3C8VA

Crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
476
structure length
453
Chain Sequence
b'GMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGKNFTFNIIQPYQDGDPRGMYPTILIQPNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (YP_390128.1) from Desulfovibrio desulfuricans G20 at 2.28 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
molecule tags Transferase
total genus 165
structure length 453
sequence length 476
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18776 Hexapep_loop Hexapeptide repeat including loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3c8vA04
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA03
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3c8vA02
2E74B 3MQHA 4G87A 2ICYA 2O01J 4I7ZB 2JF2A 3HJJA 3EH0A 4J18A 3GUEA 4AA7A 1KK4A 1SSQA 4E1KA 1V3WA 2RIJA 3OTMA 4IHGA 2YIUC 1Z90A 2NPOA 2WPVB 3F1XA 4HURA 5E3QA 4E75A 3R5CA 1QRLA 3CJ8A 3FSCA 4KNRA 3KWCA 3FSXA 1V67A 2OI7A 1QREA 1XHDA 3OTZA 4N6AA 1HV9A 4KPXA 4N69A 1VF5B 3VBMA 2V0JA 3SRTA 1MRLA 1FXJA 3R3RA 3BRKX 3BXYA 4G3SA 4N6BA 1KRUA 3OW5A 1HM0A 3P1BA 4M2AA 3OUPA 4R36A 1SSTA 2XATA 3OU9A 3C8VA 2VHEA 4KNXA 3TIOA 1MR7A 2WLDA 1JB0J 3TISA 3BSYA 3I3AA 2TDTA 5U2KA 4M9CA 4E6TA 2OEGA 4M99A 1SSMA 4EA7A 4N27A 4KT0J 4H0LB 3TDTA 5ADXU 2WLGA 2K9YA 3DJ4A 3EG4A 4E79A 3TK8A 3D8VA 3BSWA 3R5DA 2QIWA 2FYNC 4HZCA 4OGQB 3P47A 2VD4A 3VBLA 3KWDA 3PMOA 5KKZC 1G97A 4IL6X 2IU8A 1QRFA 3IXCA 3R1WA 4HCQA 4HZDA 1OCXA 3FSYA 3R2WA 4AC3A 1J2ZA 1YP3A 2P2OA 2QSIA 3GVDA 2V0HA 3VBKA 2IU9A 3MQGA 3VNPA 2QKXA 1ZRTE 4EGGA 3TV0A 2JF3A 4MYOA 1G95A 5DEMA 2QJYC 2QJKC 1YP4A 2Q4JA 2V0IA 3FSBA 3FS8A 3FOQA 2QIAA 4FCEA 1KK5A 1TDTA 2OEFA 2QIVX 3V4EA 4EA8A 4R37A 1S80A 1T3DA 1KHRA 2I5KA 3FTTA 2ICXA 3NZ2A 4IHHA 4RKUJ 4ISXA 5KLIC 1THJA 3SPTA 2GGQA 3VBJA 3JQYA 2WSFJ 2W0WA 5AFUV 4AAWA 1FWYA 2OI5A 4EA9A 4H44B 1YP2A 4E6UA 2IC7A 4Y28J 2IUAA 3D98A 2WLEA 4J09A 4KQLA 2WSCJ 5F42A 4M98A 4R7PA 5L8RJ 2E75B 2WLFA 3EEVA 1QRMA 1KGTA 3IGJA 1KK6A 4G3QA 1QQ0A 4HUSA 3VBNA 4PV1B 1HM9A 4H13B 3DHOA 3GOSA 3ST8A 1KQAA 3R0SA 5L6SA 5AFUU 3FWWA 2GGOA 1KGQA 2QJPC 1KRRA 4G3PA 3R5BA 3BFPA 3Q1XA 4K6RA 3I3XA 4M28A 5DEPA 3T57A 5E3RA 2D2CB 3R5AA 3VBPA 2AQ9A 2V0LA 2E76B 3DK5A 1MR9A 3R3IA 4H7OA 5E3PA 1S5LX 1KRVA 1Q90D 1QRGA 2WLCA 3KWEA 4M2BA 4EABA 2W0VA 4EAAA 2WSEJ 3BSSA 3ECTA 3HSQA 3LW5J 3TWDA 3MC4A 1LXAA 3VBIA 5ADXV 2OI6A 4MZUA 4MFGA 4DCLA 2ZT9B 4IHFA 2FKOA 5L6VA 1XATA 2V0KA 5DG3A 1HM8A 3R8YA 4KPZA 4EQYA
chains in the Genus database with same CATH superfamily
4IL6H 1L0NG 1K04A 1JO5A 1YYCA 2AXTH 3FWLA 1QVGO 3L35A 1M57D 1K9MQ 4XFJA 1OW8A 3TGUG 4B86A 4C7NB 1NTZE 2V0JA 1GDTA 2HR3A 4XE5B 1SQVD 2RKLA 1KRUA 1OIPA 3PLNA 4GKGA 2FYUK 3O8ZA 2M0BA 2Z4EA 1AQ5A 2HFED 2N9YB 4NPDA 2O01H 1NTMG 1JNMA 1IFPA 2QIWA 3H1KJ 4HZCA 2B88A 2VD4A 5APVA 3PMOA 1SQVE 2QSIA 2P2OA 3H1LJ 2V0IA 2QIAA 2OEFA 1RF0A 3AE1C 2M8RA 4IHHA 5DJUB 1IFJA 1BSHA 1JEKA 2WPQA 2Y0DA 3L71J 5AFUV 2G8YA 2HODA 2IUAA 1KFMA 3M0DC 1G2CA 2IX7C 4IFMA 1UIXA 5B66H 2NPSB 3DHOA 1SQXD 1M1JC 1M1KQ 3B71A 3RK3C 2D2CB 1EC5A 1FDMA 2IZ0A 1SQBJ 3TWDA 4MFGA 3V2RA 2IYPA 2Z5IA 1EDJA 2E74B 2WMMA 1SQXE 1X0TA 2ZYDA 3WUVA 1RF1A 4DZOA 2KOGA 4NPEA 3IFMA 3CX5D 3SFDC 1GW4A 3I56P 3NFQA 1LTIC 4XA4A 3KQGA 1KILA 3LIDA 2H8PD 2M5AB 1OVRA 2QG4A 1HM0A 1LWUA 1G2CB 4PD4D 2M3BA 5C39A 1PP9G 4M9CA 4M99A 4H0LB 1JY2N 2W6JH 3AEEC 3CX5E 1PL5A 1NTZJ 2WQYC 2CPSA 3VN0A 2W8ZA 3D6ZA 1EDLA 2IU8A 1BCCG 1Z56A 1OXZA 2N1TA 4PD4E 2P7JA 4N3YB 5KLVK 3V4EA 3OA7A 2FYZA 2I5KA 1J1EB 2KB7P 1RF1B 1GK4A 1KV4A 3RL0B 4AAWA 2BEZF 1IFIA 1NVOA 1L0NK 4EA9A 2XDJA 2JWAA 1SQVJ 1ZN5A 4Y28J 3AEGC 1MFTA 3E1IA 1LTJA 1HUCA 4HUSA 1L0LE 4H13B 4EOTA 1SQQG 2AEMA 3G4SP 1IC2A 1KRRA 1KB9I 3DK5A 4M2BA 2W0VA 1NTKG 3HSQA 1H89A 2KNCA 2LKMA 4C46A 5ADXV 2OI6A 3HUSA 5KAFH 2V0KA 4IOIH 4EDFA 5CCGD 1NTMK 1NU1G 2N1TB 1N73A 2AEFA 2QEXP 1JCCA 3NXSA 2WITA 1WT6A 2RIJA 5AW3B 3HRNA 1QREA 1XHDA 5CCHA 3F89A 3RK2B 3VMZA 5E79E 1M8OB 5GTIE 3L74D 2OYHA 2WTYA 4N6BA 1PZQA 1SQXJ 1EXIA 1SSTA 1ZP0C 1LTJB 1SSMA 5K5GB 4QMAA 4E79A 3D8VA 1URQA 4OGQB 4DT0A 2XNXA 3L74E 1Q82Q 2KNCB 2V0HA 4IL6E 3U1CA 1RE4A 3HUSB 3FS8A 2KP8A 1NO4A 1N2DC 2IZ1A 1T3DA 4WY4A 2AXTE 1QVFO 3H1KG 2QJKB 3VBJA 1IFNA 2GUVA 2IYOA 2Y0EA 2E5YA 1JY3O 3WU2H 2R3SA 2QA4P 5F42A 2I1KA 2OYHB 1FZBA 4PV1B 4L75A 1KQAA 2ZYGA 1J2JB 3L71G 2ZXXA 1NAFA 1VQ7P 3KWEA 2E74C 2DW3A 3LW5J 1URQB 5KAIE 1JTHA 3CCJP 1RHZB 2R44A 4IFFA 1RF0C 1HH0A 1XATA 1N86A 1L0LJ 3GG2A 3JCUH 1VPCA 4C7RA 5CHXA 3OGZA 2NZ2A 2C9LY 1KZUB 4JF7A 4WY4B 1SQBG 3OAKA 3KWCA 4KJMA 2YKPA 2OTJP 3O6QA 5BVZA 3CL3D 1MRLA 5B66E 