA 1U7JA 2J58A 3L72G 1VQ4P 3V4QA 1NTKK 2A45G 5M1BA 5KJ7A 1MR9A 5APYA 2R32A 1VQNP 2ZVNB 1BGYD 3CXHD 3IFMA 3UIAA 1ZN5A 1L0NE 1FU1A 3H6PA 5KLVK 4I2LC 2IBZI 2ZYDA 1FZCA 3HUSA 1N2DC 1KRUA 2E75B 5APQA 2QG4A 4HYTB 4HZDA 3C1LA 4W7ZA 3CX5H 1YQ3C 1M1KQ 1OW8A 4H13C 2QJPB 3TSIA 2CK3H 2H89C 3RBZA 2I1KA 3GG2A 1Q82Q 4EAAA 1YP3A 4C7RA 1QLED 2Q3EA 2E5YA 4PJ0E 2WPSA 2WSCJ 1S9KD 1FZGA 1SS1A 2CPSA 3D70A 2WPQA 2LKMA 1SQBD 3OH2A 1G2CB 1L0LD 5DJTB 4JQ0D 2O1KA 3L73D 4R36A 2WSFH 2WMMA 2OTKE 4Y28J 2FYUE 1IFPA 5BU5A 3CCEP 1N73B 1FS0E 1DD4A 1JO5A 1KHRA 2BCCJ 1HGVA 3HTKB 1FJKA 3M0DC 2E74B 4UB8E 1X22A 1LTTC 1G2CA 3MGNA 3PTZA 3V2RA 5F42A 2KUBA 1KN7A 1YP4A 2J5UA 2QJYB 1RH5B 3WUVA 1JOCA 4UB8H 2HYNA 1N73A 4R4MA 2KOGA 5AW2B 1K8AQ 2IBZD 2AXTE 3GUEA 1X79B 2KXPB 3G4SP 4HKZH 4L76A 2I5KA 3VBIA 2WPVB 3CX5I 3CD6P 3B5ND 2Z4EA 3FSCA 3H1LD 2AXTH 3RL0D 3VMXA 1JNMA 3F5HA 5DG3A 3OH1A 1EDLA 1E5WA 1LP1B 3USSA 2B89A 3KHUA 1GMJA 2WSCH 2O01N 4LC1A 1KB9I 3HSQA 1OVUA 2Q3IA 4EABA 2V0IA 1JUNA 1S5LX 1SQQK 1NTZE 3L75D 1M90Q 4L74A 3H1HG 3OH3A 2BCCE 1RF0C 2HFED 1RE3C 4WB4A 1LP1A 5CBOA 4GOEA 3C9IA 2O3JA 4EYYQ 2IC7A 1IK7A 3R3RA 4MYOA 2V4HA 3V5BA 1IFJA 3CCSP 1T6AA 1PP9J 1RQVA 1DEEG 2OI5A 2B87B 3CC7P 3TDKA 2W6JH 5APTA 1KZUB 2W0WA 4PV1D 3MD0A 2V7QJ 2H8PD 4O9BA 3LW5J 2Q1KA 1NO4A 2JP3A 1PFIA 4N6AA 3GHGB 2RMZA 3CCQP 4U3FD 3B5NC 1K04A 1R5LA 4M9CA 3CX5D 3WMM0 1L0ND 3VBJA 2K88A 1PGJA 3RL0C 3DK5A 2WLFA 1SSMA 2B87A 1VQ5P 2ZT9D 1GU4A 1KYOE 1EXIA 1BE3J 1BGYJ 1EZVE 1FDIA 1KMIZ 1ZV8A 3TK8A 4Y99C 2P2UA 3GHGA 4GODA 4M99A 1KB9D 1KYOH 1NAFA 1HJBA 1LTBC 5B66E 4U7JA 3VBPA 2YXRB 4H13B 1J2JB 3R5BA 2NPOA 4NPDA 3CWBG 1JY3N 1JCDA 1N86A 5B66H 2WSEJ 5U2KA 3DHOA 1PZQA 2MKVA 1XHDA 3RK3E 1M1JB 2RH0A 4DT0A 3H32B 1XTGB 2QJKC 3D98A 1L4AD 3GQ7A 2B88A 1SQBJ 2FYUD 5AVVB 1W2EA 1NTKJ 2P67A 3GQ9A 1SVFA 3SFDC 3D6YA 5GTHH 3OH0A 4HB1A 3S4RA 2Y9ZA 4PV1C 1NGMB 3L73J 2PGDA 1T3JA 4HCQA 2V7QH 4NPEA 3LW5H 1XTCC 4ASWA 5KLVJ 3FSBA 1PGOA 2KZJA 2BASA 1M1JA 1SQPG 4K6RA 3H32A 3MQHA 3EH0A 2BEZF 5AW0B 1BE3E 1BGYE 3BCCE 3CXHE 1PPJG 2ZT9C 1IFNA 2HLOA 1YJ9P 3I5CA 4PD4E 1N7SB 2IFMA 5APXA 1HUCA 2UWJE 2FKOA 2JO1A 3CXHH 3L37A 5AW1B 1SSQA 1S4XA 4W7YA 4PD4H 4N27A 1A02J 5KLIC 1THJA 1EZVI 2P10A 4H0LB 2KSJA 1HH0A 2IU9A 4BWNA 2HPCB 3L71G 3M0DA 5APUA 3TF5A 1N7SA 3H1LJ 1T3UA 3I56P 3AECC 2P7JA 1S9KE 1NWQA 3R5DA 4EIJA 4G3SA 1RE4C 1GTWA 4EDFA 1NTKE 2A45H 4N6JA 1DX7A 1SSTA 1NTZD 3R1WA 2M3BA 5KTBA 2BCCD 1L4AC 3BASA 1S72P 5APWA 1LGHB 3PRJA 5KLVE 1G97A 2HPCA 4WVZA 1KQLA 3L75J 1Q81Q 2R3CA 4MZUA 1NKNA 1IC2A 3BFPA 4H7OA 1GL2B 1H88A 2YMYA 2GUSA 2KP8A 3EWKA 1SQXK 2WITA 3VMAA 4E1KA 1X0TA 3H1IG 5ADXU 2GGOA 5APSA 2OARA 5KAIE 2OGUA 3O6QB 3F89A 3VBMA 2KB7P 2Q5UA 5CJ0A 2KLUA 1M8OB 4L73A 3BSWA 3Q5SA 5KAIH 1LWUC 1H8AA 3AE8C 3JC22 1OW6A 3N4XA 1HV9A 3KWDA 4PD4I 1ZRTE 2N1TC 1KYOD 1CI6A 2XNDH 3G3ZA 2YO2A 3NMDA 4U3FJ 3QWOC 1H89A 4AQRD 1MKMA 1EZVD 1YJWP 1L0NJ 2SPZA 5B5EE 1FOSF 3B5NB 1SQQJ 2ZJSE 1QVGO 1ZW0A 2OTLP 4JPZB 3GF7A 3P8MC 3GLMA 1SQVK 2H88C 5B5EH 2A45I 3LIEA 4I1LA 3WU2E 1LTSC 3E1RA 3OAKA 3U59A 4EA8A 1AFOA 4Y99B 1LT9B 4JF7A 2FXMA 1KQSO 3B5NA 3L70G 3N7NA 1VQ7P 1KGQA 3OJAB 3WU2H 2I1JA 3RK3D 1OMIA 5AFUV 4WWIA 1NYHA 4I7ZC 1ZR2A 4DCKA 1KFNA 1HJ0A 3SPTA 4OGQD 4BRYA 1PL5A 1HM8A 1EQ7A 1FBMA 1LT9A 4OVNF 2ZYAA 1WT6A 4B86A 1FZFA 2FYUJ 4J18A 1HBWA 3MP7B 4U3FE 5E3QA 2E76D 5KAFE 1BE3D 3BCCD 1Q86Q 1NHLA 3CX5E 1KQGB 1SQVD 3ABVC 1SQQE 2WQYC 1U7MA 4PD4D 2JKVA 4AUWA 5KAFH 5AVUB 3NFQA 5DEMA 1YI2P 3AE9C 2D2CD 1S3JA 1KB9E 1Y47A 3AE2C 2ZT9B 3SUCA 3GQ8A 3MHVA 3KXDA 3L72D 1KFMA 3ITKA 1FZBA 4IFDK 1G1IA 3HD7D 2PRRA 1KC8Q 1HTLC 2V0LA 2HG5D 5AVWB 4DJGA 1KB9H 4IHHA 2HODB 3NXSA 2ZXXA 4DOJA 2W90A 2WTYA 1V67A 4QMAA 1UIIA 3U1AA 1NTKD 3P47A 1Z56A 3A0BE 3RK3C 4W80A 1USEA 2Z5HA 2JWDA 1UIXA 2NZ2A 1VF5D 3TGUG 4BXLA 3H1JG 2QM8A 