3BRKX

Crystal structure of adp-glucose pyrophosphorylase from agrobacterium tumefaciens
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
412
structure length
395
Chain Sequence
QPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFRPERNESFDILPASWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural analysis of ADP-glucose pyrophosphorylase from the bacterium Agrobacterium tumefaciens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 107
structure length 395
sequence length 412
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3brkX02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3brkX01
4M99A 2GGQA 1GQCA 1HV9A 4YS8A 3BSYA 1O7OA 2WVKA 5C4DA 2PGVA 5FU0A 3T7MA 5C4FA 1S80A 4FRAA 3TDTA 1G23A 2RIYA 3SX7A 3I0LA 1SS9A 1WT2A 1MR7A 2WEEA 3CKQA 2JF3A 2BO6A 4FCUA 3BCVA 1G97A 1XZ6A 4E1KA 1TZFA 4EAAA 2V0JA 3OUPA 1R7UA 1O0RA 4EEMA 1KQAA 1R82A 4G3SA 2OI7A 3TISA 2OEGA 1VH3A 4FRPA 4CJ8A 3Q80A 3I3AA 2QIAA 3LW6A 4KQLA 1FGXA 5ADXV 1WSZA 2TDTA 2VS4A 2WLDA 1QRLA 3GUEA 2MZBA 1YP4A 3PMOA 2ZU7A 3E26A 5IFYA 4JD0A 1W55A 3BSSA 2VSHA 3Q7UA 1ZJ2A 1FO9A 3PKQA 3DJ4A 4C2SA 2I5KA 3F1XA 5EJZA 4EE4A 3SXAA 2XMEA 4M9CA 4LW6A 2RJ5A 2RITA 5C4CA 4Y7VA 3ZGFA 3C8VA 2JCLA 1VZTA 1PZYB 1XHBA 4R36A 2E3DA 4FCEA 1H7FA 3VBLA 4KPXA 4EQYA 2WVLA 3V8ZA 1GX0A 1QREA 3P47A 1JYLA 5HS2A 2IU9A 5CQNX 5DDVA 3V90A 3T7OA 1G93A 5C3AA 1FWYA 3U2XA 2O1GA 1OMZA 3OH1A 4FREA 5C36A 1H7TA 2FFVA 1TDTA 4HUSA 5C4EA 5E3RA 2IUAA 4E79A 5C1HA 1HJJA 4EE3A 4NALA 4HO6A 3VBNA 1THJA 2WLEA 3OW5A 5CMHA 4R7PA 1O23B 4JISA 1V3WA 4IRPA 4Y7GA 3U0YA 3D8VA 1QWJA 1INIA 3I3XA 3TWDA 2E8BA 3V0NA 4ARWA 1HM9A 1ZI1A 4D11A 1H7EA 3CKJA 1I52A 1KGTA 3R2WA 2AE7A 5FU8A 3ZLLA 1MP5A 4E6UA 1TVYA 1MRLA 3JUJA 1H5SB 2Y4LA 4MNDA 3V0OA 4MFGA 1JVDA 4N69A 1KHRA 1H3MA 3DUVA 1KGQA 4Y6UA 5C1LA 3BFPA 1QRGA 3D98A 4AA7A 2OI6A 1V82A 3O3PA 4P00A 4KC1A 1H7HA 1LZ0A 3CKVA 2P73A 3IOJA 1QQ0A 4M98A 3V0LA 3TQDA 4DDZA 1G9RA 2BO7A 2YQHA 5CQOA 5IDSA 1MR9A 1NHEB 4B42A 1JV1A 1VGUA 1ON6A 3IGJA 5DDTA 4FRHA 1LL0A 5CMFX 2Q4JA 1ZCVA 4Y7TA 1W77A 2V0LA 2X5ZA 1KRRA 1KK6A 2O1FA 5C4BA 2WLCA 1R7VA 4ASYA 3ST8A 5FV9A 5C8RA 3V91A 1VGWA 4FROA 1T3DA 3BSWA 3R5AA 4CJCA 4HO5A 5AJPA 4GBPA 1MC3A 2I7BA 1KK4A 5AJOA 1IINA 3TIOA 1FXJA 3I0HA 1OMXA 2IU8A 1W57A 5FUHA 2X5SA 1ZCTA 4D0TA 5ADXU 5CMGX 4IHFA 4DECA 4KC4A 3FSYA 2D7IA 4D0ZA 3I0KA 1V67A 2D7RA 1NMMB 2RJ0A 3GVDA 1H5SA 1VPAA 3SX8A 3OH2A 4LW3A 3R5BA 3R5DA 1H7QA 3TZTA 3OTZA 2ICXA 1H5TA 2RJ1A 1S4NA 3NZ2A 4Y64A 1SSMA 4AC3A 3U2UA 1LXAA 1J2ZA 3I0EA 2Z86A 1EYRA 3OAMA 1VGTA 3I0CA 3EG4A 3CGXA 4FRMA 1KRUA 5L6VA 1ZCYA 3P1BA 3K8DA 4N6AA 5C3BA 1JYKA 1VICA 5C49A 4XWIA 1FRWA 4J09A 1LZ7A 2A8WA 5DEPA 2Y4JA 1ZJPA 2JCJA 4B2WA 3JTJA 3R5CA 3F1CA 1FG5N 1TW5A 2OI5A 4BQHA 5IDTA 1E5KA 2QIVX 1R7TA 4EVWA 4HCQA 4HO4A 3SXGA 2DPWA 1JVGA 3R1WA 4EEOA 3IOHA 4DE7A 5C38A 1PZTA 2WLGA 3SX3A 3Q4SA 1KWSA 4HO3A 2AM4A 3GOSA 1H7LA 2Y4KA 1HM0A 2V0IA 2VS5A 5AFUV 2WLFA 1KRVA 4MYBA 4CVHA 3IXCA 5F42A 4G3PA 1G95A 2XMHA 1K4VA 1ZDFA 5E3PA 1NF5B 1V83A 2XWLA 2ZU9A 4P02A 2W0VA 1MP4A 4IHGA 3OKRA 5L6SA 5C47A 1R7YA 3HJJA 1EZIA 1YP2A 3PKPA 3BXYA 3V0MA 3RMVA 1FGGA 1FR9A 3KWCA 2QGIA 5EJ1A 1VZXA 3TV0A 1FXOA 3USQA 4Y7FA 3POLA 1HJLA 1VH1A 1GWWA 1VM8A 4HZCA 1ZJOA 5DEMA 1G1LA 3USRA 4H7OA 4NAKA 1XHDA 2GGOA 2O1HA 