3W67A 3BXYA 4AQRD 1H88A 1CSBA 1SQPJ 1CI6B 3H1ID 4UB8H 2TDTA 1BSNA 5ADXU 3G9RA 3CX5I 3IAOA 1G97A 1QRFA 1SFCA 1OCXA 1SQQK 1JTHB 2JF3A 3SSUA 3M9BA 1RF1C 2Q9IA 1JY2O 3RL0C 2QIVX 3FTTA 1NTKK 2WPRA 2V7QH 4RKUJ 1DX7A 1THJA 3SPTA 1T3JA 3II6A 5APTA 1HF9A 3SWFA 1M1JA 1KILD 2I1JA 4H13C 1NU1K 3L74J 4E6UA 1LWUC 1ZW0A 1JY2P 3D70A 2IC7A 1IFMA 3O6QB 2B89A 1QL2A 3CMEP 2YKOA 2J58A 1FJKA 2XKMA 2R5DA 1VDFA 1EDKA 1YHQP 3OH3A 5KTBA 2E42A 1GL2D 1HJ0A 2V0LA 1PGPA 1SQVG 1QRGA 2N1TC 1FE6A 2YXQB 3VBIA 1X8YA 2ZT9B 1SFCB 1NH4A 3RK2C 3HE4B 2O01J 5AW9B 5CJ0A 1JUNA 2MJZA 2L5GB 2BCCD 3PJSK 2V4HA 4W80A 2L91A 1FS0E 1Q2NA 2JJLA 3KZIH 1GD2E 1GU5A 3CCRP 1LTJC 2B87A 2WSEH 3V2NA 3BRKX 3ITKA 1M56D 4R36A 1JB0J 3TISA 3I3AA 4OGQC 4PD4H 2BCCE 5EFWB 2ZVOB 2FXOA 2UWJE 3JSVC 3TK8A 3BSWA 3HUSC 4L74A 1IZNB 1SQXG 5KAFE 3MQGA 1ZRTE 3A0HH 3MP7B 5AW2B 2FYNB 2P2UA 2QJKC 3FSBA 3RL0g 4I1LA 5CCHC 1BE3E 1NJIQ 3MIWA 1KFNA 3CWBG 2OYHC 2OI5A 1BDDA 4PV1C 1XTGB 1YP2A 2FKWB 1Y9BA 3QH9A 2W6AA 1SQBK 3ST8A 3GOSA 3A7OA 2PP6A 1AA0A 3BRVB 1URQC 3T57A 4H44D 1XTCC 2OTLP 1KQFB 3GF7A 3M06A 4C7NA 1EQ7A 1RE4C 2WSFH 1W2BO 3L75E 1BGYD 2P10A 3BVHA 5GTIH 4WY4C 1T8ZA 5TISH 1VQPP 4KPZA 2ICYA 3CD6P 1LP1B 2IBZE 3K5BA 3OW2O 2A06E 4E75A 1OFCX 1R8EA 1WMKA 4N69A 3WU2E 1VF5B 1L0LG 1FC2C 1BGYE 1PGJA 4EYYQ 3LIEA 3GF3A 4EI2A 4ZKPA 3FX0A 3GQ9A 2O01N 3VP9A 3DJ4A 2NRGA 3NMDA 5APUA 1ZXGA 3IXCA 1SQPG 4AC3A 3JCUE 1SS1A 3CXHD 2NPSA 1LGHB 1SQVK 4LLHA 1S80A 5KJ7A 1N8RQ 2OYIB 2J5UA 1FZGA 2H43A 5DJTB 1Z2FA 3VTPC 5APSA 2FYUD 4ASWA 5KAIH 4HKZH 3BCCD 4UB8E 1JY3N 1BE3J 1KGQA 1DEEG 4GODA 5AVRB 1YQ4C 2ZT9C 4NPFX 3L74G 5AVYB 2E76B 1SFCC 3A5TA 2KLVA 2QJPB 2HPCA 1K8AQ 5APQA 3L72D 4MZUA 2M5AA 3BCCE 1ZR4A 1HM8A 3S9OA 3MUDA 4I6MC 4AA7A 2HLOA 1DD3A 1SSQA 4GDOA 3M9QA 1SQXK 4HURA 3RK3D 3SWYA 3L75J 3HD7A 4GOFA 4L73A 3VBMA 1L4AB 2OARA 1VQMP 4BXLA 5BU8B 3H1JJ 2ZJSE 2W6BA 1VQ6P 3AE7C 3V4QA 3PRJA 1MV8A 3RK3E 3OH0A 1H8AA 2FYNC 1ZLLA 1BGYJ 4ZNCA 1FDIA 1LT1A 4U3FD 5APYA 2HPCB 5DEMA 3V2QA 2KIKA 2GM4A 3PTZA 2VRSA 1KHRA 3MZWB 1MFZA 3H1HD 1S2EA 4D6TD 2QJYB 2GGQA 3KZIE 1FOSE 5CBNA 1P84D 1PGOA 3Q2YA 4EIJA 4U3FE 3HD7B 4KQLA 2ITAA 1YJ9P 1USEA 3HTKA 1NHLA 2WLFA 4G3QA 4DCLA 1KK6A 3OH2A 4L76A 3B8EB 3H1HE 3R5BA 1L0LK 3BFPA 4YXWH 1MR9A 3H25A 1Q90D 3I5CA 2H89C 3MC4A 1AJYA 1SLQA 3Q5SA 1GZLA 5KLVD 3A0HE 2FKOA 3VMXA 2IBZI 3C1LA 1GMJA 2QM7A 3BASA 2WSCH 2P67A 3HJJA 4JYCA 2N9BA 2B9BA 1VF5C 2G3AA 5CJ4A 1VQ4P 1KK4A 1L0ND 1SQPK 1V67A 3CMAP 3BATA 4LGDE 3BCCJ 4M3LA 1FXJA 3MGNA 2YNYA 1JOCA 1PGQA 1HBWA 5AW4B 1PPJD 1TU3F 2A45I 2XATA 2V7QJ 2FBWC 3TF5A 3HTKB 1WRGA 3KYQA 1L0NE 3TNUB 4A7PA 5AW1B 1M90Q 3OH1A 4UB6H 2YO2A 1DH3A 1NTMD 5TISE 2R3CA 2IU9A 1PPJE 5AVSB 1Q86Q 4KHXA 4BRYA 1NWQA 2KSEA 4ISXA 1IFDA 3QWOC 4HJGH 3JQYA 2W0WA 1HWTC 1GTWA 1N7SA 3VBNA 3H32A 2E76C 3FXDA 3U59A 1KMIZ 1YJNP 2QJPC 3TK1A 3T97A 1YTZI 4G3PA 3Q1XA 1RE3A 1J1DB 3OJAB 4K3AA 1OMIA 2AQ9A 2WVRA 1S5LX 4EABA 3C9IA 2WSEJ 1OVUA 2BEQD 2NPSC 4U3FJ 3L37A 2NPSD 3H1LG 1OVVA 1FJPA 1BE3G 1CI6A 5KJ7C 2D2CC 3MQHA 1HGVA 3CLQA 3IN6A 2D2CD 1FBMA 4I7ZB 3H1HJ 2CK3H 2K88A 4O9BA 3AE3C 4IHGA 4OWFA 1JY3P 1VL2A 4BRYB 1Q81Q 3FSCA 3FSXA 2OI7A 1HV9A 4KPXA 1PFIA 3A0BH 1LTSC 1KORA 1JCDA 2E74D 2K3RA 3A2AA 2QRXA 4YPCA 3PHLA 2WLDA 1N7SB 2Q3EA 4BWNA 3BSYA 3H32B 1KYOD 4AYCA 2O3JA 4N27A 2KK7A 1RQVA 3T97B 1ZV8A 3L75G 1PP9D 1YITP 1N4IA 4N6JA 3GHGA 3H1JG 3MUDC 4DJGA 2IBZG 1S5LH 2A06G 4H0LC 2ZAEB 2QJYC 3TIOA 1T3UA 3AE5C 1W2EA 4EA8A 4H0LD 4FCEA 3CXHH 3G3ZA 1L0NJ 3AEAC 3TDKA 1QL1A 2XV5A 3HD7C 1RH5B 1PP9E 1BGYG 1YBKA 5AVWB 2WSFJ 3CC2P 3FWNA 1X22A 3ABVC 4PD4I 1J1EC 2A45G 1QLED 3EEVA 1KC8Q 3HE4A 3H1IE 3FWWA 4JYBA 3RL0D 1E5WA 3KXDA 3R5AA 1NTZG 2IDBA 1SQQD 4ASVA 1LT9A 4H13D 3CCQP 3GHGB 5DG3A 4LC1A 3EWKA 3V6IA 1T2KC 3AECC 2W83C 5AW5B 2E5TA 1OWAA 1A02J 5E3QA 3F1XA 1NU1D 1EZVD 1U7MA 1DIPA 3CJ8A 4HYTB 1RY3A 2Q7CA 1ZOYC 5GTHH 2JDIH 5AW0B 1KILE 3P7KA 2N1TD 3AE9C 1AFOA 1VQOP 2Y9ZA 4KNXA 1MR7A 1QX8A 1E79H 4WWIA 2OEGA 1FZEA 3RK2D 1NU1E 1EZVE 1KQLA 3EG4A 1K05A 1LNQA 1AV1A 3U1AA 3Q5RA 3KWDA 4HZDA 3R1WA 3VBKA 3W68A 1LT9B 2IFNA 1TDTA 4R37A 1YQ3C 2AXCA 2ICXA 4OVNF 4OGQD 1JMMA 1FOSF 1FWYA 2R32A 1P84H 1FDOA 3AE8C 4W7YA 3N4XA 3SWKA 1J1DC 1LTGC 1HGZA 2JR8A 1BDCA 1LP1A 3CPWO 4JQ0D 2C0XA 1FZFA 4K6RA 5CCHD 5AW8B 1SP4A 1RQUA 3P32A 5AVVB 4UB6E 3R3IA 2WLCA 2KS1B 3L71D 3VYIA 2GA1A 4I7ZC 1KQSO 2SPZA 4PV1D 1KQGB 3H1IJ 1G1IA 2KUBA 2W27A 2Q1KA 3FXEA 2JEEA 1Z90A 1ZMEC 1URQD 3OTZA 3M0AA 3GMAA 4K35A 3TYYA 2H88C 1LTBC 1N7SC 3CCEP 1SQBD 1RE3C 4WY4D 1FAVA 3GQAA 2OYIA 1DEBA 3CCMP 1LTAC 3SFEC 4YTPC 3R5DA 1KB9D 1S9KD 2Y9YA 4Z1MH 3GVDA 1HTLC 3E1RA 