4R37A 1QGKB 4OGQC 1G95A 5KLVD 3A0BH 3S1KA 3S9OA 4D6TJ 2PAJA 2HODA 1NTZJ 4WY4B 1DEBA 3BVHA 2XZRA 1T8ZA 1P84I 3FGAD 1AJYA 1QRGA 2WLDA 5CCGD 3R5CA 3JCUE 2E76C 2QIVX 1HM0A 1ZLLA 2WLEA 1LNQA 4GDOA 1ZP0C 1RE4A 4HJGH 4WY4A 2M5AB 3JCUH 3Q3DA 4MN4C 2OYIC 4RO0A 2VHEA 3A3YB 3MZWB 2G8YA 3R5AA 2D2CC 5E3RA 1Q7YQ 5TISE 3BRVB 2A06G 1MV8A 4KNXA 1ZRTD 1N4IA 4H44B 3HD7C 2M5AA 2YO3A 5TISH 1BCCG 4K3AA 1IJDB 3W68A 1LWUB 4HURA 1AVOA 4NPFX 2K9JB 1PPJE 2JR8A 1IZNB 4GIFA 5AW8B 2E43A 1NTMG 1JMMA 1ZOYC 2N1TB 4D6TE 2YIUC 3KYQA 1VF5C 3EG4A 2QIAA 3KWCA 1JCCA 3OTMA 1URQD 3CPWO 3HE4B 2YXQB 4IFMA 1EXJA 3D8VA 3FXDA 4KPXA 1FJPA 1LWUA 1T3DA 1JTHB 1SQXJ 2WSSH 2K9JA 3AEDC 3L35A 5DEPA 1YTZI 2N1TA 5CCGC 3L71E 2V0HA 3VMYA 1CZQA 2LXBA 3HE4A 3AE4C 3QH9A 2KI7B 3IR9A 3H1KG 4YXWH 1OIPA 3MUDA 4JYBA 1FDOA 1JTHA 3H1HD 3V2PA 2CPBA 2FFDC 1KRVA 2RKLA 1VQ8P 4I6MC 3WUUA 1QRMA 2BEQD 3EQ2A 4JYCA 2XKMA 1A02F 1SQQD 1Q90D 5AVTB 1K9MQ 1OXZA 1FWYA 1FZEA 1RF1C 1IFIA 5AW5B 3BCCJ 2Z5IA 1SQVJ 4C7NB 2R3SA 4KT0J 2YNYA 5GTIE 3W67A 2C0XA 3A7OA 1QRLA 4CPGA 1M56D 1EC5A 2P58A 2M8RA 3AE3C 5GTIH 2VD4A 5L6SA 1SQXE 1M57D 1URQC 2P2OA 1FZAA 4EGGA 3L74J 3FX0A 4AC3A 4M2BA 2OTJP 4C7NA 2IPPA 3L72J 5CCHD 1CSBA 3NZ2A 4AYCA 2WT7B 5GTHE 4C46A 4YXDC 1N7LA 3CMAP 1USDA 4L75A 1KRRA 2V0KA 2KK7A 3SRTA 1MFZA 1FAVA 1WMKA 3HUSC 1SQPK 3SSUA 2XU6A 3RK3B 1KD1Q 1ZXGA 2IUAA 2E74D 2WT7A 3G9RA 1YYCA 1YHQP 3CWBD 3RGUA 2OQQA 3FTTA 3VBLA 2FYNC 1SQVE 3BSSA 4E6UA 3IF4A 1NOHA 1RQUA 3CL3D 3R3IA 4R4LA 3OA7A 1YBKA 3CI9A 1NKZB 3V4WA 3PJSK 2NPSD 2XV5A 3D71A 4XFJA 1WRGA 1YIJP 2POHA 2KIKA 2K9YA 1SFCD 5E79E 3L74E 1EDJA 1FXJA 1L0SA 1JMBA 3L72E 3RK2D 4IHGA 1JB0J 3Q1MA 2ZVOB 1SQPD 3A2AA 2DW3A 5E79H 5AVXB 2E42A 3OH4A 5CCHC 1PPJD 2PFXA 5CJ4A 4D6TD 3P8CE 1HM9A 1LTJC 1FC2C 2R5DA 2IFNA 1U57A 3FS8A 3AEGC 3ZDMA 2PP6A 4ZNCA 2OYIA 1VPCA 2TDTA 3HJJA 5L6VA 1N73C 1PV3A 4XE5B 3B8EB 4TLFA 3T57A 3RL0g 4KJMA 1S5LH 2Y0CA 3F1XA 2E74C 4Z1MH 1KQAA 4JBZA 4E75A 5AW4B 2K37A 4ZMDA 3HD7A 3L71D 1PGPA 2QIWA 1CI6B 3KPEA 2FY8A 1TDTA 4RKUJ 2YKPA 1LJ2A 1NU1K 4KQLA 3TGUE 2QKXA 1V3WA 2HR3A 3H1JE 3GQAA 2K1AA 2NPSC 4UB6E 3JQYA 2Y0DA 1RF0A 4A7PA 5BU8B 3OTZA 4ISXA 1RE3A 1VQ6P 3GF3A 2QEXP 1SFCC 1NU1G 3K5BA 1MUUA 1KILE 2M3EA 2FXPA 3H1HJ 1X9VA 3MQGA 3RK2C 4UB6H 3PMOA 1LTAC 1Y9BA 2ICXA 2FFDB 1BDCA 5CCGA 2RN0A
chains in the Genus database with same CATH topology
3SFEC 1DD3A 1VL2A 2E76B 2QJPC 1UIXA 2NZ2A 1VF5D 1S80A 5E3PA 4R37A 1RQVA 1R8EA 4OGQC 2OI5A 1G95A 3FOQA 4H44D 3S9OA 3ECTA 2W0WA 4PV1D 4R7PA 1KK5A 2V7QJ 3LW5J 4IHFA 3ST8A 2JF3A 2JP3A 2WLCA 4N6AA 2GGQA 2IU8A 2D2CB 3FGAD 1K04A 3IN6A 1AJYA 1QREA 4M9CA 3OW5A 1QRGA 2WLDA 1DIPA 3R5CA 1MRLA 3VBJA 4G3QA 2E76C 3D6ZA 1Z90A 2ICYA 3DK5A 2WLFA 2QIVX 1SSMA 2ZT9D 1HM0A 2WLEA 2V0JA 1EXIA 4GDOA 1LXAA 1ZP0C 3VBKA 3Q3DA 1FDIA 2VHEA 1KMIZ 4E6TA 3TK8A 3FWWA 1QRFA 2G8YA 4M99A 1OCXA 3R5AA 2FBWC 4EA7A 2D2CC 5E3RA 1VF5B 1MR7A 4KNXA 4U7JA 3VBPA 1J2ZA 4H13B 3R5BA 2O01J 4H44B 2NPOA 2QJYC 4HZCA 2YMKA 3AE1C 2G3AA 4PV1B 2OEFA 2AQ9A 4TT3H 2WSEJ 4MFGA 5U2KA 3DHOA 4AAWA 4HURA 2MKVA 1XHDA 3TDTA 3TV0A 3RK3E 1ZOYC 2QSIA 2QJKC 3D98A 2YIUC 1VF5C 3TISA 3EG4A 2QIAA 3VNPA 3KWCA 4M98A 3B71A 3OTMA 4G87A 3SFDC 3D6YA 4H0LD 4FCEA 1EXJA 3D8VA 4H44C 4KPXA 3Q5PA 4PV1C 1NGMB 4HUSA 4HCQA 3IAOA 3GOSA 4EQYA 1T3DA 1S1CX 3FSBA 3CJ8A 3AEDC 4K6RA 2Q4JA 3MQHA 5DEPA 3EEVA 3EH0A 2BEZF 3DJ4A 4M28A 3GMAA 1HF9A 2V0HA 2WLGA 2ZT9C 3O6QA 3AEAC 1KORA 4H13D 3AE4C 1XATA 3P1BA 4KNRA 3AEBC 2FKOA 2JO1A 4N69A 3AE6C 1FDOA 2OEGA 1SSQA 3IGJA 3BXYA 4J09A 3OUPA 3TWDA 1KRVA 4N27A 1QRMA 3I3XA 2BEQD 3H25A 4M2AA 5KLIC 1THJA 1OW7A 1TU3F 1Q90D 1KK4A 4AA7A 3IXCA 2P10A 1FWYA 4H0LB 3KWEA 2IU9A 4MYOA 3AEEC 3AECC 3R5DA 1KK6A 4G3SA 2OI7A 2OI6A 4KT0J 1QRLA 1SSTA 2XATA 3GVDA 3R1WA 2WSFJ 4N6BA 5AFUU 3AE3C 5L6SA 2VD4A 1K05A 1G97A 2P2OA 