1IIMA 1LZIA 1O7QA 3V8YA 4EABA 2X65A 2WVMA 5JQQA 3KWEA 2OEFA 3CKNA 1GWVA 4Y6NA 5CQLX 3OGZA 5C3DA 2FYDB 1S4OA 4Y63A 3T7NA 2I5EA 2RIZA 3U2VA 1ZJ1A 1QRMA 1INJA 3F1YA 2D0JA 2BO8A 3HSQA 4N27A 1R80A 2QKXA 2RJ8A 2AQ9A 1OCXA 1ZCUA 1OQMB 1YP3A 3SX5A 1JV3A 2A8UA 3CU0A 4AAWA 1QGQA 2XWMA 4ISXA 2P6WA 2VD4A 2XWNA 4M2AA 2PA4A 1TW1A 3SXBA 2FY7A 3DHOA 4E6TA 1R81A 2AM3A 4HO0A 1ZI4A 4BMAA 2YC3A 3Q1XA 1ZJ0A 4MZUA 3VBMA 5FYEA 1WT3A 2JCOA 4HO8A 4KNRA 2RIJA 4Y9XA 1ZI3A 4HOCA 3FS8A 3JQYA 3U0XA 4J18A 3MQHA 4K6RA 1FO8A 1ZHJA 4M4KA 2PX7A 1GX4A 3QVBA 2Z87A 1FOAA 1GA8A 2RIXA 2RJ9A 1LVWA 2V0HA 2W0WA 2YQCA 4FRBA 3SXDA 2RJ6A 4ZDQA 3I0IX 4UEGA 3RSBA 2Y7AA 3KWDA 4EA7A 3EEVA 4EEAA 4Y7UA 4AYLA 3MQGA 1H7GA 3I0GA 2FFUA 4Y62A 2VFZA 3R3IA 2QH5A 3I0DA 5BXCA 3R3RA 5FTSA 3JUKA 2UX8A 3PNNA 3R8YA 1KK5A 1G0RA 5FTVA 4D48A 4MYOA 3SXCA 1WVCA 2Y4MA 2NXVA 1ZDGA 4HURA 1QG8A 3FSBA 1H4EA 4B4BA 3SRTA 2WGZA 5C48A 2AGDA 1R7XA 3OH0A 5J49A 4D11C 2FKOA 3OH4A 4G3QA 1LL2A 2WE9A 3KIAA 4R37A 4CJBA 5CMJA 1LL3A 2X60A 2YESA 3VBPA 3E25A 4N6BA 1QRFA 4FRDA 5AJNA 2AESA 2XATA 1SSQA 4EA9A 4FQWA 3ECTA 5AFUU 1G8OA 4EGGA 1FR8A 1FZWA 3TK8A 1ZI5A 1ZIZA 2FYBA 2VSIA 1QGSA 1H5RB 3OTMA 3VBIA 4KXOA 1SSTA 3K8EA 2YCMA 4B4MA 1HM8A 2P2OA 3FSCA 5I1FA 2AECA 3V0PA 5U2KA 4L41C 3FTTA 4IHHA 3I0FA 3T57A 1ZJ3A 4KC2A 4B4GA 3R0SA 1GQ9A 3NGWA 1ON8A 4FRQA 3VBJA 2AM5A 2VHEA 1XATA 2WAWA 3U2WA 3ZGGA 4B2XA 4B5BA 2JCKA 3RMWA 1G3LA 1VGZA 2RJ7A 2BO4A 2PGYA 4DCLA 2IC7A 2ZU8A 3HL3A 2FYAA 1MP3A 3VBKA 3DK5A 3FOQA 2APCA 3SXEA 1NWGB 3EE5A 2RJ4A 2YC5A 2YQSA 3BRKX 4EA8A 4KNXA 2VXLA 2Y6PA 3ZF8A 4NAIA 5DG3A 3ZLKA 3FSXA 1Z90A 3D5NA 5EIYA 5C1GA 3V0QA 5CMIA 4FRLA 3I0JA 4KPZA 3VNPA 4EE5A 1NQIB 4M2BA 4ECMA 5E3QA 1G2VA 3CKOA 1H5TB 3N9WA 4G87A 2AH9A 2V0KA 1WT0A 4HZDA 4KRVA 1H5SC 3U2TA 4EEGA 3SPTA 2VXMA 4M28A 4KT7A 1H4CA 3OU9A 4E75A 4HO9A 2P72A 3OH3A 4HO2A 2CU2A 3MC4A 3FWWA 2VS3A 1H5RA 5CQPA 1YROB 1H4DA 1V84A 3IOIA 4AYJA 1H5SD 1LZJA 4NANA 3OC9A 1VZUA 4HG6A 4ASJA 4IRQA 1S4PA 2NPOA 3CJ8A 3V4EA 4B3UA 3EH0A 2YQJA 5CQMX 1WT1A 2ICYA 1NKHB 2FYCB 2JF2A
chains in the Genus database with same CATH superfamily
4M99A 2GGQA 1GQCA 1HV9A 4YS8A 3BSYA 1O7OA 2WVKA 5C4DA 2PGVA 5FU0A 3T7MA 5C4FA 1S80A 4FRAA 3TDTA 1G23A 2RIYA 3SX7A 3I0LA 1SS9A 1WT2A 1MR7A 2WEEA 3CKQA 2JF3A 2BO6A 4FCUA 3BCVA 1G97A 1XZ6A 4E1KA 1TZFA 4EAAA 2V0JA 3OUPA 1R7UA 2J0BA 1O0RA 4EEMA 1KQAA 1R82A 4G3SA 2OI7A 3TISA 2OEGA 1VH3A 4FRPA 4CJ8A 4O6NA 3Q80A 1M8NA 3I3AA 2QIAA 3LW6A 4KQLA 1FGXA 5ADXV 1WSZA 2TDTA 2VS4A 2WLDA 1QRLA 3GUEA 2MZBA 1YP4A 3PMOA 2ZU7A 3E26A 5IFYA 4JD0A 1W55A 3BSSA 2VSHA 3Q7UA 1ZJ2A 1FO9A 3PKQA 3DJ4A 4C2SA 2I5KA 3F1XA 5EJZA 4EE4A 5D92A 3SXAA 2XMEA 4M9CA 4LW6A 2RJ5A 2RITA 5C4CA 4Y7VA 3ZGFA 3C8VA 2JCLA 1VZTA 1PZYB 1XHBA 4R36A 2E3DA 4FCEA 1H7FA 4FIXA 3VBLA 4KPXA 4EQYA 2WVLA 3V8ZA 4FIYA 1GX0A 1QREA 3P47A 1JYLA 5HS2A 2IU9A 5CQNX 5DDVA 3V90A 3T7OA 1N4IA 1G93A 5C3AA 1FWYA 3U2XA 2O1GA 3OH1A 1OMZA 4FREA 5C36A 1H7TA 2FFVA 5D91A 1TDTA 4HUSA 5C4EA 5E3RA 2IUAA 4E79A 5C1HA 1HJJA 4EE3A 4NALA 4HO6A 3VBNA 1THJA 2WLEA 3OW5A 5CMHA 4R7PA 1O23B 4JISA 1V3WA 4IRPA 4Y7GA 3U0YA 3D8VA 1QWJA 1INIA 3I3XA 3TWDA 2E8BA 3V0NA 4ARWA 1HM9A 1ZI1A 4D11A 1H7EA 3CKJA 1I52A 1KGTA 3R2WA 2AE7A 5FU8A 3ZLLA 1MP5A 4E6UA 1TVYA 1MRLA 3JUJA 1H5SB 2Y4LA 4MNDA 3V0OA 