2QVAA 1FZCA 2IFMA 3FOQA 1NTZK 5KKZB 4GT1A 1NU1J 2FFDA 1AVOA 3A0BE 3G71P 1FZAA 2ZFCA 2WT7A 1NYHA 2KZIA 2WSCJ 5L8RJ 2E75B 2PGDA 3L70D 1QRMA 1LJ2A 1U7JA 5L6SA 2POHA 2BCCJ 1A02F 3VBPA 2W90A 2K9JB 3GHGC 1H0TA 1KRVA 3ECTA 1L4AA 1PPJG 3WUUA 1S5LE 2XU6A 4W7ZA 3Q1MA 4IHFA 4AUWA 3L70E 3CXHE 1EDIA 2R5BA 2JF2A 1FZCB 4E1KA 3R5CA 2FFDB 2ZT9D 1SFCD 1GW3A 5H2FH 3AE6C 2FYUE 3R3RA 2WT7B 3OW5A 5AVQB 1Y8AA 3M91A 1EZVI 3V5BA 4KT0J 3TDTA 4Y99B 1KYOH 3ZDMA 2KSJA 1LT9C 2J59M 3RGUA 4RO0A 1H0TB 3G6EP 3L72E 1J2ZA 4EGGA 1G95A 1KK5A 3SUCA 3UIAA 3OH4A 2ZYAA 1X79B 1CW5A 3RBXA 2OGUA 5GTHE 3CCLP 1EWWA 3MHVA 1YIJP 4JBZA 1KN7A 1OX3A 5KLIB 3CWBD 1LTTC 4M98A 4R7PA 3KDPB 1KGTA 4GOEA 5M1BA 1YI2P 3AEFC 1L0SA 3PH0A 3GLMA 4EAAA 4HB1A 1L2PA 4JPZB 3BSSA 3CCUP 2HODB 1AQTA 1VQKP 3CWBE 3L73D 5AVUB 3B5NA 1Y47A 2PRRA 5TJHA 1R5LA 3TNUA 5AW6B 3OTMA 3S1KA 1UIIA 4D6TE 3VMAA 4DCKA 1OW7A 1MKMA 1GL2A 1P84E 3V2PA 2M3EA 1K73Q 3H1IG 2YIUB 3L36A 2IPPA 3L70J 3L73E 2ZXEB 4G3SA 2YMKA 3P1BA 3AEDC 3OUPA 1L0LD 2FXPA 3OU9A 2VHEA 5APXA 4E6TA 2QM8A 3PP5A 1T6AA 1VF5D 3AE2C 2WZ7A 2PAJA 3P47A 1VQ5P 5KKZC 1G1JA 2FYUJ 4WB4A 4HCQA 2OYOA 2Q5UA 5KLVE 3D71A 1ZR2A 1KILB 2AEJA 2BASA 3TGUD 1SQPD 1LWUB 4MN4C 1U57A 3NTNA 3B5NB 4WVZA 5APWA 2H7HA 2E75C 2E75D 3L72J 1USDA 1GL2B 5B5EH 2JO1A 3N7NA 5CCGC 3HE5A 2YKQA 3TGUE 1SQPE 1EZVG 4HH2A 2OYIC 1HM9A 5AFUU 4GIFA 5E3PA 4H7OA 2Q6QA 1S3JA 1JM0A 1NTME 3CXHI 1FZCC 1KTMA 1HVVA 2BCCG 1OZHA 5AVZB 3R2PA 2FFDC 2E76D 1Q7YQ 1MUUA 2XZRA 2RMZA 4PJ0E 3R4YA 4KNRA 2FXMA 1EXJA 3RBZA 3CWBJ 2KZJA 4DOJA 3AE4C 2WWWA 4Y99C 2O1KA 3VMYA 3HE5B 1GU4A 3MTUE 3P8CD 5KJ7D 1CZQA 3IR9A 1N73B 2Q3IA 4D6TJ 5BU5A 1L4AC 1VQ8P 1L4AD 2K1AA 3CI9A 2CPBA 1OW6A 3EQ2A 3L73J 1KB9H 3FSYA 3VNPA 3L4FA 3WUTA 3P8CE 2Q4JA 2E43A 2KI7B 2O1JA 3S4RA 1VQNP 3NZ2A 2A45H 5KLIC 1MZ9A 1S72P 1GK6A 2QE7H 4H44B 5H2FE 5KLVJ 2OTKE 2WLEA 1S1CX 1SVFA 1S4XA 1BCCD 1KYOE 5DEPA 3I3XA 5E3RA 1N7LA 3EFGA 1NAYA 3HD7D 4OH8B 2P1JA 2KYVA 1NOHA 3I55P 1LXAA 3KPEA 3TGUJ 5L6VA 4I2LC 1R5SA 4EQYA 4G87A 4TLFA 4ZMDA 2C9NY 1BCCE 3EH0A 4J18A 3V4WA 2YIUC 4N78D 2NPOA 2WPVB 3WMM0 1QRLA 1P84I 4N6AA 1NKZB 1NTMJ 1AVYA 4U7JA 2GUSA 4M2AA 1YTZT 4R4MA 1NTKD 2JKVA 2I8DA 4RESB 4RJTA 3GQ8A 2FY8A 3M0DA 1T2KD 4EA7A 3KHUA 4N78E 1VQLP 1M7LA 2K9YA 2WLGA 2YMYA 1KILC 3VP8A 1SQQE 2PFXA 4ZKUA 3L70G 3B5NC 3GQ7A 1YP3A 3JC22 5AW7B 3B5ND 3CCVP 2QKXA 1FU1A 1NTKE 4MYOA 3MD0A 2KXPB 1NKNA 3USSA 1GL2C 2RH0A 2KS1A 4R4LA 1JMBA 2FYUG 3BCCG 2MKVA 3D98A 2OQQA 2WPSA 3A3YB 2LXBA 1IK7A 2K37A 5AVTB 3D6YA 2HG5D 2GGOA 2LR2A 3CC7P 4M28A 3L72G 3TSIA 3P8MC 1M8NA 2JWDA 3CX5H 1IJDB 1M1JB 3H1KD 3RK3B 1ZRTD 3R8YA 2LXCB 3H1LD 4YXDC 3GUEA 2YO3A 2YXRB 1IK9A 1BE3D 1D7MA 1V3WA 1PP9J 3E7KA 1X9VA 2HYNA 5B5EE 3H1KE 1HJBA 2P58A 3CCSP 1N73C 3H6PA 3SRTA 1IO4A 3LW5H 1QGKB 1PV3A 1BCCJ 3C8VA 2XNDH 3H1LE 5U2KA 1KD1Q 3CC4P 1W5CE 2ZVNB 4U3FG 5AVXB 3VBLA 3L71E 4IL6X 3L75D 3M9HA 3R2WA 1N7SD 2Y0CA 2B87B 2RN0A 3Q3DA 3TV0A 5CMZA 3H1HG 1YP4A 1YJWP 3GW6A 3H1JD 4D6TG 2IBZD 1DD4A 5CCGA 5CBOA 3VOPA 3B4SA 2A06D 2Z5HA 4H44C 3FGAD 4TT3H 3AEBC 2K9JA 1SQQJ 1QEXA 3L73G 4IFDK 1SQBE 1NTKJ 4J09A 5E79H 1VQ9P 3IGJA 3F5HA 1QQ0A 1KYOI 3H1JE 3R0SA 3EFFK 1PIXA 3BRTB 2JP3A 3Q5PA 5KLVG 4PJ0H 2C0WA 1KB9E 4CPGA 1S9KE 1NGMB 2KLUA 4WBAA 1NTZD 2WSSH 3IF4A
chains in the Genus database with same CATH topology
2D2CC 3MQHA 1K04A 3IN6A 2D2CD 2O01J 4I7ZB 3AE3C 3OTMA 4IHGA 1VL2A 3FSCA 3FSXA 2OI7A 1HV9A 1OW7A 4KPXA 1MKMA 4XFJA 1OW8A 1KORA 2E74D 2V0JA 3BRKX 4G3SA 2YMKA 1KRUA 3P1BA 3AEDC 3OUPA 4R36A 2FXPA 3OU9A 2VHEA 2WLDA 1JB0J 3TISA 3BSYA 3I3AA 4OGQC 4E6TA 4N27A 1RQVA 1VF5D 3AE2C 3T97B 3TK8A 3BSWA 2QIWA 4HZCA 3P47A 2VD4A 3PMOA 5KKZC 4HCQA 3D71A 2P2OA 2QSIA 3MQGA 1ZRTE 4H0LC 2QJYC 2QJKC 2V0IA 3AE5C 3FSBA 3TIOA 4EA8A 4H0LD 3RL0g 2QIAA 2OEFA 4FCEA 3AE1C 1U57A 3AEAC 4IHHA 2WSFJ 2E75C 5AFUV 2OI5A 2G8YA 4PV1C 2E75D 1YP2A 3ABVC 2IUAA 2JO1A 1Y9BA 1UIXA 3EEVA 1HM9A 3DHOA 3GOSA 3ST8A 5AFUU 3FWWA 3T57A 3B71A 2D2CB 4H44D 3R5AA 1KQFB 2IDBA 5E3PA 4H7OA 3GF7A 3TWDA 4MFGA 4H13D 2P10A 1KTMA 5DG3A 3EWKA 4KPZA 2E74B 2ICYA 3AECC 2E76D 5E3QA 3F1XA 4E75A 3R4YA 3CJ8A 1DIPA 4KNRA 1R8EA 1ZOYC 1EXJA 3SFDC 1WMKA 4N69A 1KILE 1VF5B 3AE9C 3GF3A 3AE4C 1HM0A 4KNXA 1MR7A 4M9CA 2OEGA 4M99A 4H0LB 3DJ4A 3EG4A 1K05A 3AEEC 1PL5A 2WQYC 1OW6A 3Q5RA 3KWDA 3D6ZA 4HZDA 3IXCA 2IU8A 3R1WA 3FSYA 4AC3A 3VNPA 3VBKA 2Q4JA 1TDTA 3V4EA 4R37A 1YQ3C 1S80A 2I5KA 2ICXA 3NZ2A 4OGQD 5KLIC 4AAWA 2J5UA 1FWYA 2BEZF 4EA9A 4H44B 1FDOA 4Y28J 3AE8C 2WLEA 1S1CX 3AEGC 4HUSA 4H13B 1KGQA 1KRRA 4K6RA 3I3XA 5DEPA 1YQ4C 5E3RA 2ZT9C 1RQUA 2E76B 3DK5A 3R3IA 2WLCA 4M2BA 2W0VA 