4H0LC 4EGGA 3BRKX 3FSYA 4AC3A 4M2BA 5M1BA 4MZUA 3BFPA 1MR9A 4H7OA 1KTMA 3NZ2A 4YXDC 3EWKA 4E1KA 5ADXU 1KRRA 1KRUA 2E75B 3AE5C 2V0KA 2GGOA 3SRTA 4HZDA 1KGTA 1WMKA 1YQ4C 3VBMA 1YQ3C 1OW8A 4H13C 5L8RJ 1KQFB 2IUAA 2RIJA 3BSWA 2E74D 3Q5SA 3G9RA 2H89C 3R4YA 3AE8C 1OW6A 4EAAA 1YP3A 1HV9A 3KWDA 1ZRTE 2OQQA 3FTTA 3VBLA 2FYNC 3BSSA 3OU9A 4E6UA 2WSCJ 1MKMA 1RQUA 3D70A 3R3IA 4R4LA 4I7ZB 3D71A 3Q2YA 3GF7A 4XFJA 3R0SA 2JF2A 4R36A 3GLMA 2H88C 2K9YA 1QQ0A 3T97B 4Y28J 1FXJA 4EA8A 2IDBA 3C8VA 4IHGA 1DD4A 1JB0J 2E75D 3Q1MA 1KHRA 1PIXA 2W0VA 1KGQA 2E74B 1OMIA 5AFUV 3I3AA 1NYHA 4I7ZC 1HJ0A 1HM9A 5F42A 4KPZA 3SPTA 1YP4A 2J5UA 4OGQD 1PL5A 1U57A 3FS8A 3AEGC 1HM8A 4R4MA 2TDTA 3HJJA 5L6VA 3TIOA 1PV3A 3GUEA 4EA9A 3T57A 3RL0g 2I5KA 3VBIA 2WPVB 4DCLA 3FSCA 4J18A 5ADXV 3F1XA 2E74C 4IL6X 4Z1MH 5E3QA 3AE7C 5KKZC 1KQAA 1YP2A 4E75A 2E76D 1KQGB 1ZMEC 3ABVC 3MC4A 4YTPC 4G3PA 5DG3A 2WQYC 2QIWA 1GMJA 1TDTA 4RKUJ 5DEMA 3HSQA 3AE9C 4KQLA 2D2CD 2QKXA 1V3WA 3V4EA 3BSYA 2V0IA 4EABA 1S5LX 3AE2C 3JQYA 2ZT9B 3OTZA 3VBNA 3Q1XA 4OGQB 4ISXA 3GF3A 3FSXA 3R2WA 4E79A 1KILE 2FXPA 2V0LA 3MQGA 3AEFC 4IHHA 3PMOA 1Y9BA 2E75C 3R8YA 3Q5RA 2ICXA 1V67A 2IC7A 3P47A 1IK7A 3R3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD4 A;  1G97 A;  3TIS A;  3EG4 A;  2QIA A;  3VNP A;  2P2O A;  2E76 B;  2QJP C;  3KWC A;  4EGG A;  2E74 B;  3BRK X;  4M98 A;  1S80 A;  5E3P A;  3OTM A;  4G87 A;  5AFU V;  4R37 A;  3FSY A;  3I3A A;  4FCE A;  4AC3 A;  3D8V A;  4M2B A;  4MZU A;  2OI5 A;  4KPX A;  3BFP A;  1MR9 A;  4H7O A;  1G95 A;  1HM9 A;  5F42 A;  4KPZ A;  4HUS A;  3SPT A;  3FOQ A;  1YP4 A;  4HCQ A;  3NZ2 A;  3ECT A;  3GOS A;  2W0W A;  4EQY A;  1T3D A;  4R7P A;  1KK5 A;  3FSB A;  3FS8 A;  3CJ8 A;  3LW5 J;  1HM8 A;  4IHF A;  3ST8 A;  2TDT A;  2JF3 A;  4E1K A;  3HJJ A;  2Q4J A;  2WLC A;  3MQH A;  3EEV A;  4K6R A;  3EH0 A;  5DEP A;  5L6V A;  4N6A A;  2GGQ A;  2IU8 A;  5ADX U;  2D2C B;  3TIO A;  3DJ4 A;  3GUE A;  1KRR A;  1KRU A;  2E75 B;  2V0K A;  4EA9 A;  3T57 A;  2GGO A;  3SRT A;  4M28 A;  4HZD A;  1QRE A;  4M9C A;  2I5K A;  3OW5 A;  1KGT A;  1QRG A;  2WLD A;  3R5C A;  3VBI A;  2WPV B;  1MRL A;  2V0H A;  3VBM A;  2WLG A;  3VBJ A;  4DCL A;  3FSC A;  4G3Q A;  4J18 A;  5ADX V;  1Z90 A;  2ICY A;  3F1X A;  4IL6 X;  3DK5 A;  2WLF A;  2QIV X;  5L8R J;  1SSM A;  5E3Q A;  5KKZ C;  1HM0 A;  1KQA A;  1YP2 A;  2WLE A;  2V0J A;  4E75 A;  1XAT A;  3P1B A;  2IUA A;  2RIJ A;  3BSW A;  4KNR A;  2FKO A;  1LXA A;  4N69 A;  3VBK A;  2OEG A;  3MC4 A;  4G3P A;  5DG3 A;  1SSQ A;  3IGJ A;  3BXY A;  2QIW A;  4J09 A;  3OUP A;  4EAA A;  3TWD A;  1YP3 A;  2VHE A;  1KRV A;  4E6T A;  1HV9 A;  3KWD A;  3TK8 A;  1ZRT E;  3FWW A;  1QRF A;  3FTT A;  4N27 A;  1QRM A;  3VBL A;  4M99 A;  3I3X A;  2FYN C;  1OCX A;  3R5A A;  3BSS A;  4EA7 A;  1TDT A;  3OU9 A;  4M2A A;  4RKU J;  5KLI C;  5E3R A;  1THJ A;  4E6U A;  2WSC J;  5DEM A;  1Q90 D;  3HSQ A;  1VF5 B;  1MR7 A;  1KK4 A;  4AA7 A;  4KQL A;  3IXC A;  2QKX A;  1V3W A;  3R3I A;  1FWY A;  4H0L B;  4KNX A;  3V4E A;  3BSY A;  2V0I A;  3KWE A;  4EAB A;  2IU9 A;  3VBP A;  3R3R A;  1S5L X;  1J2Z A;  3JQY A;  2ZT9 B;  4H13 B;  4I7Z B;  3OTZ A;  3VBN A;  3Q1X A;  4OGQ B;  2O01 J;  4H44 B;  2NPO A;  3R5B A;  3R5D A;  4ISX A;  2QJY C;  4HZC A;  4PV1 B;  1KK6 A;  3FSX A;  4G3S A;  3R2W A;  4E79 A;  2OEF A;  3R0S A;  2JF2 A;  2OI7 A;  4R36 A;  3P47 A;  2AQ9 A;  2OI6 A;  2K9Y A;  4KT0 J;  1QQ0 A;  2V0L A;  3MQG A;  1QRL A;  1SST A;  2XAT A;  3GVD A;  3R1W A;  2WSF J;  4Y28 J;  4IHH A;  3PMO A;  1FXJ A;  2WSE J;  4MFG A;  5U2K A;  3DHO A;  4N6B A;  4AAW A;  4HUR A;  3R8Y A;  1XHD A;  4EA8 A;  3C8V A;  3TDT A;  2ICX A;  3TV0 A;  4IHG A;  1JB0 J;  5AFU U;  2QSI A;  1V67 A;  1KHR A;  2IC7 A;  2QJK C;  2W0V A;  3D98 A;  2YIU C;  4MYO A;  1KGQ A;  5L6S A; 