4MFGA 1JVDA 4N69A 1KHRA 1H3MA 3DUVA 1KGQA 4Y6UA 5C1LA 3BFPA 1QRGA 3D98A 4AA7A 2OI6A 1V82A 3O3PA 4P00A 4KC1A 1H7HA 1LZ0A 3CKVA 2P73A 3IOJA 1QQ0A 4M98A 3V0LA 3TQDA 4DDZA 1G9RA 2BO7A 2YQHA 5CQOA 5IDSA 1MR9A 1NHEB 4B42A 1JV1A 1VGUA 1ON6A 3IGJA 5DDTA 4FRHA 1LL0A 5CMFX 2Q4JA 1ZCVA 4Y7TA 1W77A 2V0LA 2X5ZA 1KRRA 1KK6A 2O1FA 5C4BA 2WLCA 1R7VA 4ASYA 3ST8A 5FV9A 5C8RA 3V91A 1VGWA 4FROA 1T3DA 3BSWA 3R5AA 4CJCA 4HO5A 5AJPA 4GBPA 1MC3A 2I7BA 1KK4A 5AJOA 1IINA 3TIOA 2VK9A 1FXJA 3I0HA 1OMXA 2IU8A 1W57A 5FUHA 2X5SA 1ZCTA 4D0TA 5ADXU 5CMGX 4IHFA 4DECA 4KC4A 3FSYA 2D7IA 4D0ZA 3I0KA 1V67A 2D7RA 1NMMB 2RJ0A 3GVDA 1H5SA 1VPAA 3SX8A 3OH2A 4LW3A 3R5BA 3R5DA 1H7QA 3TZTA 3OTZA 2ICXA 1H5TA 2RJ1A 1S4NA 3NZ2A 4Y64A 1SSMA 4AC3A 3U2UA 1LXAA 1J2ZA 3I0EA 2Z86A 1EYRA 3OAMA 1VGTA 3I0CA 3EG4A 3CGXA 4FRMA 1KRUA 5L6VA 1ZCYA 3P1BA 3K8DA 4N6AA 5C3BA 1JYKA 1VICA 5C49A 4XWIA 1FRWA 4J09A 1LZ7A 2A8WA 5DEPA 2Y4JA 1ZJPA 2JCJA 4B2WA 3JTJA 3R5CA 3F1CA 1FG5N 1TW5A 2OI5A 4BQHA 5IDTA 1E5KA 2QIVX 1R7TA 4EVWA 4HCQA 4HO4A 3SXGA 2DPWA 1JVGA 3R1WA 4EEOA 3IOHA 4DE7A 5C38A 1PZTA 2WLGA 3SX3A 3Q4SA 1KWSA 4HO3A 2AM4A 3GOSA 1H7LA 2Y4KA 1HM0A 2V0IA 2VS5A 5AFUV 2WLFA 1KRVA 4MYBA 4CVHA 3IXCA 5F42A 4G3PA 1G95A 2XMHA 1K4VA 1ZDFA 5E3PA 1NF5B 1V83A 2XWLA 2ZU9A 3SUCA 4P02A 2W0VA 1MP4A 4IHGA 3GQ8A 3OKRA 5L6SA 5C47A 1R7YA 3HJJA 1EZIA 1YP2A 3PKPA 3BXYA 3V0MA 3RMVA 1FGGA 1FR9A 3KWCA 2QGIA 5EJ1A 1VZXA 3TV0A 1FXOA 3USQA 4Y7FA 3POLA 1HJLA 1VH1A 1GWWA 1VM8A 4HZCA 1ZJOA 5DEMA 1G1LA 3USRA 4H7OA 4NAKA 1XHDA 2GGOA 2O1HA 1IIMA 1LZIA 1O7QA 3V8YA 3GQAA 4EABA 2WVMA 2X65A 3KWEA 2OEFA 3CKNA 1GWVA 5JQQA 4Y6NA 5CQLX 3OGZA 5C3DA 2FYDB 1S4OA 4Y63A 3T7NA 2I5EA 2RIZA 3U2VA 1ZJ1A 1QRMA 1INJA 3F1YA 2C0NA 2D0JA 2BO8A 3HSQA 4N27A 1R80A 2QKXA 2RJ8A 2AQ9A 1OCXA 1ZCUA 1OQMB 1YP3A 3SX5A 1JV3A 2A8UA 3CU0A 4AAWA 1QGQA 2XWMA 2J0AA 4ISXA 2P6WA 2VD4A 2XWNA 4MIXA 4M2AA 2PA4A 1TW1A 3SXBA 2FY7A 3DHOA 4E6TA 1R81A 2AM3A 4HO0A 1ZI4A 4BMAA 2YC3A 4Q7CA 3Q1XA 1ZJ0A 4MZUA 3VBMA 5FYEA 1WT3A 2JCOA 4HO8A 4KNRA 2RIJA 4Y9XA 1ZI3A 1L0SA 4HOCA 3FS8A 3JQYA 3U0XA 4J18A 3MQHA 4K6RA 1FO8A 1ZHJA 4M4KA 2PX7A 1GX4A 3QVBA 2Z87A 1FOAA 1GA8A 2RIXA 2RJ9A 1LVWA 2V0HA 2W0WA 2YQCA 4FRBA 3SXDA 2RJ6A 4ZDQA 3I0IX 4UEGA 3RSBA 2Y7AA 3KWDA 4EA7A 3EEVA 4EEAA 4Y7UA 4AYLA 3MQGA 1H7GA 3I0GA 2FFUA 4Y62A 2VFZA 3R3IA 2QH5A 3I0DA 5BXCA 3R3RA 5FTSA 3JUKA 2UX8A 3PNNA 3R8YA 1KK5A 1G0RA 5FTVA 4D48A 4MYOA 3SXCA 1WVCA 2Y4MA 2NXVA 1ZDGA 4HURA 1QG8A 3FSBA 1H4EA 4B4BA 3SRTA 2WGZA 5C48A 2AGDA 1R7XA 3OH0A 5J49A 4D11C 2FKOA 3OH4A 4G3QA 1LL2A 2WE9A 3KIAA 4R37A 4CJBA 5CMJA 1LL3A 2X60A 2YESA 3VBPA 3E25A 4N6BA 1QRFA 4FRDA 5AJNA 2AESA 2XATA 1SSQA 4EA9A 4FQWA 3ECTA 5AFUU 1G8OA 4EGGA 1FR8A 1FZWA 3TK8A 1ZI5A 1ZIZA 2FYBA 2VSIA 1QGSA 1H5RB 3OTMA 3VBIA 4KXOA 1SSTA 3K8EA 2YCMA 4B4MA 1HM8A 2P2OA 3FSCA 5I1FA 2AECA 3V0PA 5U2KA 4L41C 3FTTA 4IHHA 3I0FA 3T57A 1ZJ3A 4KC2A 4B4GA 3R0SA 1GQ9A 3NGWA 1ON8A 4FRQA 3VBJA 2AM5A 2VHEA 1XATA 2WAWA 3U2WA 3ZGGA 4B2XA 4B5BA 2JCKA 3RMWA 1G3LA 1VGZA 2RJ7A 2BO4A 2PGYA 4DCLA 2IC7A 1EWWA 2ZU8A 3HL3A 2FYAA 1MP3A 3VBKA 3DK5A 3FOQA 2APCA 3SXEA 1NWGB 3EE5A 2RJ4A 2YC5A 2YQSA 3BRKX 4EA8A 4KNXA 2VXLA 2Y6PA 3ZF8A 4O6MA 4NAIA 5DG3A 3ZLKA 3FSXA 1Z90A 3D5NA 5EIYA 5C1GA 3V0QA 5CMIA 4FRLA 3I0JA 4KPZA 3VNPA 4EE5A 1NQIB 4M2BA 4ECMA 5E3QA 1G2VA 3CKOA 1H5TB 1Z2FA 3GQ9A 3GQ7A 3N9WA 4G87A 2AH9A 2V0KA 1WT0A 4HZDA 4KRVA 1H5SC 3U2TA 4EEGA 3SPTA 2VXMA 4M28A 4KT7A 1H4CA 3OU9A 4E75A 4HO9A 2P72A 3OH3A 4HO2A 2CU2A 3MC4A 3FWWA 2VS3A 1H5RA 5CQPA 1YROB 1H4DA 1V84A 3IOIA 4AYJA 1H5SD 1LZJA 4NANA 3OC9A 1VZUA 4HG6A 4ASJA 4IRQA 1S4PA 2NPOA 3CJ8A 3V4EA 4B3UA 3EH0A 2YQJA 5CQMX 1WT1A 2ICYA 1NKHB 2FYCB 2JF2A