3HSQA 5ADXV 1LXAA 4I7ZC 2OI6A 4MZUA 4PV1D 1KQGB 5L6VA 2V0KA 1HM8A 4EQYA 3S9OA 4G87A 3EH0A 4J18A 4AA7A 1DD3A 1SSQA 4GDOA 2RIJA 2YIUC 1Z90A 2NPOA 2WPVB 4HURA 1ZMEC 1QRLA 3OTZA 1QREA 1XHDA 4N6AA 3GMAA 2H88C 4U7JA 3VBMA 4N6BA 4M2AA 4R4MA 1EXIA 1SSTA 1ZP0C 3AE7C 1SSMA 4EA7A 2WLGA 2K9YA 4E79A 3SFEC 4YTPC 3RK3E 3D8VA 3R5DA 2FYNC 4OGQB 4Z1MH 1FDIA 1YP3A 3GVDA 2V0HA 2QKXA 4MYOA 5DEMA 3FS8A 3FOQA 1T3DA 1KHRA 2GGQA 3VBJA 4R4LA 3Q2YA 2MKVA 1NYHA 3D98A 2OQQA 4KQLA 2WSCJ 5F42A 5L8RJ 1IK7A 2E75B 2WLFA 4G3QA 1QRMA 4DCLA 1KK6A 4PV1B 3D6YA 1KQAA 5L6SA 2GGOA 3R5BA 3BFPA 4M28A 3VBPA 1MR9A 3H25A 1KRVA 1Q90D 3KWEA 2E74C 3ECTA 3LW5J 2H89C 3MC4A 1AJYA 3Q5SA 3Q1MA 4IHFA 2FKOA 1XATA 3R8YA 1GMJA 4YXDC 2JF2A 3HJJA 2NZ2A 3GUEA 1VF5C 2G3AA 1KK4A 4E1KA 1V3WA 3R5CA 3KWCA 1V67A 2ZT9D 3O6QA 3SRTA 3AE6C 1MRLA 1FXJA 3R3RA 3BXYA 3OW5A 1PV3A 1TU3F 2XATA 3C8VA 2V7QJ 2FBWC 2TDTA 5U2KA 4KT0J 3TDTA 5ADXU 3G9RA 3IAOA 3VBLA 1G97A 4IL6X 1QRFA 1OCXA 3R2WA 1J2ZA 3Q3DA 2IU9A 4EGGA 3TV0A 2JF3A 1G95A 1YP4A 1KK5A 2QIVX 1DD4A 3FTTA 4H44C 3FGAD 4RKUJ 4TT3H 4ISXA 3AEBC 1THJA 3SPTA 3JQYA 1HF9A 2W0WA 4H13C 4E6UA 3D70A 2IC7A 4J09A 4M98A 4R7PA 3IGJA 3VBNA 1KGTA 1QQ0A 2E76C 3R0SA 1KMIZ 5M1BA 2QJPC 1PIXA 4G3PA 2JP3A 3Q1XA 3Q5PA 3AEFC 2AQ9A 1OMIA 1HJ0A 3GLMA 2V0LA 1S5LX 4EAAA 1QRGA 4EABA 2WSEJ 3BSSA 2BEQD 3VBIA 1NGMB 2ZT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  3MQH A;  4G87 A;  2ICY A;  2O01 J;  4I7Z B;  2JF2 A;  3HJJ A;  3EH0 A;  4J18 A;  3GUE A;  4AA7 A;  1KK4 A;  1SSQ A;  4E1K A;  1V3W A;  2RIJ A;  3OTM A;  4IHG A;  2YIU C;  1Z90 A;  2NPO A;  2WPV B;  3F1X A;  4HUR A;  5E3Q A;  4E75 A;  3R5C A;  1QRL A;  3CJ8 A;  3FSC A;  4KNR A;  3KWC A;  3FSX A;  1V67 A;  2OI7 A;  1QRE A;  1XHD A;  3OTZ A;  4N6A A;  1HV9 A;  4KPX A;  4N69 A;  1VF5 B;  3VBM A;  2V0J A;  3SRT A;  1MRL A;  1FXJ A;  3R3R A;  3BRK X;  3BXY A;  4G3S A;  4N6B A;  1KRU A;  3OW5 A;  1HM0 A;  3P1B A;  4M2A A;  3OUP A;  4R36 A;  1SST A;  2XAT A;  3OU9 A;  3C8V A;  2VHE A;  4KNX A;  3TIO A;  1MR7 A;  2WLD A;  1JB0 J;  3TIS A;  3BSY A;  3I3A A;  2TDT A;  5U2K A;  4M9C A;  4E6T A;  2OEG A;  4M99 A;  1SSM A;  4EA7 A;  4N27 A;  4KT0 J;  4H0L B;  3TDT A;  5ADX U;  2WLG A;  2K9Y A;  3DJ4 A;  3EG4 A;  4E79 A;  3TK8 A;  3D8V A;  3BSW A;  3R5D A;  2QIW A;  2FYN C;  4HZC A;  4OGQ B;  3P47 A;  2VD4 A;  3VBL A;  3KWD A;  3PMO A;  5KKZ C;  1G97 A;  4IL6 X;  2IU8 A;  1QRF A;  3IXC A;  3R1W A;  4HCQ A;  4HZD A;  1OCX A;  3FSY A;  3R2W A;  4AC3 A;  1J2Z A;  1YP3 A;  2P2O A;  2QSI A;  3GVD A;  2V0H A;  3VBK A;  2IU9 A;  3MQG A;  3VNP A;  2QKX A;  1ZRT E;  4EGG A;  3TV0 A;  2JF3 A;  4MYO A;  1G95 A;  5DEM A;  2QJY C;  2QJK C;  1YP4 A;  2Q4J A;  2V0I A;  3FSB A;  3FS8 A;  3FOQ A;  2QIA A;  4FCE A;  1KK5 A;  1TDT A;  2OEF A;  2QIV X;  3V4E A;  4EA8 A;  4R37 A;  1S80 A;  1T3D A;  1KHR A;  2I5K A;  3FTT A;  2ICX A;  3NZ2 A;  4IHH A;  4RKU J;  4ISX A;  5KLI C;  1THJ A;  3SPT A;  2GGQ A;  3VBJ A;  3JQY A;  2WSF J;  2W0W A;  5AFU V;  4AAW A;  1FWY A;  2OI5 A;  4EA9 A;  4H44 B;  1YP2 A;  4E6U A;  2IC7 A;  4Y28 J;  2IUA A;  3D98 A;  2WLE A;  4J09 A;  4KQL A;  2WSC J;  5F42 A;  4M98 A;  4R7P A;  5L8R J;  2E75 B;  2WLF A;  3EEV A;  1QRM A;  1KGT A;  3IGJ A;  1KK6 A;  4G3Q A;  1QQ0 A;  4HUS A;  3VBN A;  4PV1 B;  1HM9 A;  4H13 B;  3DHO A;  3GOS A;  3ST8 A;  1KQA A;  3R0S A;  5L6S A;  5AFU U;  3FWW A;  2GGO A;  1KGQ A;  2QJP C;  1KRR A;  4G3P A;  3R5B A;  3BFP A;  3Q1X A;  4K6R A;  3I3X A;  4M28 A;  5DEP A;  3T57 A;  5E3R A;  2D2C B;  3R5A A;  3VBP A;  2AQ9 A;  2V0L A;  2E76 B;  3DK5 A;  1MR9 A;  3R3I A;  4H7O A;  5E3P A;  1S5L X;  1KRV A;  1Q90 D;  1QRG A;  2WLC A;  3KWE A;  4M2B A;  4EAB A;  2W0V A;  4EAA A;  2WSE J;  3BSS A;  3ECT A;  3HSQ A;  3LW5 J;  3TWD A;  3MC4 A;  1LXA A;  3VBI A;  5ADX V;  2OI6 A;  4MZU A;  4MFG A;  4DCL A;  2ZT9 B;  4IHF A;  2FKO A;  5L6V A;  1XAT A;  2V0K A;  5DG3 A;  1HM8 A;  3R8Y A;  4KPZ A;  4EQY A; 
#chains in the Genus database with same CATH topology