#chains in the Genus database with same CATH topology
 3LID A;  5AW6 B;  3SFE C;  1DD3 A;  1VL2 A;  4XA4 A;  3RL0 B;  5E3P A;  4IL6 E;  1RF1 B;  3B4S A;  4BRY B;  1GK6 A;  1SQX D;  3FOQ A;  3NTN A;  3EFG A;  3ECT A;  3CC2 P;  3E7K A;  4R7P A;  1KK5 A;  3ST8 A;  2FFD A;  2WLC A;  1H0T B;  4IL6 H;  2A06 E;  5EFW B;  1N8R Q;  3IN6 A;  1QRE A;  3OW5 A;  2H43 A;  2ZFC A;  1DIP A;  4G3Q A;  1VQK P;  3M9Q A;  3D6Z A;  1P84 E;  3M9H A;  1IO4 A;  1BE3 G;  1BGY G;  1RF1 A;  1FE6 A;  3P32 A;  1BDD A;  3VYI A;  1AVY A;  2OYH C;  1P84 H;  4E6T A;  1H0T A;  3FWW A;  1OCX A;  2FBW C;  1GDT A;  2QJK B;  3PLN A;  3H1H E;  1VDF A;  2O1J A;  2ZXE B;  5AW7 B;  1URQ A;  1OVR A;  1J2Z A;  3L70 D;  2QE7 H;  2W27 A;  4HH2 A;  4HZC A;  1SQB K;  4PV1 B;  2Q6Q A;  2OEF A;  2FKW B;  2OYO A;  1N7S D;  2E5T A;  1LT1 A;  1L0L K;  3CWB J;  3TDT A;  1SQB G;  4N78 E;  3OW2 O;  2KSE A;  1NTK G;  3CCR P;  1BSH A;  2FYN B;  3L74 D;  3JSV C;  3TIS A;  2AEM A;  3VNP A;  1L0L G;  3KQG A;  3L4F A;  2IX7 C;  3FWL A;  2L5G B;  3L73 G;  3H1K E;  3HE5 B;  4H0L D;  1GD2 E;  4FCE A;  1IK9 A;  5KLV G;  3Q5P A;  4HUS A;  1QX8 A;  5K5G B;  2QVA A;  3IAO A;  3GOS A;  4EQY A;  3CJ8 A;  2M0B A;  2Q4J A;  3EEV A;  3P8C D;  5KLI B;  1M1J C;  3DJ4 A;  2ZYG A;  4M28 A;  1SQP J;  1OZH A;  3RBX A;  2YKO A;  4ZKP A;  3HE5 A;  2W6B A;  1PGQ A;  1KOR A;  3G6E P;  1Z2F A;  1ZR4 A;  2N9B A;  1XAT A;  5APV A;  1AQ5 A;  4KNR A;  2GUV A;  3AEB C;  2L91 A;  3FXE A;  4N69 A;  2IBZ G;  4PJ0 H;  3IGJ A;  3BXY A;  4J09 A;  1LTJ B;  3OUP A;  1GL2 D;  1EDK A;  2KZI A;  1L4A B;  5AVY B;  3I3X A;  3H25 A;  2AEJ A;  3M91 A;  4OH8 B;  1OW7 A;  2QRX A;  1BSN A;  3H1L G;  4AA7 A;  3CWB E;  3KWE A;  4WBA A;  1JM0 A;  3KDP B;  5CCH A;  1N7S C;  1KK6 A;  3L71 J;  1SP4 A;  3TGU D;  2OI7 A;  3H1J D;  2OI6 A;  1LTJ A;  2GM4 A;  3EFF K;  1OX3 A;  2XAT A;  3GVD A;  2JJL A;  2LXC B;  1GZL A;  1L4A A;  1KV4 A;  1KIL D;  5AFU U;  5H2F E;  3L75 G;  1K05 A;  3VTP C;  4KHX A;  2IZ1 A;  2H7H A;  4H0L C;  3HTK A;  3BRK X;  2MJZ A;  2WPR A;  2KS1 B;  4GKG A;  1NTM K;  3FSY A;  2NPS B;  1RY3 A;  1W2B O;  2FYZ A;  5H2F H;  1SQP E;  1VQP P;  2WWW A;  1KTM A;  2W8Z A;  1SFC B;  1FOS E;  4DZO A;  1J1E C;  1YTZ T;  3RK2 B;  3MTU E;  1OWA A;  3V2N A;  5DJU B;  1VQ9 P;  3AE5 C;  3L36 A;  2WZ7 A;  1KGT A;  2IZ0 A;  1CW5 A;  1YQ4 C;  3H1I J;  1SLQ A;  2KS1 A;  3CCV P;  3I55 P;  1FDM A;  2NPS A;  3R2P A;  3KZI E;  5L8R J;  1KQF B;  1OFC X;  2A06 D;  1L0N K;  2RIJ A;  3TNU B;  3P7K A;  1GL2 C;  1SFC A;  5KJ7 D;  3R4Y A;  1P84 D;  1VQM P;  4U3F G;  3U1C A;  2JWA A;  3KZI H;  2XDJ A;  1BCC D;  3TYY A;  1L0N G;  3OU9 A;  1NU1 J;  1SQQ G;  4GT1 A;  3CME P;  1NTM D;  2KYV A;  1T2K D;  3V2Q A;  3TNU A;  4I7Z B;  1S2E A;  1QVF O;  3Q2Y A;  4N3Y B;  3R0S A;  2JF2 A;  3M9B A;  3O8Z A;  1QQ0 A;  3T97 B;  2Y9Y A;  1KIL C;  5CBN A;  3PP5 A;  2N9Y B;  2IDB A;  3C8V A;  1NJI Q;  2OYH B;  3MIW A;  1QEX A;  2E75 D;  1PIX A;  2W0V A;  1NH4 A;  3G71 P;  1JY2 N;  4ZKU A;  1MZ9 A;  3L70 J;  4ASV A;  4N78 D;  1AA0 A;  1AQT A;  3I3A A;  2FYU K;  4KPZ A;  3GW6 A;  3VMZ A;  3H1I E;  3T97 A;  1EWW A;  3H1K D;  2K3R A;  2OYH A;  1LTI C;  2FYU G;  3TIO A;  4EA9 A;  1LT9 C;  1YJN P;  4DCL A;  5ADX V;  4IL6 X;  3CCM P;  2I8D A;  5TJH A;  3AE7 C;  5KKZ C;  1NU1 E;  1YP2 A;  5KJ7 C;  3CCU P;  1J1D C;  2W83 C;  1ZME C;  5AVQ B;  3MC4 A;  4YTP C;  5AVZ B;  4G3P A;  2C9L Y;  1FZC C;  4WY4 D;  1PP9 E;  3HRN A;  4GOF A;  1T2K C;  1EDI A;  2KLV A;  3BSY A;  3V4E A;  5AW3 B;  1VQL P;  3VBN A;  2QM7 A;  4OGQ B;  3Q1X A;  2B9B A;  3FSX A;  3R2W A;  4E79 A;  1IFM A;  4YPC A;  1LTG C;  1GW4 A;  1L0L J;  2VRS A;  4LGD E;  1QL2 A;  3L70 E;  3AEF C;  