chains in the Genus database with same CATH topology
4M99A 2GGQA 1GQCA 1HV9A 4YS8A 3BSYA 1O7OA 2WVKA 5C4DA 2PGVA 5FU0A 3T7MA 5C4FA 1S80A 4FRAA 3TDTA 1G23A 2RIYA 3SX7A 3I0LA 1SS9A 1WT2A 1MR7A 2WEEA 3CKQA 2JF3A 2BO6A 4FCUA 3BCVA 1G97A 1XZ6A 4E1KA 1TZFA 4EAAA 2V0JA 3OUPA 1R7UA 2J0BA 1O0RA 4EEMA 1KQAA 1R82A 4G3SA 2OI7A 3TISA 2OEGA 1VH3A 4FRPA 4CJ8A 4O6NA 3Q80A 3I3AA 2QIAA 3LW6A 4KQLA 1FGXA 5ADXV 1WSZA 2TDTA 2VS4A 2WLDA 1QRLA 3GUEA 2MZBA 1YP4A 3PMOA 2ZU7A 3E26A 5IFYA 4JD0A 1W55A 3BSSA 2VSHA 3Q7UA 1ZJ2A 1FO9A 3PKQA 3DJ4A 4C2SA 2I5KA 3F1XA 5EJZA 4EE4A 5D92A 3SXAA 2XMEA 4M9CA 4LW6A 2RJ5A 2RITA 5C4CA 4Y7VA 3ZGFA 3C8VA 2JCLA 1VZTA 1PZYB 1XHBA 4R36A 2E3DA 4FCEA 1H7FA 4FIXA 3VBLA 4KPXA 4EQYA 2WVLA 3V8ZA 4FIYA 1GX0A 1QREA 3P47A 1JYLA 5HS2A 2IU9A 5CQNX 5DDVA 3V90A 3T7OA 1G93A 5C3AA 1FWYA 3U2XA 2O1GA 1OMZA 3OH1A 4FREA 5C36A 1H7TA 2FFVA 5D91A 1TDTA 4HUSA 5C4EA 5E3RA 2IUAA 4E79A 5C1HA 1HJJA 4EE3A 4NALA 4HO6A 3VBNA 1THJA 2WLEA 3OW5A 5CMHA 4R7PA 1O23B 4JISA 1V3WA 4IRPA 4Y7GA 3U0YA 3D8VA 1QWJA 1INIA 3I3XA 3TWDA 2E8BA 3V0NA 4ARWA 1HM9A 1ZI1A 4D11A 1H7EA 3CKJA 1I52A 1KGTA 3R2WA 2AE7A 5FU8A 3ZLLA 1MP5A 4E6UA 1TVYA 1MRLA 3JUJA 1H5SB 2Y4LA 4MNDA 3V0OA 4MFGA 1JVDA 4N69A 1KHRA 1H3MA 3DUVA 1KGQA 4Y6UA 5C1LA 3BFPA 1QRGA 3D98A 4AA7A 2OI6A 1V82A 3O3PA 4P00A 4KC1A 1H7HA 1LZ0A 3CKVA 2P73A 3IOJA 1QQ0A 4M98A 3V0LA 3TQDA 4DDZA 1G9RA 2BO7A 2YQHA 5CQOA 5IDSA 1MR9A 1NHEB 4B42A 1JV1A 1VGUA 1ON6A 3IGJA 5DDTA 4FRHA 1LL0A 5CMFX 2Q4JA 1ZCVA 4Y7TA 1W77A 2V0LA 2X5ZA 1KRRA 1KK6A 2O1FA 5C4BA 2WLCA 1R7VA 4ASYA 3ST8A 5FV9A 5C8RA 3V91A 1VGWA 4FROA 1T3DA 3BSWA 3R5AA 4CJCA 4HO5A 5AJPA 4GBPA 1MC3A 2I7BA 1KK4A 5AJOA 1IINA 3TIOA 2VK9A 1FXJA 3I0HA 1OMXA 2IU8A 1W57A 5FUHA 2X5SA 1ZCTA 4D0TA 5ADXU 5CMGX 4IHFA 4DECA 4KC4A 3FSYA 2D7IA 4D0ZA 3I0KA 1V67A 2D7RA 1NMMB 2RJ0A 3GVDA 1H5SA 1VPAA 3SX8A 3OH2A 4LW3A 3R5BA 3R5DA 1H7QA 3TZTA 3OTZA 2ICXA 1H5TA 2RJ1A 1S4NA 3NZ2A 4Y64A 1SSMA 4AC3A 3U2UA 1LXAA 1J2ZA 3I0EA 2Z86A 1EYRA 3OAMA 1VGTA 3I0CA 3EG4A 3CGXA 4FRMA 1KRUA 5L6VA 1ZCYA 3P1BA 3K8DA 4N6AA 5C3BA 1JYKA 1VICA 5C49A 4XWIA 1FRWA 4J09A 1LZ7A 2A8WA 5DEPA 2Y4JA 1ZJPA 2JCJA 4B2WA 3JTJA 3R5CA 3F1CA 1FG5N 1TW5A 2OI5A 4BQHA 5IDTA 1E5KA 2QIVX 1R7TA 4EVWA 4HCQA 4HO4A 3SXGA 2DPWA 1JVGA 3R1WA 4EEOA 3IOHA 4DE7A 5C38A 1PZTA 2WLGA 3SX3A 3Q4SA 1KWSA 4HO3A 2AM4A 3GOSA 1H7LA 2Y4KA 1HM0A 2V0IA 2VS5A 5AFUV 2WLFA 1KRVA 4MYBA 4CVHA 3IXCA 5F42A 4G3PA 1G95A 2XMHA 1K4VA 1ZDFA 5E3PA 1NF5B 1V83A 2XWLA 2ZU9A 4P02A 2W0VA 1MP4A 4IHGA 3OKRA 5L6SA 5C47A 1R7YA 3HJJA 1EZIA 1YP2A 3PKPA 3BXYA 3V0MA 3RMVA 1FGGA 1FR9A 3KWCA 2QGIA 5EJ1A 1VZXA 3TV0A 1FXOA 3USQA 4Y7FA 3POLA 1HJLA 1VH1A 1GWWA 1VM8A 4HZCA 1ZJOA 5DEMA 1G1LA 3USRA 4H7OA 4NAKA 1XHDA 2GGOA 2O1HA 1IIMA 1LZIA 1O7QA 3V8YA 4EABA 2X65A 2WVMA 5JQQA 3KWEA 2OEFA 3CKNA 1GWVA 4Y6NA 5CQLX 3OGZA 5C3DA 2FYDB 1S4OA 4Y63A 3T7NA 2I5EA 2RIZA 3U2VA 1ZJ1A 1QRMA 