 4IL6 H;  1L0N G;  1K04 A;  1JO5 A;  1YYC A;  2AXT H;  3FWL A;  1QVG O;  3L35 A;  1M57 D;  1K9M Q;  4XFJ A;  1OW8 A;  3TGU G;  4B86 A;  4C7N B;  1NTZ E;  2V0J A;  1GDT A;  2HR3 A;  4XE5 B;  1SQV D;  2RKL A;  1KRU A;  1OIP A;  3PLN A;  4GKG A;  2FYU K;  3O8Z A;  2M0B A;  2Z4E A;  1AQ5 A;  2HFE D;  2N9Y B;  4NPD A;  2O01 H;  1NTM G;  1JNM A;  1IFP A;  2QIW A;  3H1K J;  4HZC A;  2B88 A;  2VD4 A;  5APV A;  3PMO A;  1SQV E;  2QSI A;  2P2O A;  3H1L J;  2V0I A;  2QIA A;  2OEF A;  1RF0 A;  3AE1 C;  2M8R A;  4IHH A;  5DJU B;  1IFJ A;  1BSH A;  1JEK A;  2WPQ A;  2Y0D A;  3L71 J;  5AFU V;  2G8Y A;  2HOD A;  2IUA A;  1KFM A;  3M0D C;  1G2C A;  2IX7 C;  4IFM A;  1UIX A;  5B66 H;  2NPS B;  3DHO A;  1SQX D;  1M1J C;  1M1K Q;  3B71 A;  3RK3 C;  2D2C B;  1EC5 A;  1FDM A;  2IZ0 A;  1SQB J;  3TWD A;  4MFG A;  3V2R A;  2IYP A;  2Z5I A;  1EDJ A;  2E74 B;  2WMM A;  1SQX E;  1X0T A;  2ZYD A;  3WUV A;  1RF1 A;  4DZO A;  2KOG A;  4NPE A;  3IFM A;  3CX5 D;  3SFD C;  1GW4 A;  3I56 P;  3NFQ A;  1LTI C;  4XA4 A;  3KQG A;  1KIL A;  3LID A;  2H8P D;  2M5A B;  1OVR A;  2QG4 A;  1HM0 A;  1LWU A;  1G2C B;  4PD4 D;  2M3B A;  5C39 A;  1PP9 G;  4M9C A;  4M99 A;  4H0L B;  1JY2 N;  2W6J H;  3AEE C;  3CX5 E;  1PL5 A;  1NTZ J;  2WQY C;  2CPS A;  3VN0 A;  2W8Z A;  3D6Z A;  1EDL A;  2IU8 A;  1BCC G;  1Z56 A;  1OXZ A;  2N1T A;  4PD4 E;  2P7J A;  4N3Y B;  5KLV K;  3V4E A;  3OA7 A;  2FYZ A;  2I5K A;  1J1E B;  2KB7 P;  1RF1 B;  1GK4 A;  1KV4 A;  3RL0 B;  4AAW A;  2BEZ F;  1IFI A;  1NVO A;  1L0N K;  4EA9 A;  2XDJ A;  2JWA A;  1SQV J;  1ZN5 A;  4Y28 J;  3AEG C;  1MFT A;  3E1I A;  1LTJ A;  1HUC A;  4HUS A;  1L0L E;  4H13 B;  4EOT A;  1SQQ G;  2AEM A;  3G4S P;  1IC2 A;  1KRR A;  1KB9 I;  3DK5 A;  4M2B A;  2W0V A;  1NTK G;  3HSQ A;  1H89 A;  2KNC A;  2LKM A;  4C46 A;  5ADX V;  2OI6 A;  3HUS A;  5KAF H;  2V0K A;  4IOI H;  4EDF A;  5CCG D;  1NTM K;  1NU1 G;  2N1T B;  1N73 A;  2AEF A;  2QEX P;  1JCC A;  3NXS A;  2WIT A;  1WT6 A;  2RIJ A;  5AW3 B;  3HRN A;  1QRE A;  1XHD A;  5CCH A;  3F89 A;  3RK2 B;  3VMZ A;  5E79 E;  1M8O B;  5GTI E;  3L74 D;  2OYH A;  2WTY A;  4N6B A;  1PZQ A;  1SQX J;  1EXI A;  1SST A;  1ZP0 C;  1LTJ B;  1SSM A;  5K5G B;  4QMA A;  4E79 A;  3D8V A;  1URQ A;  4OGQ B;  4DT0 A;  2XNX A;  3L74 E;  1Q82 Q;  2KNC B;  2V0H A;  4IL6 E;  3U1C A;  1RE4 A;  3HUS B;  3FS8 A;  2KP8 A;  1NO4 A;  1N2D C;  2IZ1 A;  1T3D A;  4WY4 A;  2AXT E;  1QVF O;  3H1K G;  2QJK B;  3VBJ A;  1IFN A;  2GUV A;  2IYO A;  2Y0E A;  2E5Y A;  1JY3 O;  3WU2 H;  2R3S A;  2QA4 P;  5F42 A;  2I1K A;  2OYH B;  1FZB A;  4PV1 B;  4L75 A;  1KQA A;  2ZYG A;  1J2J B;  3L71 G;  2ZXX A;  1NAF A;  1VQ7 P;  3KWE A;  2E74 C;  2DW3 A;  3LW5 J;  1URQ B;  5KAI E;  1JTH A;  3CCJ P;  1RHZ B;  2R44 A;  4IFF A;  1RF0 C;  1HH0 A;  1XAT A;  1N86 A;  1L0L J;  3GG2 A;  3JCU H;  1VPC A;  4C7R A;  5CHX A;  3OGZ A;  2NZ2 A;  2C9L Y;  1KZU B;  4JF7 A;  4WY4 B;  1SQB G;  3OAK A;  3KWC A;  4KJM A;  2YKP A;  2OTJ P;  3O6Q A;  5BVZ A;  3CL3 D;  1MRL A;  5B66 E;  3W67 A;  3BXY A;  4AQR D;  1H88 A;  1CSB A;  1SQP J;  1CI6 B;  3H1I D;  4UB8 H;  2TDT A;  1BSN A;  5ADX U;  3G9R A;  3CX5 I;  3IAO A;  1G97 A;  1QRF A;  1SFC A;  1OCX A;  1SQQ K;  1JTH B;  2JF3 A;  3SSU A;  3M9B A;  1RF1 C;  2Q9I A;  1JY2 O;  3RL0 C;  2QIV X;  3FTT A;  1NTK K;  2WPR A;  2V7Q H;  4RKU J;  1DX7 A;  1THJ A;  3SPT A;  1T3J A;  3II6 A;  5APT A;  1HF9 A;  3SWF A;  1M1J A;  1KIL D;  2I1J A;  4H13 C;  1NU1 K;  3L74 J;  4E6U A;  1LWU C;  1ZW0 A;  1JY2 P;  3D70 A;  2IC7 A;  1IFM A;  3O6Q B;  2B89 A;  1QL2 A;  3CME P;  2YKO A;  2J58 A;  1FJK A;  2XKM A;  2R5D A;  1VDF A;  1EDK A;  1YHQ P;  3OH3 A;  5KTB A;  2E42 A;  1GL2 D;  1HJ0 A;  2V0L A;  1PGP A;  1SQV G;  1QRG A;  2N1T C;  1FE6 A;  2YXQ B;  3VBI A;  1X8Y A;  2ZT9 B;  1SFC B;  1NH4 A;  3RK2 C;  3HE4 B;  2O01 J;  5AW9 B;  5CJ0 A;  1JUN A;  2MJZ A;  2L5G B;  2BCC D;  3PJS K;  2V4H A;  4W80 A;  2L91 A;  1FS0 E;  1Q2N A;  2JJL A;  3KZI H;  1GD2 E;  1GU5 A;  3CCR P;  1LTJ C;  2B87 A;  2WSE H;  3V2N A;  3BRK X;  3ITK A;  1M56 D;  4R36 A;  1JB0 J;  3TIS A;  3I3A A;  4OGQ C;  4PD4 H;  2BCC E;  5EFW B;  2ZVO B;  2FXO A;  2UWJ E;  3JSV C;  3TK8 A;  3BSW A;  3HUS C;  4L74 A;  1IZN B;  1SQX G;  5KAF E;  3MQG A;  1ZRT E;  3A0H H;  3MP7 B;  5AW2 B;  2FYN B;  2P2U A;  2QJK C;  3FSB A;  3RL0 g;  4I1L A;  5CCH C;  1BE3 E;  1NJI Q;  3MIW A;  1KFN A;  3CWB G;  2OYH C;  2OI5 A;  1BDD A;  4PV1 C;  1XTG B;  1YP2 A;  2FKW B;  1Y9B A;  3QH9 A;  2W6A A;  1SQB K;  3ST8 A;  3GOS A;  3A7O A;  2PP6 A;  1AA0 A;  3BRV B;  1URQ C;  3T57 A;  4H44 D;  1XTC C;  2OTL P;  1KQF B;  3GF7 A;  3M06 A;  4C7N A;  1EQ7 A;  1RE4 C;  2WSF H;  1W2B O;  3L75 E;  1BGY D;  2P10 A;  3BVH A;  5GTI H;  4WY4 C;  1T8Z A;  5TIS H;  1VQP P;  4KPZ A;  2ICY A;  3CD6 P;  1LP1 B;  2IBZ E;  3K5B A;  3OW2 O;  2A06 E;  4E75 A;  1OFC X;  1R8E A;  1WMK A;  4N69 A;  3WU2 E;  1VF5 B;  1L0L G;  1FC2 C;  1BGY E;  1PGJ A;  4EYY Q;  3LIE A;  3GF3 A;  4EI2 A;  4ZKP A;  3FX0 A;  3GQ9 A;  2O01 N;  3VP9 A;  3DJ4 A;  2NRG A;  3NMD A;  5APU