4RJT A;  2E75 C;  3R8Y A;  2Y0E A;  1GK4 A;  3SWF A;  3Q5R A;  1OVV A;  1NTZ K;  1JY2 O;  1Q2N A;  2E76 B;  2QJP C;  1S80 A;  1R8E A;  4D6T G;  1NTZ G;  5AW9 B;  3TGU J;  3H1J J;  4H44 D;  4RES B;  2BCC G;  1GU5 A;  2OYI B;  4M3L A;  4IHF A;  2R5B A;  2WVR A;  2JF3 A;  1NAY A;  2GGQ A;  2IU8 A;  2D2C B;  2W6A A;  3A5T A;  3A0H E;  3E1I A;  1KYO I;  2FXO A;  1MRL A;  1RHZ B;  2N1T D;  1Z90 A;  2ICY A;  1MFT A;  2V0J A;  3HD7 B;  1K73 Q;  1S5L E;  1LXA A;  3A0H H;  3WUT A;  1AV1 A;  3VBK A;  1E79 H;  5AVR B;  2ITA A;  3VOP A;  3BRT B;  1JY3 O;  4WY4 C;  1SQB E;  4EI2 A;  1QRF A;  2WSE H;  4K35 A;  4EA7 A;  1QL1 A;  3CCL P;  1JY2 P;  1L0L E;  2YIU B;  1J1E B;  1VF5 B;  1MR7 A;  2AXC A;  2AEF A;  3L73 E;  3CC4 P;  3TK1 A;  1D7M A;  3OGZ A;  3V6I A;  4IFF A;  2O01 J;  2QJY C;  2YMK A;  3AE1 C;  2G3A A;  5AVS B;  2AQ9 A;  2IYO A;  4TT3 H;  1M8N A;  2ZAE B;  4MFG A;  1EZV G;  1G1J A;  1BCC J;  3SWY A;  5BVZ A;  4AAW A;  3FWN A;  3TV0 A;  1DH3 A;  3SWK A;  1W5C E;  2QSI A;  1R5S A;  2Q7C A;  5CMZ A;  2QA4 P;  2Q9I A;  1NTM J;  4M98 A;  3B71 A;  4G87 A;  2JEE A;  5C39 A;  4EOT A;  1X8Y A;  3VN0 A;  4H44 C;  2IBZ E;  3CCJ P;  1SQX G;  3M0A A;  2P1J A;  3M06 A;  1JY3 P;  1GL2 A;  1S1C X;  2C9N Y;  3CXH I;  2KNC B;  1HWT C;  1KIL B;  3H1L E;  3H1I D;  2XNX A;  3GMA A;  1L2P A;  1HF9 A;  2WLG A;  1Y8A A;  1GW3 A;  2JDI H;  3VP9 A;  1HGZ A;  3O6Q A;  3AEA C;  2YKQ A;  4H13 D;  3VP8 A;  3P1B A;  2LR2 A;  1PP9 G;  3AE6 C;  2OEG A;  2KNC A;  3MUD C;  1JEK A;  3H1K J;  3TWD A;  1NU1 D;  1HVV A;  2IYP A;  3CLQ A;  1KIL A;  3BAT A;  2GA1 A;  3L75 E;  3PHL A;  4M2A A;  1TU3 F;  1KK4 A;  1URQ B;  3IXC A;  3BCC G;  1BCC E;  1SQV G;  2O01 H;  3AEE C;  2NRG A;  4OWF A;  1PP9 D;  2J59 M;  5KKZ B;  3PH0 A;  1VQO P;  4LLH A;  1YIT P;  1NTM E;  1J1D B;  2R44 A;  1NVO A;  2WSF J;  3GHG C;  4N6B A;  1IFD A;  4IOI H;  5CHX A;  1M7L A;  3II6 A;  1FZC B;  3L74 G;  3HUS B;  2C0W A;  1U7J A;  2J58 A;  3L72 G;  1VQ4 P;  3V4Q A;  1NTK K;  2A45 G;  5M1B A;  5KJ7 A;  1MR9 A;  5APY A;  2R32 A;  1VQN P;  2ZVN B;  1BGY D;  3CXH D;  3IFM A;  3UIA A;  1ZN5 A;  1L0N E;  1FU1 A;  3H6P A;  5KLV K;  4I2L C;  2IBZ I;  2ZYD A;  1FZC A;  3HUS A;  1N2D C;  1KRU A;  2E75 B;  5APQ A;  2QG4 A;  4HYT B;  4HZD A;  3C1L A;  4W7Z A;  3CX5 H;  1YQ3 C;  1M1K Q;  1OW8 A;  4H13 C;  2QJP B;  3TSI A;  2CK3 H;  2H89 C;  3RBZ A;  2I1K A;  3GG2 A;  1Q82 Q;  4EAA A;  1YP3 A;  4C7R A;  1QLE D;  2Q3E A;  2E5Y A;  4PJ0 E;  2WPS A;  2WSC J;  1S9K D;  1FZG A;  1SS1 A;  2CPS A;  3D70 A;  2WPQ A;  2LKM A;  1SQB D;  3OH2 A;  1G2C B;  1L0L D;  5DJT B;  4JQ0 D;  2O1K A;  3L73 D;  4R36 A;  2WSF H;  2WMM A;  2OTK E;  4Y28 J;  2FYU E;  1IFP A;  5BU5 A;  3CCE P;  1N73 B;  1FS0 E;  1DD4 A;  1JO5 A;  1KHR A;  2BCC J;  1HGV A;  3HTK B;  1FJK A;  3M0D C;  2E74 B;  4UB8 E;  1X22 A;  1LTT C;  1G2C A;  3MGN A;  3PTZ A;  3V2R A;  5F42 A;  2KUB A;  1KN7 A;  1YP4 A;  2J5U A;  2QJY B;  1RH5 B;  3WUV A;  1JOC A;  4UB8 H;  2HYN A;  1N73 A;  4R4M A;  2KOG A;  5AW2 B;  1K8A Q;  2IBZ D;  2AXT E;  3GUE A;  1X79 B;  2KXP B;  3G4S P;  4HKZ H;  4L76 A;  2I5K A;  3VBI A;  2WPV B;  3CX5 I;  3CD6 P;  3B5N D;  2Z4E A;  3FSC A;  3H1L D;  2AXT H;  3RL0 D;  3VMX A;  1JNM A;  3F5H A;  5DG3 A;  3OH1 A;  1EDL A;  1E5W A;  1LP1 B;  3USS A;  2B89 A;  3KHU A;  1GMJ A;  2WSC H;  2O01 N;  4LC1 A;  1KB9 I;  3HSQ A;  1OVU A;  2Q3I A;  4EAB A;  2V0I A;  1JUN A;  1S5L X;  1SQQ K;  1NTZ E;  3L75 D;  1M90 Q;  4L74 A;  3H1H G;  3OH3 A;  2BCC E;  1RF0 C;  2HFE D;  1RE3 C;  4WB4 A;  1LP1 A;  5CBO A;  4GOE A;  3C9I A;  2O3J A;  4EYY Q;  2IC7 A;  1IK7 A;  3R3R A;  4MYO A;  2V4H A;  3V5B A;  1IFJ A;  3CCS P;  1T6A A;  1PP9 J;  1RQV A;  1DEE G;  2OI5 A;  2B87 B;  3CC7 