1INJA 3F1YA 2C0NA 2D0JA 2BO8A 3HSQA 4N27A 1R80A 2QKXA 2RJ8A 2AQ9A 1OCXA 1ZCUA 1OQMB 1YP3A 3SX5A 1JV3A 2A8UA 3CU0A 4AAWA 1QGQA 2XWMA 2J0AA 4ISXA 2P6WA 2VD4A 2XWNA 4MIXA 4M2AA 2PA4A 1TW1A 3SXBA 2FY7A 3DHOA 4E6TA 1R81A 2AM3A 4HO0A 1ZI4A 4BMAA 2YC3A 4Q7CA 3Q1XA 1ZJ0A 4MZUA 3VBMA 5FYEA 1WT3A 2JCOA 4HO8A 4KNRA 2RIJA 4Y9XA 1ZI3A 4HOCA 3FS8A 3JQYA 3U0XA 4J18A 3MQHA 4K6RA 1FO8A 1ZHJA 4M4KA 2PX7A 1GX4A 3QVBA 2Z87A 1FOAA 1GA8A 2RIXA 2RJ9A 1LVWA 2V0HA 2W0WA 2YQCA 4FRBA 3SXDA 2RJ6A 4ZDQA 3I0IX 4UEGA 3RSBA 2Y7AA 3KWDA 4EA7A 3EEVA 4EEAA 4Y7UA 4AYLA 3MQGA 1H7GA 3I0GA 2FFUA 4Y62A 2VFZA 3R3IA 2QH5A 3I0DA 5BXCA 3R3RA 5FTSA 3JUKA 2UX8A 3PNNA 3R8YA 1KK5A 1G0RA 5FTVA 4D48A 4MYOA 3SXCA 1WVCA 2Y4MA 2NXVA 1ZDGA 4HURA 1QG8A 3FSBA 1H4EA 4B4BA 3SRTA 2WGZA 5C48A 2AGDA 1R7XA 3OH0A 5J49A 4D11C 2FKOA 3OH4A 4G3QA 1LL2A 2WE9A 3KIAA 4R37A 4CJBA 5CMJA 1LL3A 2X60A 2YESA 3VBPA 3E25A 4N6BA 1QRFA 4FRDA 5AJNA 2AESA 2XATA 1SSQA 4EA9A 4FQWA 3ECTA 5AFUU 1G8OA 4EGGA 1FR8A 1FZWA 3TK8A 1ZI5A 1ZIZA 2FYBA 2VSIA 1QGSA 1H5RB 3OTMA 3VBIA 4KXOA 1SSTA 3K8EA 2YCMA 4B4MA 1HM8A 2P2OA 3FSCA 5I1FA 2AECA 3V0PA 5U2KA 4L41C 3FTTA 4IHHA 3I0FA 3T57A 1ZJ3A 4KC2A 4B4GA 3R0SA 1GQ9A 3NGWA 1ON8A 4FRQA 3VBJA 2AM5A 2VHEA 1XATA 2WAWA 3U2WA 3ZGGA 4B2XA 4B5BA 2JCKA 3RMWA 1G3LA 1VGZA 2RJ7A 2BO4A 2PGYA 4DCLA 2IC7A 2ZU8A 3HL3A 2FYAA 1MP3A 3VBKA 3DK5A 3FOQA 2APCA 3SXEA 1NWGB 3EE5A 2RJ4A 2YC5A 2YQSA 3BRKX 4EA8A 4KNXA 2VXLA 2Y6PA 3ZF8A 4O6MA 4NAIA 5DG3A 3ZLKA 3FSXA 1Z90A 3D5NA 5EIYA 5C1GA 3V0QA 5CMIA 4FRLA 3I0JA 4KPZA 3VNPA 4EE5A 1NQIB 4M2BA 4ECMA 5E3QA 1G2VA 3CKOA 1H5TB 3N9WA 4G87A 2AH9A 2V0KA 1WT0A 4HZDA 4KRVA 1H5SC 3U2TA 4EEGA 3SPTA 2VXMA 4M28A 4KT7A 1H4CA 3OU9A 4E75A 4HO9A 2P72A 3OH3A 4HO2A 2CU2A 3MC4A 3FWWA 2VS3A 1H5RA 5CQPA 1YROB 1H4DA 1V84A 3IOIA 4AYJA 1H5SD 1LZJA 4NANA 3OC9A 1VZUA 4HG6A 4ASJA 4IRQA 1S4PA 2NPOA 3CJ8A 3V4EA 4B3UA 3EH0A 2YQJA 5CQMX 1WT1A 2ICYA 1NKHB 2FYCB 2JF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M99 A;  2GGQ A;  1GQC A;  1HV9 A;  4YS8 A;  3BSY A;  1O7O A;  2WVK A;  5C4D A;  2PGV A;  5FU0 A;  3T7M A;  5C4F A;  1S80 A;  4FRA A;  3TDT A;  1G23 A;  2RIY A;  3SX7 A;  3I0L A;  1SS9 A;  1WT2 A;  1MR7 A;  2WEE A;  3CKQ A;  2JF3 A;  2BO6 A;  4FCU A;  3BCV A;  1G97 A;  1XZ6 A;  4E1K A;  1TZF A;  4EAA A;  2V0J A;  3OUP A;  1R7U A;  1O0R A;  4EEM A;  1KQA A;  1R82 A;  4G3S A;  2OI7 A;  3TIS A;  2OEG A;  1VH3 A;  4FRP A;  4CJ8 A;  3Q80 A;  3I3A A;  2QIA A;  3LW6 A;  4KQL A;  1FGX A;  5ADX V;  1WSZ A;  2TDT A;  2VS4 A;  2WLD A;  1QRL A;  3GUE A;  2MZB A;  1YP4 A;  3PMO A;  2ZU7 A;  3E26 A;  5IFY A;  4JD0 A;  1W55 A;  3BSS A;  2VSH A;  3Q7U A;  1ZJ2 A;  1FO9 A;  3PKQ A;  3DJ4 A;  4C2S A;  2I5K A;  3F1X A;  5EJZ A;  4EE4 A;  3SXA A;  2XME A;  4M9C A;  4LW6 A;  2RJ5 A;  2RIT A;  5C4C A;  4Y7V A;  3ZGF A;  3C8V A;  2JCL A;  1VZT A;  1PZY B;  1XHB A;  4R36 A;  2E3D A;  4FCE A;  1H7F A;  3VBL A;  4KPX A;  4EQY A;  2WVL A;  3V8Z A;  1GX0 A;  1QRE A;  3P47 A;  1JYL A;  5HS2 A;  2IU9 A;  5CQN X;  5DDV A;  3V90 A;  3T7O A;  1G93 A;  5C3A A;  1FWY A;  3U2X A;  2O1G A;  1OMZ A;  3OH1 A;  4FRE A;  5C36 A;  1H7T A;  2FFV A;  1TDT A;  4HUS A;  5C4E A;  5E3R A;  2IUA A;  4E79 A;  5C1H A;  1HJJ A;  4EE3 A;  4NAL A;  4HO6 A;  3VBN A;  