A;  1ZXG A;  3IXC A;  1SQP G;  4AC3 A;  3JCU E;  1SS1 A;  3CXH D;  2NPS A;  1LGH B;  1SQV K;  4LLH A;  1S80 A;  5KJ7 A;  1N8R Q;  2OYI B;  2J5U A;  1FZG A;  2H43 A;  5DJT B;  1Z2F A;  3VTP C;  5APS A;  2FYU D;  4ASW A;  5KAI H;  4HKZ H;  3BCC D;  4UB8 E;  1JY3 N;  1BE3 J;  1KGQ A;  1DEE G;  4GOD A;  5AVR B;  1YQ4 C;  2ZT9 C;  4NPF X;  3L74 G;  5AVY B;  2E76 B;  1SFC C;  3A5T A;  2KLV A;  2QJP B;  2HPC A;  1K8A Q;  5APQ A;  3L72 D;  4MZU A;  2M5A A;  3BCC E;  1ZR4 A;  1HM8 A;  3S9O A;  3MUD A;  4I6M C;  4AA7 A;  2HLO A;  1DD3 A;  1SSQ A;  4GDO A;  3M9Q A;  1SQX K;  4HUR A;  3RK3 D;  3SWY A;  3L75 J;  3HD7 A;  4GOF A;  4L73 A;  3VBM A;  1L4A B;  2OAR A;  1VQM P;  4BXL A;  5BU8 B;  3H1J J;  2ZJS E;  2W6B A;  1VQ6 P;  3AE7 C;  3V4Q A;  3PRJ A;  1MV8 A;  3RK3 E;  3OH0 A;  1H8A A;  2FYN C;  1ZLL A;  1BGY J;  4ZNC A;  1FDI A;  1LT1 A;  4U3F D;  5APY A;  2HPC B;  5DEM A;  3V2Q A;  2KIK A;  2GM4 A;  3PTZ A;  2VRS A;  1KHR A;  3MZW B;  1MFZ A;  3H1H D;  1S2E A;  4D6T D;  2QJY B;  2GGQ A;  3KZI E;  1FOS E;  5CBN A;  1P84 D;  1PGO A;  3Q2Y A;  4EIJ A;  4U3F E;  3HD7 B;  4KQL A;  2ITA A;  1YJ9 P;  1USE A;  3HTK A;  1NHL A;  2WLF A;  4G3Q A;  4DCL A;  1KK6 A;  3OH2 A;  4L76 A;  3B8E B;  3H1H E;  3R5B A;  1L0L K;  3BFP A;  4YXW H;  1MR9 A;  3H25 A;  1Q90 D;  3I5C A;  2H89 C;  3MC4 A;  1AJY A;  1SLQ A;  3Q5S A;  1GZL A;  5KLV D;  3A0H E;  2FKO A;  3VMX A;  2IBZ I;  3C1L A;  1GMJ A;  2QM7 A;  3BAS A;  2WSC H;  2P67 A;  3HJJ A;  4JYC A;  2N9B A;  2B9B A;  1VF5 C;  2G3A A;  5CJ4 A;  1VQ4 P;  1KK4 A;  1L0N D;  1SQP K;  1V67 A;  3CMA P;  3BAT A;  4LGD E;  3BCC J;  4M3L A;  1FXJ A;  3MGN A;  2YNY A;  1JOC A;  1PGQ A;  1HBW A;  5AW4 B;  1PPJ D;  1TU3 F;  2A45 I;  2XAT A;  2V7Q J;  2FBW C;  3TF5 A;  3HTK B;  1WRG A;  3KYQ A;  1L0N E;  3TNU B;  4A7P A;  5AW1 B;  1M90 Q;  3OH1 A;  4UB6 H;  2YO2 A;  1DH3 A;  1NTM D;  5TIS E;  2R3C A;  2IU9 A;  1PPJ E;  5AVS B;  1Q86 Q;  4KHX A;  4BRY A;  1NWQ A;  2KSE A;  4ISX A;  1IFD A;  3QWO C;  4HJG H;  3JQY A;  2W0W A;  1HWT C;  1GTW A;  1N7S A;  3VBN A;  3H32 A;  2E76 C;  3FXD A;  3U59 A;  1KMI Z;  1YJN P;  2QJP C;  3TK1 A;  3T97 A;  1YTZ I;  4G3P A;  3Q1X A;  1RE3 A;  1J1D B;  3OJA B;  4K3A A;  1OMI A;  2AQ9 A;  2WVR A;  1S5L X;  4EAB A;  3C9I A;  2WSE J;  1OVU A;  2BEQ D;  2NPS C;  4U3F J;  3L37 A;  2NPS D;  3H1L G;  1OVV A;  1FJP A;  1BE3 G;  1CI6 A;  5KJ7 C;  2D2C C;  3MQH A;  1HGV A;  3CLQ A;  3IN6 A;  2D2C D;  1FBM A;  4I7Z B;  3H1H J;  2CK3 H;  2K88 A;  4O9B A;  3AE3 C;  4IHG A;  4OWF A;  1JY3 P;  1VL2 A;  4BRY B;  1Q81 Q;  3FSC A;  3FSX A;  2OI7 A;  1HV9 A;  4KPX A;  1PFI A;  3A0B H;  1LTS C;  1KOR A;  1JCD A;  2E74 D;  2K3R A;  3A2A A;  2QRX A;  4YPC A;  3PHL A;  2WLD A;  1N7S B;  2Q3E A;  4BWN A;  3BSY A;  3H32 B;  1KYO D;  4AYC A;  2O3J A;  4N27 A;  2KK7 A;  1RQV A;  3T97 B;  1ZV8 A;  3L75 G;  1PP9 D;  1YIT P;  1N4I A;  4N6J A;  3GHG A;  3H1J G;  3MUD C;  4DJG A;  2IBZ G;  1S5L H;  2A06 G;  4H0L C;  2ZAE B;  2QJY C;  3TIO A;  1T3U A;  3AE5 C;  1W2E A;  4EA8 A;  4H0L D;  4FCE A;  3CXH H;  3G3Z A;  1L0N J;  3AEA C;  3TDK A;  1QL1 A;  2XV5 A;  3HD7 C;  1RH5 B;  1PP9 E;  1BGY G;  1YBK A;  5AVW B;  2WSF J;  3CC2 P;  3FWN A;  1X22 A;  3ABV C;  4PD4 I;  1J1E C;  2A45 G;  1QLE D;  3EEV A;  1KC8 Q;  3HE4 A;  3H1I E;  3FWW A;  4JYB A;  3RL0 D;  1E5W A;  3KXD A;  3R5A A;  1NTZ G;  2IDB A;  1SQQ D;  4ASV A;  1LT9 A;  4H13 D;  3CCQ P;  3GHG B;  5DG3 A;  4LC1 A;  3EWK A;  3V6I A;  1T2K C;  3AEC C;  2W83 C;  5AW5 B;  2E5T A;  1OWA A;  1A02 J;  5E3Q A;  3F1X A;  1NU1 D;  1EZV D;  1U7M A;  1DIP A;  3CJ8 A;  4HYT B;  1RY3 A;  2Q7C A;  1ZOY C;  5GTH H;  2JDI H;  5AW0 B;  1KIL E;  3P7K A;  2N1T D;  3AE9 C;  1AFO A;  1VQO P;  2Y9Z A;  4KNX A;  1MR7 A;  1QX8 A;  1E79 H;  4WWI A;  2OEG A;  1FZE A;  3RK2 D;  1NU1 E;  1EZV E;  1KQL A;  3EG4 A;  1K05 A;  1LNQ A;  1AV1 A;  3U1A A;  3Q5R A;  3KWD A;  4HZD A;  3R1W A;  3VBK A;  3W68 A;  1LT9 B;  2IFN A;  1TDT A;  4R37 A;  1YQ3 C;  2AXC A;  2ICX A;  4OVN F;  4OGQ D;  1JMM A;  1FOS F;  1FWY A;  2R32 A;  1P84 H;  1FDO A;  3AE8 C;  4W7Y A;  3N4X A;  3SWK A;  1J1D C;  1LTG C;  1HGZ A;  2JR8 A;  1BDC A;  1LP1 A;  3CPW O;  4JQ0 D;  2C0X A;  1FZF A;  4K6R A;  5CCH D;  5AW8 B;  1SP4 A;  1RQU A;  3P32 A;  5AVV B;  4UB6 E;  3R3I A;  2WLC A;  2KS1 B;  3L71 D;  3VYI A;  2GA1 A;  4I7Z C;  1KQS O;  2SPZ A;  4PV1 D;  1KQG B;  3H1I J;  1G1I A;  2KUB A;  2W27 A;  2Q1K A;  3FXE A;  2JEE A;  1Z90 A;  1ZME C;  1URQ D;  3OTZ A;  3M0A A;  3GMA A;  