P;  3TDK A;  2W6J H;  5APT A;  1KZU B;  2W0W A;  4PV1 D;  3MD0 A;  2V7Q J;  2H8P D;  4O9B A;  3LW5 J;  2Q1K A;  1NO4 A;  2JP3 A;  1PFI A;  4N6A A;  3GHG B;  2RMZ A;  3CCQ P;  4U3F D;  3B5N C;  1K04 A;  1R5L A;  4M9C A;  3CX5 D;  3WMM 0;  1L0N D;  3VBJ A;  2K88 A;  1PGJ A;  3RL0 C;  3DK5 A;  2WLF A;  1SSM A;  2B87 A;  1VQ5 P;  2ZT9 D;  1GU4 A;  1KYO E;  1EXI A;  1BE3 J;  1BGY J;  1EZV E;  1FDI A;  1KMI Z;  1ZV8 A;  3TK8 A;  4Y99 C;  2P2U A;  3GHG A;  4GOD A;  4M99 A;  1KB9 D;  1KYO H;  1NAF A;  1HJB A;  1LTB C;  5B66 E;  4U7J A;  3VBP A;  2YXR B;  4H13 B;  1J2J B;  3R5B A;  2NPO A;  4NPD A;  3CWB G;  1JY3 N;  1JCD A;  1N86 A;  5B66 H;  2WSE J;  5U2K A;  3DHO A;  1PZQ A;  2MKV A;  1XHD A;  3RK3 E;  1M1J B;  2RH0 A;  4DT0 A;  3H32 B;  1XTG B;  2QJK C;  3D98 A;  1L4A D;  3GQ7 A;  2B88 A;  1SQB J;  2FYU D;  5AVV B;  1W2E A;  1NTK J;  2P67 A;  3GQ9 A;  1SVF A;  3SFD C;  3D6Y A;  5GTH H;  3OH0 A;  4HB1 A;  3S4R A;  2Y9Z A;  4PV1 C;  1NGM B;  3L73 J;  2PGD A;  1T3J A;  4HCQ A;  2V7Q H;  4NPE A;  3LW5 H;  1XTC C;  4ASW A;  5KLV J;  3FSB A;  1PGO A;  2KZJ A;  2BAS A;  1M1J A;  1SQP G;  4K6R A;  3H32 A;  3MQH A;  3EH0 A;  2BEZ F;  5AW0 B;  1BE3 E;  1BGY E;  3BCC E;  3CXH E;  1PPJ G;  2ZT9 C;  1IFN A;  2HLO A;  1YJ9 P;  3I5C A;  4PD4 E;  1N7S B;  2IFM A;  5APX A;  1HUC A;  2UWJ E;  2FKO A;  2JO1 A;  3CXH H;  3L37 A;  5AW1 B;  1SSQ A;  1S4X A;  4W7Y A;  4PD4 H;  4N27 A;  1A02 J;  5KLI C;  1THJ A;  1EZV I;  2P10 A;  4H0L B;  2KSJ A;  1HH0 A;  2IU9 A;  4BWN A;  2HPC B;  3L71 G;  3M0D A;  5APU A;  3TF5 A;  1N7S A;  3H1L J;  1T3U A;  3I56 P;  3AEC C;  2P7J A;  1S9K E;  1NWQ A;  3R5D A;  4EIJ A;  4G3S A;  1RE4 C;  1GTW A;  4EDF A;  1NTK E;  2A45 H;  4N6J A;  1DX7 A;  1SST A;  1NTZ D;  3R1W A;  2M3B A;  5KTB A;  2BCC D;  1L4A C;  3BAS A;  1S72 P;  5APW A;  1LGH B;  3PRJ A;  5KLV E;  1G97 A;  2HPC A;  4WVZ A;  1KQL A;  3L75 J;  1Q81 Q;  2R3C A;  4MZU A;  1NKN A;  1IC2 A;  3BFP A;  4H7O A;  1GL2 B;  1H88 A;  2YMY A;  2GUS A;  2KP8 A;  3EWK A;  1SQX K;  2WIT A;  3VMA A;  4E1K A;  1X0T A;  3H1I G;  5ADX U;  2GGO A;  5APS A;  2OAR A;  5KAI E;  2OGU A;  3O6Q B;  3F89 A;  3VBM A;  2KB7 P;  2Q5U A;  5CJ0 A;  2KLU A;  1M8O B;  4L73 A;  3BSW A;  3Q5S A;  5KAI H;  1LWU C;  1H8A A;  3AE8 C;  3JC2 2;  1OW6 A;  3N4X A;  1HV9 A;  3KWD A;  4PD4 I;  1ZRT E;  2N1T C;  1KYO D;  1CI6 A;  2XND H;  3G3Z A;  2YO2 A;  3NMD A;  4U3F J;  3QWO C;  1H89 A;  4AQR D;  1MKM A;  1EZV D;  1YJW P;  1L0N J;  2SPZ A;  5B5E E;  1FOS F;  3B5N B;  1SQQ J;  2ZJS E;  1QVG O;  1ZW0 A;  2OTL P;  4JPZ B;  3GF7 A;  3P8M C;  3GLM A;  1SQV K;  2H88 C;  5B5E H;  2A45 I;  3LIE A;  4I1L A;  3WU2 E;  1LTS C;  3E1R A;  3OAK A;  3U59 A;  4EA8 A;  1AFO A;  4Y99 B;  1LT9 B;  4JF7 A;  2FXM A;  1KQS O;  3B5N A;  3L70 G;  3N7N A;  1VQ7 P;  1KGQ A;  3OJA B;  3WU2 H;  2I1J A;  3RK3 D;  1OMI A;  5AFU V;  4WWI A;  1NYH A;  4I7Z C;  1ZR2 A;  4DCK A;  1KFN A;  1HJ0 A;  3SPT A;  4OGQ D;  4BRY A;  1PL5 A;  1HM8 A;  1EQ7 A;  1FBM A;  1LT9 A;  4OVN F;  2ZYA A;  1WT6 A;  4B86 A;  1FZF A;  2FYU J;  4J18 A;  1HBW A;  3MP7 B;  4U3F E;  5E3Q A;  2E76 D;  5KAF E;  1BE3 D;  3BCC D;  1Q86 Q;  1NHL A;  3CX5 E;  1KQG B;  1SQV D;  3ABV C;  1SQQ E;  2WQY C;  1U7M A;  4PD4 D;  2JKV A;  4AUW A;  5KAF H;  5AVU B;  3NFQ A;  5DEM A;  1YI2 P;  3AE9 C;  2D2C D;  1S3J A;  1KB9 E;  1Y47 A;  3AE2 C;  2ZT9 B;  3SUC A;  3GQ8 A;  3MHV A;  3KXD A;  3L72 D;  1KFM A;  3ITK A;  1FZB A;  4IFD K;  1G1I A;  3HD7 D;  2PRR A;  1KC8 Q;  1HTL C;  2V0L A;  2HG5 D;  5AVW B;  4DJG A;  1KB9 H;  4IHH A;  2HOD B;  3NXS A;  2ZXX A;  4DOJ A;  2W90 A;  2WTY A;  1V67 A;  4QMA A;  1UII A;  3U1A A;  1NTK D;  3P47 A;  1Z56 A;  3A0B E;  3RK3 C;  4W80 A;  1USE A;  2Z5H A;  