1THJ A;  2WLE A;  3OW5 A;  5CMH A;  4R7P A;  1O23 B;  4JIS A;  1V3W A;  4IRP A;  4Y7G A;  3U0Y A;  3D8V A;  1QWJ A;  1INI A;  3I3X A;  3TWD A;  2E8B A;  3V0N A;  4ARW A;  1HM9 A;  1ZI1 A;  4D11 A;  1H7E A;  3CKJ A;  1I52 A;  1KGT A;  3R2W A;  2AE7 A;  5FU8 A;  3ZLL A;  1MP5 A;  4E6U A;  1TVY A;  1MRL A;  3JUJ A;  1H5S B;  2Y4L A;  4MND A;  3V0O A;  4MFG A;  1JVD A;  4N69 A;  1KHR A;  1H3M A;  3DUV A;  1KGQ A;  4Y6U A;  5C1L A;  3BFP A;  1QRG A;  3D98 A;  4AA7 A;  2OI6 A;  1V82 A;  3O3P A;  4P00 A;  4KC1 A;  1H7H A;  1LZ0 A;  3CKV A;  2P73 A;  3IOJ A;  1QQ0 A;  4M98 A;  3V0L A;  3TQD A;  4DDZ A;  1G9R A;  2BO7 A;  2YQH A;  5CQO A;  5IDS A;  1MR9 A;  1NHE B;  4B42 A;  1JV1 A;  1VGU A;  1ON6 A;  3IGJ A;  5DDT A;  4FRH A;  1LL0 A;  5CMF X;  2Q4J A;  1ZCV A;  4Y7T A;  1W77 A;  2V0L A;  2X5Z A;  1KRR A;  1KK6 A;  2O1F A;  5C4B A;  2WLC A;  1R7V A;  4ASY A;  3ST8 A;  5FV9 A;  5C8R A;  3V91 A;  1VGW A;  4FRO A;  1T3D A;  3BSW A;  3R5A A;  4CJC A;  4HO5 A;  5AJP A;  4GBP A;  1MC3 A;  2I7B A;  1KK4 A;  5AJO A;  1IIN A;  3TIO A;  1FXJ A;  3I0H A;  1OMX A;  2IU8 A;  1W57 A;  5FUH A;  2X5S A;  1ZCT A;  4D0T A;  5ADX U;  5CMG X;  4IHF A;  4DEC A;  4KC4 A;  3FSY A;  2D7I A;  4D0Z A;  3I0K A;  1V67 A;  2D7R A;  1NMM B;  2RJ0 A;  3GVD A;  1H5S A;  1VPA A;  3SX8 A;  3OH2 A;  4LW3 A;  3R5B A;  3R5D A;  1H7Q A;  3TZT A;  3OTZ A;  2ICX A;  1H5T A;  2RJ1 A;  1S4N A;  3NZ2 A;  4Y64 A;  1SSM A;  4AC3 A;  3U2U A;  1LXA A;  1J2Z A;  3I0E A;  2Z86 A;  1EYR A;  3OAM A;  1VGT A;  3I0C A;  3EG4 A;  3CGX A;  4FRM A;  1KRU A;  5L6V A;  1ZCY A;  3P1B A;  3K8D A;  4N6A A;  5C3B A;  1JYK A;  1VIC A;  5C49 A;  4XWI A;  1FRW A;  4J09 A;  1LZ7 A;  2A8W A;  5DEP A;  2Y4J A;  1ZJP A;  2JCJ A;  4B2W A;  3JTJ A;  3R5C A;  3F1C A;  1FG5 N;  1TW5 A;  2OI5 A;  4BQH A;  5IDT A;  1E5K A;  2QIV X;  1R7T A;  4EVW A;  4HCQ A;  4HO4 A;  3SXG A;  2DPW A;  1JVG A;  3R1W A;  4EEO A;  3IOH A;  4DE7 A;  5C38 A;  1PZT A;  2WLG A;  3SX3 A;  3Q4S A;  1KWS A;  4HO3 A;  2AM4 A;  3GOS A;  1H7L A;  2Y4K A;  1HM0 A;  2V0I A;  2VS5 A;  5AFU V;  2WLF A;  1KRV A;  4MYB A;  4CVH A;  3IXC A;  5F42 A;  4G3P A;  1G95 A;  2XMH A;  1K4V A;  1ZDF A;  5E3P A;  1NF5 B;  1V83 A;  2XWL A;  2ZU9 A;  4P02 A;  2W0V A;  1MP4 A;  4IHG A;  3OKR A;  5L6S A;  5C47 A;  1R7Y A;  3HJJ A;  1EZI A;  1YP2 A;  3PKP A;  3BXY A;  3V0M A;  3RMV A;  1FGG A;  1FR9 A;  3KWC A;  2QGI A;  5EJ1 A;  1VZX A;  3TV0 A;  1FXO A;  3USQ A;  4Y7F A;  3POL A;  1HJL A;  1VH1 A;  1GWW A;  1VM8 A;  4HZC A;  1ZJO A;  5DEM A;  1G1L A;  3USR A;  4H7O A;  4NAK A;  1XHD A;  2GGO A;  2O1H A;  1IIM A;  1LZI A;  1O7Q A;  3V8Y A;  4EAB A;  2X65 A;  2WVM A;  5JQQ A;  3KWE A;  2OEF A;  3CKN A;  1GWV A;  4Y6N A;  5CQL X;  3OGZ A;  5C3D A;  2FYD B;  1S4O A;  4Y63 A;  3T7N A;  2I5E A;  2RIZ A;  3U2V A;  1ZJ1 A;  1QRM A;  1INJ A;  3F1Y A;  2D0J A;  2BO8 A;  3HSQ A;  4N27 A;  1R80 A;  2QKX A;  2RJ8 A;  2AQ9 A;  1OCX A;  1ZCU A;  1OQM B;  1YP3 A;  3SX5 A;  1JV3 A;  2A8U A;  3CU0 A;  4AAW A;  1QGQ A;  2XWM A;  4ISX A;  2P6W A;  2VD4 A;  2XWN A;  4M2A A;  2PA4 A;  1TW1 A;  3SXB A;  2FY7 A;  3DHO A;  4E6T A;  1R81 A;  2AM3 A;  4HO0 A;  1ZI4 A;  4BMA A;  2YC3 A;  3Q1X A;  1ZJ0 A;  4MZU A;  3VBM