4K35 A;  3TYY A;  2H88 C;  1LTB C;  1N7S C;  3CCE P;  1SQB D;  1RE3 C;  4WY4 D;  1FAV A;  3GQA A;  2OYI A;  1DEB A;  3CCM P;  1LTA C;  3SFE C;  4YTP C;  3R5D A;  1KB9 D;  1S9K D;  2Y9Y A;  4Z1M H;  3GVD A;  1HTL C;  3E1R A;  2QVA A;  1FZC A;  2IFM A;  3FOQ A;  1NTZ K;  5KKZ B;  4GT1 A;  1NU1 J;  2FFD A;  1AVO A;  3A0B E;  3G71 P;  1FZA A;  2ZFC A;  2WT7 A;  1NYH A;  2KZI A;  2WSC J;  5L8R J;  2E75 B;  2PGD A;  3L70 D;  1QRM A;  1LJ2 A;  1U7J A;  5L6S A;  2POH A;  2BCC J;  1A02 F;  3VBP A;  2W90 A;  2K9J B;  3GHG C;  1H0T A;  1KRV A;  3ECT A;  1L4A A;  1PPJ G;  3WUU A;  1S5L E;  2XU6 A;  4W7Z A;  3Q1M A;  4IHF A;  4AUW A;  3L70 E;  3CXH E;  1EDI A;  2R5B A;  2JF2 A;  1FZC B;  4E1K A;  3R5C A;  2FFD B;  2ZT9 D;  1SFC D;  1GW3 A;  5H2F H;  3AE6 C;  2FYU E;  3R3R A;  2WT7 B;  3OW5 A;  5AVQ B;  1Y8A A;  3M91 A;  1EZV I;  3V5B A;  4KT0 J;  3TDT A;  4Y99 B;  1KYO H;  3ZDM A;  2KSJ A;  1LT9 C;  2J59 M;  3RGU A;  4RO0 A;  1H0T B;  3G6E P;  3L72 E;  1J2Z A;  4EGG A;  1G95 A;  1KK5 A;  3SUC A;  3UIA A;  3OH4 A;  2ZYA A;  1X79 B;  1CW5 A;  3RBX A;  2OGU A;  5GTH E;  3CCL P;  1EWW A;  3MHV A;  1YIJ P;  4JBZ A;  1KN7 A;  1OX3 A;  5KLI B;  3CWB D;  1LTT C;  4M98 A;  4R7P A;  3KDP B;  1KGT A;  4GOE A;  5M1B A;  1YI2 P;  3AEF C;  1L0S A;  3PH0 A;  3GLM A;  4EAA A;  4HB1 A;  1L2P A;  4JPZ B;  3BSS A;  3CCU P;  2HOD B;  1AQT A;  1VQK P;  3CWB E;  3L73 D;  5AVU B;  3B5N A;  1Y47 A;  2PRR A;  5TJH A;  1R5L A;  3TNU A;  5AW6 B;  3OTM A;  3S1K A;  1UII A;  4D6T E;  3VMA A;  4DCK A;  1OW7 A;  1MKM A;  1GL2 A;  1P84 E;  3V2P A;  2M3E A;  1K73 Q;  3H1I G;  2YIU B;  3L36 A;  2IPP A;  3L70 J;  3L73 E;  2ZXE B;  4G3S A;  2YMK A;  3P1B A;  3AED C;  3OUP A;  1L0L D;  2FXP A;  3OU9 A;  2VHE A;  5APX A;  4E6T A;  2QM8 A;  3PP5 A;  1T6A A;  1VF5 D;  3AE2 C;  2WZ7 A;  2PAJ A;  3P47 A;  1VQ5 P;  5KKZ C;  1G1J A;  2FYU J;  4WB4 A;  4HCQ A;  2OYO A;  2Q5U A;  5KLV E;  3D71 A;  1ZR2 A;  1KIL B;  2AEJ A;  2BAS A;  3TGU D;  1SQP D;  1LWU B;  4MN4 C;  1U57 A;  3NTN A;  3B5N B;  4WVZ A;  5APW A;  2H7H A;  2E75 C;  2E75 D;  3L72 J;  1USD A;  1GL2 B;  5B5E H;  2JO1 A;  3N7N A;  5CCG C;  3HE5 A;  2YKQ A;  3TGU E;  1SQP E;  1EZV G;  4HH2 A;  2OYI C;  1HM9 A;  5AFU U;  4GIF A;  5E3P A;  4H7O A;  2Q6Q A;  1S3J A;  1JM0 A;  1NTM E;  3CXH I;  1FZC C;  1KTM A;  1HVV A;  2BCC G;  1OZH A;  5AVZ B;  3R2P A;  2FFD C;  2E76 D;  1Q7Y Q;  1MUU A;  2XZR A;  2RMZ A;  4PJ0 E;  3R4Y A;  4KNR A;  2FXM A;  1EXJ A;  3RBZ A;  3CWB J;  2KZJ A;  4DOJ A;  3AE4 C;  2WWW A;  4Y99 C;  2O1K A;  3VMY A;  3HE5 B;  1GU4 A;  3MTU E;  3P8C D;  5KJ7 D;  1CZQ A;  3IR9 A;  1N73 B;  2Q3I A;  4D6T J;  5BU5 A;  1L4A C;  1VQ8 P;  1L4A D;  2K1A A;  3CI9 A;  2CPB A;  1OW6 A;  3EQ2 A;  3L73 J;  1KB9 H;  3FSY A;  3VNP A;  3L4F A;  3WUT A;  3P8C E;  2Q4J A;  2E43 A;  2KI7 B;  2O1J A;  3S4R A;  1VQN P;  3NZ2 A;  2A45 H;  5KLI C;  1MZ9 A;  1S72 P;  1GK6 A;  2QE7 H;  4H44 B;  5H2F E;  5KLV J;  2OTK E;  2WLE A;  1S1C X;  1SVF A;  1S4X A;  1BCC D;  1KYO E;  5DEP A;  3I3X A;  5E3R A;  1N7L A;  3EFG A;  1NAY A;  3HD7 D;  4OH8 B;  2P1J A;  2KYV A;  1NOH A;  3I55 P;  1LXA A;  3KPE A;  3TGU J;  5L6V A;  4I2L C;  1R5S A;  4EQY A;  4G87 A;  4TLF A;  4ZMD A;  2C9N Y;  1BCC E;  3EH0 A;  4J18 A;  3V4W A;  2YIU C;  4N78 D;  2NPO A;  2WPV B;  3WMM 0;  1QRL A;  1P84 I;  4N6A A;  1NKZ B;  1NTM J;  1AVY A;  4U7J A;  2GUS A;  4M2A A;  1YTZ T;  4R4M A;  1NTK D;  2JKV A;  2I8D A;  4RES B;  4RJT A;  3GQ8 A;  2FY8 A;  3M0D A;  1T2K D;  4EA7 A;  3KHU A;  4N78 E;  1VQL P;  1M7L A;  2K9Y A;  2WLG A;  2YMY A;  1KIL C;  3VP8 A;  1SQQ E;  2PFX A;  4ZKU A;  3L70 G;  3B5N C;  3GQ7 A;  1YP3 A;  3JC2 2;  5AW7 B;  3B5N D;  3CCV P;  2QKX A;  1FU1 A;  1NTK E;  4MYO A;  3MD0 A;  2KXP B;  1NKN A;  3USS A;  1GL2 C;  2RH0 A;  2KS1 A;  4R4L A;  1JMB A;  2FYU G;  3BCC G;  2MKV A;  3D98 A;  2OQQ A;  2WPS A;  3A3Y B;  2LXB A;  1IK7 A;  2K37 A;  5AVT B;  3D6Y A;  2HG5 D;  2GGO A;  2LR2 A;  3CC7 P;  4M28 A;  3L72 G;  3TSI A;  3P8M C;  1M8N A;  2JWD A;  3CX5 H;  1IJD B;  1M1J B;  3H1K D;  3RK3 B;  1ZRT D;  3R8Y A;  2LXC B;  3H1L D;  4YXD C;  3GUE A;  2YO3 A;  2YXR B;  1IK9 A;  1BE3 D;  1D7M A;  1V3W A;  1PP9 J;  3E7K A;  1X9V A;  2HYN A;  5B5E E;  3H1K E;  1HJB A;  2P58 A;  3CCS P;  1N73 C;  3H6P A;  3SRT A;  1IO4 A;  3LW5 H;  1QGK B;  1PV3 A;  1BCC J;  3C8V A;  2XND H;  3H1L E;  5U2K A;  1KD1 Q;  3CC4 P;  1W5C E;  2ZVN B;  4U3F G;  5AVX B;  3VBL A;  3L71 E;  4IL6 X;  3L75 D;  3M9H A;  3R2W A;  1N7S D;  2Y0C A;  2B87 B;  2RN0 A;  3Q3D A;  3TV0 A;  5CMZ A;  3H1H G;  1YP4 A;  1YJW P;  3GW6 A;  3H1J D;  4D6T G;  2IBZ D;  1DD4 A;  5CCG A;  5CBO A;  3VOP A;  3B4S A;  2A06 D;  2Z5H A;  4H44 C;  3FGA D;  4TT3 H;  3AEB C;  2K9J A;  1SQQ J;  1QEX A;  3L73 G;  4IFD K;  1SQB E;  1NTK J;  4J09 A;  5E79 H;  1VQ9 P;  3IGJ A;  3F5H A;  1QQ0 A;  1KYO I;  3H1J E;  3R0S A;  3EFF K;  1PIX A;  3BRT B;  2JP3 A;  3Q5P A;  5KLV G;  4PJ0 H;  2C0W A;  1KB9 E;  4CPG A;  1S9K E;  1NGM B;  2KLU A;  4WBA A;  1NTZ D;  2WSS H;  3IF4 A; 