2JWD A;  1UIX A;  2NZ2 A;  1VF5 D;  3TGU G;  4BXL A;  3H1J G;  2QM8 A;  4R37 A;  1QGK B;  4OGQ C;  1G95 A;  5KLV D;  3A0B H;  3S1K A;  3S9O A;  4D6T J;  2PAJ A;  2HOD A;  1NTZ J;  4WY4 B;  1DEB A;  3BVH A;  2XZR A;  1T8Z A;  1P84 I;  3FGA D;  1AJY A;  1QRG A;  2WLD A;  5CCG D;  3R5C A;  3JCU E;  2E76 C;  2QIV X;  1HM0 A;  1ZLL A;  2WLE A;  1LNQ A;  4GDO A;  1ZP0 C;  1RE4 A;  4HJG H;  4WY4 A;  2M5A B;  3JCU H;  3Q3D A;  4MN4 C;  2OYI C;  4RO0 A;  2VHE A;  3A3Y B;  3MZW B;  2G8Y A;  3R5A A;  2D2C C;  5E3R A;  1Q7Y Q;  5TIS E;  3BRV B;  2A06 G;  1MV8 A;  4KNX A;  1ZRT D;  1N4I A;  4H44 B;  3HD7 C;  2M5A A;  2YO3 A;  5TIS H;  1BCC G;  4K3A A;  1IJD B;  3W68 A;  1LWU B;  4HUR A;  1AVO A;  4NPF X;  2K9J B;  1PPJ E;  2JR8 A;  1IZN B;  4GIF A;  5AW8 B;  2E43 A;  1NTM G;  1JMM A;  1ZOY C;  2N1T B;  4D6T E;  2YIU C;  3KYQ A;  1VF5 C;  3EG4 A;  2QIA A;  3KWC A;  1JCC A;  3OTM A;  1URQ D;  3CPW O;  3HE4 B;  2YXQ B;  4IFM A;  1EXJ A;  3D8V A;  3FXD A;  4KPX A;  1FJP A;  1LWU A;  1T3D A;  1JTH B;  1SQX J;  2WSS H;  2K9J A;  3AED C;  3L35 A;  5DEP A;  1YTZ I;  2N1T A;  5CCG C;  3L71 E;  2V0H A;  3VMY A;  1CZQ A;  2LXB A;  3HE4 A;  3AE4 C;  3QH9 A;  2KI7 B;  3IR9 A;  3H1K G;  4YXW H;  1OIP A;  3MUD A;  4JYB A;  1FDO A;  1JTH A;  3H1H D;  3V2P A;  2CPB A;  2FFD C;  1KRV A;  2RKL A;  1VQ8 P;  4I6M C;  3WUU A;  1QRM A;  2BEQ D;  3EQ2 A;  4JYC A;  2XKM A;  1A02 F;  1SQQ D;  1Q90 D;  5AVT B;  1K9M Q;  1OXZ A;  1FWY A;  1FZE A;  1RF1 C;  1IFI A;  5AW5 B;  3BCC J;  2Z5I A;  1SQV J;  4C7N B;  2R3S A;  4KT0 J;  2YNY A;  5GTI E;  3W67 A;  2C0X A;  3A7O A;  1QRL A;  4CPG A;  1M56 D;  1EC5 A;  2P58 A;  2M8R A;  3AE3 C;  5GTI H;  2VD4 A;  5L6S A;  1SQX E;  1M57 D;  1URQ C;  2P2O A;  1FZA A;  4EGG A;  3L74 J;  3FX0 A;  4AC3 A;  4M2B A;  2OTJ P;  4C7N A;  2IPP A;  3L72 J;  5CCH D;  1CSB A;  3NZ2 A;  4AYC A;  2WT7 B;  5GTH E;  4C46 A;  4YXD C;  1N7L A;  3CMA P;  1USD A;  4L75 A;  1KRR A;  2V0K A;  2KK7 A;  3SRT A;  1MFZ A;  1FAV A;  1WMK A;  3HUS C;  1SQP K;  3SSU A;  2XU6 A;  3RK3 B;  1KD1 Q;  1ZXG A;  2IUA A;  2E74 D;  2WT7 A;  3G9R A;  1YYC A;  1YHQ P;  3CWB D;  3RGU A;  2OQQ A;  3FTT A;  3VBL A;  2FYN C;  1SQV E;  3BSS A;  4E6U A;  3IF4 A;  1NOH A;  1RQU A;  3CL3 D;  3R3I A;  4R4L A;  3OA7 A;  1YBK A;  3CI9 A;  1NKZ B;  3V4W A;  3PJS K;  2NPS D;  2XV5 A;  3D71 A;  4XFJ A;  1WRG A;  1YIJ P;  2POH A;  2KIK A;  2K9Y A;  1SFC D;  5E79 E;  3L74 E;  1EDJ A;  1FXJ A;  1L0S A;  1JMB A;  3L72 E;  3RK2 D;  4IHG A;  1JB0 J;  3Q1M A;  2ZVO B;  1SQP D;  3A2A A;  2DW3 A;  5E79 H;  5AVX B;  2E42 A;  3OH4 A;  5CCH C;  1PPJ D;  2PFX A;  5CJ4 A;  4D6T D;  3P8C E;  1HM9 A;  1LTJ C;  1FC2 C;  2R5D A;  2IFN A;  1U57 A;  3FS8 A;  3AEG C;  3ZDM A;  2PP6 A;  4ZNC A;  2OYI A;  1VPC A;  2TDT A;  3HJJ A;  5L6V A;  1N73 C;  1PV3 A;  4XE5 B;  3B8E B;  4TLF A;  3T57 A;  3RL0 g;  4KJM A;  1S5L H;  2Y0C A;  3F1X A;  2E74 C;  4Z1M H;  1KQA A;  4JBZ A;  4E75 A;  5AW4 B;  2K37 A;  4ZMD A;  3HD7 A;  3L71 D;  1PGP A;  2QIW A;  1CI6 B;  3KPE A;  2FY8 A;  1TDT A;  4RKU J;  2YKP A;  1LJ2 A;  1NU1 K;  4KQL A;  3TGU E;  2QKX A;  1V3W A;  2HR3 A;  3H1J E;  3GQA A;  2K1A A;  2NPS C;  4UB6 E;  3JQY A;  2Y0D A;  1RF0 A;  4A7P A;  5BU8 B;  3OTZ A;  4ISX A;  1RE3 A;  1VQ6 P;  3GF3 A;  2QEX P;  1SFC C;  1NU1 G;  3K5B A;  1MUU A;  1KIL E;  2M3E A;  2FXP A;  3H1H J;  1X9V A;  3MQG A;  3RK2 C;  4UB6 H;  3PMO A;  1LTA C;  1Y9B A;  2ICX A;  2FFD B;  1BDC A;  5CCG A;  2RN0 A; 
#chains in the Genus database with same CATH homology