A;  5FYE A;  1WT3 A;  2JCO A;  4HO8 A;  4KNR A;  2RIJ A;  4Y9X A;  1ZI3 A;  4HOC A;  3FS8 A;  3JQY A;  3U0X A;  4J18 A;  3MQH A;  4K6R A;  1FO8 A;  1ZHJ A;  4M4K A;  2PX7 A;  1GX4 A;  3QVB A;  2Z87 A;  1FOA A;  1GA8 A;  2RIX A;  2RJ9 A;  1LVW A;  2V0H A;  2W0W A;  2YQC A;  4FRB A;  3SXD A;  2RJ6 A;  4ZDQ A;  3I0I X;  4UEG A;  3RSB A;  2Y7A A;  3KWD A;  4EA7 A;  3EEV A;  4EEA A;  4Y7U A;  4AYL A;  3MQG A;  1H7G A;  3I0G A;  2FFU A;  4Y62 A;  2VFZ A;  3R3I A;  2QH5 A;  3I0D A;  5BXC A;  3R3R A;  5FTS A;  3JUK A;  2UX8 A;  3PNN A;  3R8Y A;  1KK5 A;  1G0R A;  5FTV A;  4D48 A;  4MYO A;  3SXC A;  1WVC A;  2Y4M A;  2NXV A;  1ZDG A;  4HUR A;  1QG8 A;  3FSB A;  1H4E A;  4B4B A;  3SRT A;  2WGZ A;  5C48 A;  2AGD A;  1R7X A;  3OH0 A;  5J49 A;  4D11 C;  2FKO A;  3OH4 A;  4G3Q A;  1LL2 A;  2WE9 A;  3KIA A;  4R37 A;  4CJB A;  5CMJ A;  1LL3 A;  2X60 A;  2YES A;  3VBP A;  3E25 A;  4N6B A;  1QRF A;  4FRD A;  5AJN A;  2AES A;  2XAT A;  1SSQ A;  4EA9 A;  4FQW A;  3ECT A;  5AFU U;  1G8O A;  4EGG A;  1FR8 A;  1FZW A;  3TK8 A;  1ZI5 A;  1ZIZ A;  2FYB A;  2VSI A;  1QGS A;  1H5R B;  3OTM A;  3VBI A;  4KXO A;  1SST A;  3K8E A;  2YCM A;  4B4M A;  1HM8 A;  2P2O A;  3FSC A;  5I1F A;  2AEC A;  3V0P A;  5U2K A;  4L41 C;  3FTT A;  4IHH A;  3I0F A;  3T57 A;  1ZJ3 A;  4KC2 A;  4B4G A;  3R0S A;  1GQ9 A;  3NGW A;  1ON8 A;  4FRQ A;  3VBJ A;  2AM5 A;  2VHE A;  1XAT A;  2WAW A;  3U2W A;  3ZGG A;  4B2X A;  4B5B A;  2JCK A;  3RMW A;  1G3L A;  1VGZ A;  2RJ7 A;  2BO4 A;  2PGY A;  4DCL A;  2IC7 A;  2ZU8 A;  3HL3 A;  2FYA A;  1MP3 A;  3VBK A;  3DK5 A;  3FOQ A;  2APC A;  3SXE A;  1NWG B;  3EE5 A;  2RJ4 A;  2YC5 A;  2YQS A;  3BRK X;  4EA8 A;  4KNX A;  2VXL A;  2Y6P A;  3ZF8 A;  4NAI A;  5DG3 A;  3ZLK A;  3FSX A;  1Z90 A;  3D5N A;  5EIY A;  5C1G A;  3V0Q A;  5CMI A;  4FRL A;  3I0J A;  4KPZ A;  3VNP A;  4EE5 A;  1NQI B;  4M2B A;  4ECM A;  5E3Q A;  1G2V A;  3CKO A;  1H5T B;  3N9W A;  4G87 A;  2AH9 A;  2V0K A;  1WT0 A;  4HZD A;  4KRV A;  1H5S C;  3U2T A;  4EEG A;  3SPT A;  2VXM A;  4M28 A;  4KT7 A;  1H4C A;  3OU9 A;  4E75 A;  4HO9 A;  2P72 A;  3OH3 A;  4HO2 A;  2CU2 A;  3MC4 A;  3FWW A;  2VS3 A;  1H5R A;  5CQP A;  1YRO B;  1H4D A;  1V84 A;  3IOI A;  4AYJ A;  1H5S D;  1LZJ A;  4NAN A;  3OC9 A;  1VZU A;  4HG6 A;  4ASJ A;  4IRQ A;  1S4P A;  2NPO A;  3CJ8 A;  3V4E A;  4B3U A;  3EH0 A;  2YQJ A;  5CQM X;  1WT1 A;  2ICY A;  1NKH B;  2FYC B;  2JF2 A; 
#chains in the Genus database with same CATH topology
 4M99 A;  2GGQ A;  1GQC A;  1HV9 A;  4YS8 A;  3BSY A;  1O7O A;  2WVK A;  5C4D A;  2PGV A;  5FU0 A;  3T7M A;  5C4F A;  1S80 A;  4FRA A;  3TDT A;  1G23 A;  2RIY A;  3SX7 A;  3I0L A;  1SS9 A;  1WT2 A;  1MR7 A;  2WEE A;  3CKQ A;  2JF3 A;  2BO6 A;  4FCU A;  3BCV A;  1G97 A;  1XZ6 A;  4E1K A;  1TZF A;  4EAA A;  2V0J A;  3OUP A;  1R7U A;  2J0B A;  1O0R A;  4EEM A;  1KQA A;  1R82 A;  4G3S A;  2OI7 A;  3TIS A;  2OEG A;  1VH3 A;  4FRP A;  4CJ8 A;  4O6N A;  3Q80 A;  1M8N A;  3I3A A;  2QIA A;  3LW6 A;  4KQL A;  1FGX A;  5ADX V;  1WSZ A;  2TDT A;  2VS4 A;  2WLD A;  1QRL A;  3GUE A;  2MZB A;  1YP4 A;  3PMO A;  2ZU7 A;  3E26 A;  5IFY A;  4JD0 A;  1W55 A;  3BSS A;  2VSH A;  3Q7U A;  1ZJ2 A;  1FO9 A;  3PKQ A;  3DJ4 A;  4C2S A;  2I5K A;  