#chains in the Genus database with same CATH homology
 2D2C C;  3MQH A;  1K04 A;  3IN6 A;  2D2C D;  2O01 J;  4I7Z B;  3AE3 C;  3OTM A;  4IHG A;  1VL2 A;  3FSC A;  3FSX A;  2OI7 A;  1HV9 A;  1OW7 A;  4KPX A;  1MKM A;  4XFJ A;  1OW8 A;  1KOR A;  2E74 D;  2V0J A;  3BRK X;  4G3S A;  2YMK A;  1KRU A;  3P1B A;  3AED C;  3OUP A;  4R36 A;  2FXP A;  3OU9 A;  2VHE A;  2WLD A;  1JB0 J;  3TIS A;  3BSY A;  3I3A A;  4OGQ C;  4E6T A;  4N27 A;  1RQV A;  1VF5 D;  3AE2 C;  3T97 B;  3TK8 A;  3BSW A;  2QIW A;  4HZC A;  3P47 A;  2VD4 A;  3PMO A;  5KKZ C;  4HCQ A;  3D71 A;  2P2O A;  2QSI A;  3MQG A;  1ZRT E;  4H0L C;  2QJY C;  2QJK C;  2V0I A;  3AE5 C;  3FSB A;  3TIO A;  4EA8 A;  4H0L D;  3RL0 g;  2QIA A;  2OEF A;  4FCE A;  3AE1 C;  1U57 A;  3AEA C;  4IHH A;  2WSF J;  2E75 C;  5AFU V;  2OI5 A;  2G8Y A;  4PV1 C;  2E75 D;  1YP2 A;  3ABV C;  2IUA A;  2JO1 A;  1Y9B A;  1UIX A;  3EEV A;  1HM9 A;  3DHO A;  3GOS A;  3ST8 A;  5AFU U;  3FWW A;  3T57 A;  3B71 A;  2D2C B;  4H44 D;  3R5A A;  1KQF B;  2IDB A;  5E3P A;  4H7O A;  3GF7 A;  3TWD A;  4MFG A;  4H13 D;  2P10 A;  1KTM A;  5DG3 A;  3EWK A;  4KPZ A;  2E74 B;  2ICY A;  3AEC C;  2E76 D;  5E3Q A;  3F1X A;  4E75 A;  3R4Y A;  3CJ8 A;  1DIP A;  4KNR A;  1R8E A;  1ZOY C;  1EXJ A;  3SFD C;  1WMK A;  4N69 A;  1KIL E;  1VF5 B;  3AE9 C;  3GF3 A;  3AE4 C;  1HM0 A;  4KNX A;  1MR7 A;  4M9C A;  2OEG A;  4M99 A;  4H0L B;  3DJ4 A;  3EG4 A;  1K05 A;  3AEE C;  1PL5 A;  2WQY C;  1OW6 A;  3Q5R A;  3KWD A;  3D6Z A;  4HZD A;  3IXC A;  2IU8 A;  3R1W A;  3FSY A;  4AC3 A;  3VNP A;  3VBK A;  2Q4J A;  1TDT A;  3V4E A;  4R37 A;  1YQ3 C;  1S80 A;  2I5K A;  2ICX A;  3NZ2 A;  4OGQ D;  5KLI C;  4AAW A;  2J5U A;  1FWY A;  2BEZ F;  4EA9 A;  4H44 B;  1FDO A;  4Y28 J;  3AE8 C;  2WLE A;  1S1C X;  3AEG C;  4HUS A;  4H13 B;  1KGQ A;  1KRR A;  4K6R A;  3I3X A;  5DEP A;  1YQ4 C;  5E3R A;  2ZT9 C;  1RQU A;  2E76 B;  3DK5 A;  3R3I A;  2WLC A;  4M2B A;  2W0V A;  3HSQ A;  5ADX V;  1LXA A;  4I7Z C;  2OI6 A;  4MZU A;  4PV1 D;  1KQG B;  5L6V A;  2V0K A;  1HM8 A;  4EQY A;  3S9O A;  4G87 A;  3EH0 A;  4J18 A;  4AA7 A;  1DD3 A;  1SSQ A;  4GDO A;  2RIJ A;  2YIU C;  1Z90 A;  2NPO A;  2WPV B;  4HUR A;  1ZME C;  1QRL A;  3OTZ A;  1QRE A;  1XHD A;  4N6A A;  3GMA A;  2H88 C;  4U7J A;  3VBM A;  4N6B A;  4M2A A;  4R4M A;  1EXI A;  1SST A;  1ZP0 C;  3AE7 C;  1SSM A;  4EA7 A;  2WLG A;  2K9Y A;  4E79 A;  3SFE C;  4YTP C;  3RK3 E;  3D8V A;  3R5D A;  2FYN C;  4OGQ B;  4Z1M H;  1FDI A;  1YP3 A;  3GVD A;  2V0H A;  2QKX A;  4MYO A;  5DEM A;  3FS8 A;  3FOQ A;  1T3D A;  1KHR A;  2GGQ A;  3VBJ A;  4R4L A;  3Q2Y A;  2MKV A;  1NYH A;  3D98 A;  2OQQ A;  4KQL A;  2WSC J;  5F42 A;  5L8R J;  1IK7 A;  2E75 B;  2WLF A;  4G3Q A;  1QRM A;  4DCL A;  1KK6 A;  4PV1 B;  3D6Y A;  1KQA A;  5L6S A;  2GGO A;  3R5B A;  3BFP A;  4M28 A;  3VBP A;  1MR9 A;  3H25 A;  1KRV A;  1Q90 D;  3KWE A;  2E74 C;  3ECT A;  3LW5 J;  2H89 C;  3MC4 A;  1AJY A;  3Q5S A;  3Q1M A;  4IHF A;  2FKO A;  1XAT A;  3R8Y A;  1GMJ A;  4YXD C;  2JF2 A;  3HJJ A;  2NZ2 A;  3GUE A;  1VF5 C;  2G3A A;  1KK4 A;  4E1K A;  1V3W A;  3R5C A;  3KWC A;  1V67 A;  2ZT9 D;  3O6Q A;  3SRT A;  3AE6 C;  1MRL A;  1FXJ A;  3R3R A;  3BXY A;  3OW5 A;  1PV3 A;  1TU3 F;  2XAT A;  3C8V A;  2V7Q J;  2FBW C;  2TDT A;  5U2K A;  4KT0 J;  3TDT A;  5ADX U;  3G9R A;  3IAO A;  3VBL A;  1G97 A;  4IL6 X;  1QRF A;  1OCX A;  3R2W A;  1J2Z A;  3Q3D A;  2IU9 A;  4EGG A;  3TV0 A;  2JF3 A;  1G95 A;  1YP4 A;  1KK5 A;  2QIV X;  1DD4 A;  3FTT A;  4H44 C;  3FGA D;  4RKU J;  4TT3 H;  4ISX A;  3AEB C;  1THJ A;  3SPT A;  3JQY A;  1HF9 A;  2W0W A;  4H13 C;  4E6U A;  3D70 A;  2IC7 A;  4J09 A;  4M98 A;  4R7P A;  3IGJ A;  3VBN A;  1KGT A;  1QQ0 A;  2E76 C;  3R0S A;  1KMI Z;  5M1B A;  2QJP C;  1PIX A;  4G3P A;  2JP3 A;  3Q1X A;  3Q5P A;  3AEF C;  2AQ9 A;  1OMI A;  1HJ0 A;  3GLM A;  2V0L A;  1S5L X;  4EAA A;  1QRG A;  4EAB A;  2WSE J;  3BSS A;  2BEQ D;  3VBI A;  1NGM B;  2ZT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...