 3SFE C;  1DD3 A;  1VL2 A;  2E76 B;  2QJP C;  1UIX A;  2NZ2 A;  1VF5 D;  1S80 A;  5E3P A;  4R37 A;  1RQV A;  1R8E A;  4OGQ C;  2OI5 A;  1G95 A;  3FOQ A;  4H44 D;  3S9O A;  3ECT A;  2W0W A;  4PV1 D;  4R7P A;  1KK5 A;  2V7Q J;  3LW5 J;  4IHF A;  3ST8 A;  2JF3 A;  2JP3 A;  2WLC A;  4N6A A;  2GGQ A;  2IU8 A;  2D2C B;  3FGA D;  1K04 A;  3IN6 A;  1AJY A;  1QRE A;  4M9C A;  3OW5 A;  1QRG A;  2WLD A;  1DIP A;  3R5C A;  1MRL A;  3VBJ A;  4G3Q A;  2E76 C;  3D6Z A;  1Z90 A;  2ICY A;  3DK5 A;  2WLF A;  2QIV X;  1SSM A;  2ZT9 D;  1HM0 A;  2WLE A;  2V0J A;  1EXI A;  4GDO A;  1LXA A;  1ZP0 C;  3VBK A;  3Q3D A;  1FDI A;  2VHE A;  1KMI Z;  4E6T A;  3TK8 A;  3FWW A;  1QRF A;  2G8Y A;  4M99 A;  1OCX A;  3R5A A;  2FBW C;  4EA7 A;  2D2C C;  5E3R A;  1VF5 B;  1MR7 A;  4KNX A;  4U7J A;  3VBP A;  1J2Z A;  4H13 B;  3R5B A;  2O01 J;  4H44 B;  2NPO A;  2QJY C;  4HZC A;  2YMK A;  3AE1 C;  2G3A A;  4PV1 B;  2OEF A;  2AQ9 A;  4TT3 H;  2WSE J;  4MFG A;  5U2K A;  3DHO A;  4AAW A;  4HUR A;  2MKV A;  1XHD A;  3TDT A;  3TV0 A;  3RK3 E;  1ZOY C;  2QSI A;  2QJK C;  3D98 A;  2YIU C;  1VF5 C;  3TIS A;  3EG4 A;  2QIA A;  3VNP A;  3KWC A;  4M98 A;  3B71 A;  3OTM A;  4G87 A;  3SFD C;  3D6Y A;  4H0L D;  4FCE A;  1EXJ A;  3D8V A;  4H44 C;  4KPX A;  3Q5P A;  4PV1 C;  1NGM B;  4HUS A;  4HCQ A;  3IAO A;  3GOS A;  4EQY A;  1T3D A;  1S1C X;  3FSB A;  3CJ8 A;  3AED C;  4K6R A;  2Q4J A;  3MQH A;  5DEP A;  3EEV A;  3EH0 A;  2BEZ F;  3DJ4 A;  4M28 A;  3GMA A;  1HF9 A;  2V0H A;  2WLG A;  2ZT9 C;  3O6Q A;  3AEA C;  1KOR A;  4H13 D;  3AE4 C;  1XAT A;  3P1B A;  4KNR A;  3AEB C;  2FKO A;  2JO1 A;  4N69 A;  3AE6 C;  1FDO A;  2OEG A;  1SSQ A;  3IGJ A;  3BXY A;  4J09 A;  3OUP A;  3TWD A;  1KRV A;  4N27 A;  1QRM A;  3I3X A;  2BEQ D;  3H25 A;  4M2A A;  5KLI C;  1THJ A;  1OW7 A;  1TU3 F;  1Q90 D;  1KK4 A;  4AA7 A;  3IXC A;  2P10 A;  1FWY A;  4H0L B;  3KWE A;  2IU9 A;  4MYO A;  3AEE C;  3AEC C;  3R5D A;  1KK6 A;  4G3S A;  2OI7 A;  2OI6 A;  4KT0 J;  1QRL A;  1SST A;  2XAT A;  3GVD A;  3R1W A;  2WSF J;  4N6B A;  5AFU U;  3AE3 C;  5L6S A;  2VD4 A;  1K05 A;  1G97 A;  2P2O A;  4H0L C;  4EGG A;  3BRK X;  3FSY A;  4AC3 A;  4M2B A;  5M1B A;  4MZU A;  3BFP A;  1MR9 A;  4H7O A;  1KTM A;  3NZ2 A;  4YXD C;  3EWK A;  4E1K A;  5ADX U;  1KRR A;  1KRU A;  2E75 B;  3AE5 C;  2V0K A;  2GGO A;  3SRT A;  4HZD A;  1KGT A;  1WMK A;  1YQ4 C;  3VBM A;  1YQ3 C;  1OW8 A;  4H13 C;  5L8R J;  1KQF B;  2IUA A;  2RIJ A;  3BSW A;  2E74 D;  3Q5S A;  3G9R A;  2H89 C;  3R4Y A;  3AE8 C;  1OW6 A;  4EAA A;  1YP3 A;  1HV9 A;  3KWD A;  1ZRT E;  2OQQ A;  3FTT A;  3VBL A;  2FYN C;  3BSS A;  3OU9 A;  4E6U A;  2WSC J;  1MKM A;  1RQU A;  3D70 A;  3R3I A;  4R4L A;  4I7Z B;  3D71 A;  3Q2Y A;  3GF7 A;  4XFJ A;  3R0S A;  2JF2 A;  4R36 A;  3GLM A;  2H88 C;  2K9Y A;  1QQ0 A;  3T97 B;  4Y28 J;  1FXJ A;  4EA8 A;  2IDB A;  3C8V A;  4IHG A;  1DD4 A;  1JB0 J;  2E75 D;  3Q1M A;  1KHR A;  1PIX A;  2W0V A;  1KGQ A;  2E74 B;  1OMI A;  5AFU V;  3I3A A;  1NYH A;  4I7Z C;  1HJ0 A;  1HM9 A;  5F42 A;  4KPZ A;  3SPT A;  1YP4 A;  2J5U A;  4OGQ D;  1PL5 A;  1U57 A;  3FS8 A;  3AEG C;  1HM8 A;  4R4M A;  2TDT A;  3HJJ A;  5L6V A;  3TIO A;  1PV3 A;  3GUE A;  4EA9 A;  3T57 A;  3RL0 g;  2I5K A;  3VBI A;  2WPV B;  4DCL A;  3FSC A;  4J18 A;  5ADX V;  3F1X A;  2E74 C;  4IL6 X;  4Z1M H;  5E3Q A;  3AE7 C;  5KKZ C;  1KQA A;  1YP2 A;  4E75 A;  2E76 D;  1KQG B;  1ZME C;  3ABV C;  3MC4 A;  4YTP C;  4G3P A;  5DG3 A;  2WQY C;  2QIW A;  1GMJ A;  1TDT A;  4RKU J;  5DEM A;  3HSQ A;  3AE9 C;  4KQL A;  2D2C D;  2QKX A;  1V3W A;  3V4E A;  3BSY A;  2V0I A;  4EAB A;  1S5L X;  3AE2 C;  3JQY A;  2ZT9 B;  3OTZ A;  3VBN A;  3Q1X A;  4OGQ B;  4ISX A;  3GF3 A;  3FSX A;  3R2W A;  4E79 A;  1KIL E;  2FXP A;  2V0L A;  3MQG A;  3AEF C;  4IHH A;  3PMO A;  1Y9B A;  2E75 C;  3R8Y A;  3Q5R A;  2ICX A;  1V67 A;  2IC7 A;  3P47 A;  1IK7 A;  3R3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...