3F1X A;  5EJZ A;  4EE4 A;  5D92 A;  3SXA A;  2XME A;  4M9C A;  4LW6 A;  2RJ5 A;  2RIT A;  5C4C A;  4Y7V A;  3ZGF A;  3C8V A;  2JCL A;  1VZT A;  1PZY B;  1XHB A;  4R36 A;  2E3D A;  4FCE A;  1H7F A;  4FIX A;  3VBL A;  4KPX A;  4EQY A;  2WVL A;  3V8Z A;  4FIY A;  1GX0 A;  1QRE A;  3P47 A;  1JYL A;  5HS2 A;  2IU9 A;  5CQN X;  5DDV A;  3V90 A;  3T7O A;  1N4I A;  1G93 A;  5C3A A;  1FWY A;  3U2X A;  2O1G A;  3OH1 A;  1OMZ A;  4FRE A;  5C36 A;  1H7T A;  2FFV A;  5D91 A;  1TDT A;  4HUS A;  5C4E A;  5E3R A;  2IUA A;  4E79 A;  5C1H A;  1HJJ A;  4EE3 A;  4NAL A;  4HO6 A;  3VBN A;  1THJ A;  2WLE A;  3OW5 A;  5CMH A;  4R7P A;  1O23 B;  4JIS A;  1V3W A;  4IRP A;  4Y7G A;  3U0Y A;  3D8V A;  1QWJ A;  1INI A;  3I3X A;  3TWD A;  2E8B A;  3V0N A;  4ARW A;  1HM9 A;  1ZI1 A;  4D11 A;  1H7E A;  3CKJ A;  1I52 A;  1KGT A;  3R2W A;  2AE7 A;  5FU8 A;  3ZLL A;  1MP5 A;  4E6U A;  1TVY A;  1MRL A;  3JUJ A;  1H5S B;  2Y4L A;  4MND A;  3V0O A;  4MFG A;  1JVD A;  4N69 A;  1KHR A;  1H3M A;  3DUV A;  1KGQ A;  4Y6U A;  5C1L A;  3BFP A;  1QRG A;  3D98 A;  4AA7 A;  2OI6 A;  1V82 A;  3O3P A;  4P00 A;  4KC1 A;  1H7H A;  1LZ0 A;  3CKV A;  2P73 A;  3IOJ A;  1QQ0 A;  4M98 A;  3V0L A;  3TQD A;  4DDZ A;  1G9R A;  2BO7 A;  2YQH A;  5CQO A;  5IDS A;  1MR9 A;  1NHE B;  4B42 A;  1JV1 A;  1VGU A;  1ON6 A;  3IGJ A;  5DDT A;  4FRH A;  1LL0 A;  5CMF X;  2Q4J A;  1ZCV A;  4Y7T A;  1W77 A;  2V0L A;  2X5Z A;  1KRR A;  1KK6 A;  2O1F A;  5C4B A;  2WLC A;  1R7V A;  4ASY A;  3ST8 A;  5FV9 A;  5C8R A;  3V91 A;  1VGW A;  4FRO A;  1T3D A;  3BSW A;  3R5A A;  4CJC A;  4HO5 A;  5AJP A;  4GBP A;  1MC3 A;  2I7B A;  1KK4 A;  5AJO A;  1IIN A;  3TIO A;  2VK9 A;  1FXJ A;  3I0H A;  1OMX A;  2IU8 A;  1W57 A;  5FUH A;  2X5S A;  1ZCT A;  4D0T A;  5ADX U;  5CMG X;  4IHF A;  4DEC A;  4KC4 A;  3FSY A;  2D7I A;  4D0Z A;  3I0K A;  1V67 A;  2D7R A;  1NMM B;  2RJ0 A;  3GVD A;  1H5S A;  1VPA A;  3SX8 A;  3OH2 A;  4LW3 A;  3R5B A;  3R5D A;  1H7Q A;  3TZT A;  3OTZ A;  2ICX A;  1H5T A;  2RJ1 A;  1S4N A;  3NZ2 A;  4Y64 A;  1SSM A;  4AC3 A;  3U2U A;  1LXA A;  1J2Z A;  3I0E A;  2Z86 A;  1EYR A;  3OAM A;  1VGT A;  3I0C A;  3EG4 A;  3CGX A;  4FRM A;  1KRU A;  5L6V A;  1ZCY A;  3P1B A;  3K8D A;  4N6A A;  5C3B A;  1JYK A;  1VIC A;  5C49 A;  4XWI A;  1FRW A;  4J09 A;  1LZ7 A;  2A8W A;  5DEP A;  2Y4J A;  1ZJP A;  2JCJ A;  4B2W A;  3JTJ A;  3R5C A;  3F1C A;  1FG5 N;  1TW5 A;  2OI5 A;  4BQH A;  5IDT A;  1E5K A;  2QIV X;  1R7T A;  4EVW A;  4HCQ A;  4HO4 A;  3SXG A;  2DPW A;  1JVG A;  3R1W A;  4EEO A;  3IOH A;  4DE7 A;  5C38 A;  1PZT A;  2WLG A;  3SX3 A;  3Q4S A;  1KWS A;  4HO3 A;  2AM4 A;  3GOS A;  1H7L A;  2Y4K A;  1HM0 A;  2V0I A;  2VS5 A;  5AFU V;  2WLF A;  1KRV A;  4MYB A;  4CVH A;  3IXC A;  5F42 A;  4G3P A;  1G95 A;  2XMH A;  1K4V A;  1ZDF A;  5E3P A;  1NF5 B;  1V83 A;  2XWL A;  2ZU9 A;  3SUC A;  4P02 A;  2W0V A;  1MP4 A;  4IHG A;  3GQ8 A;  3OKR A;  5L6S A;  5C47 A;  1R7Y A;  3HJJ A;  1EZI A;  1YP2 A;  3PKP A;  3BXY A;  3V0M A;  3RMV A;  1FGG A;  1FR9 A;  3KWC A;  2QGI A;  5EJ1 A;  1VZX A;  3TV0 A;  1FXO A;  3USQ A;  4Y7F A;  3POL A;  1HJL A;  1VH1 A;  1GWW A;  1VM8 A;  4HZC A;  1ZJO A;  5DEM A;  1G1L A;  3USR A;  4H7O A;  4NAK A;  1XHD A;  2GGO A;  2O1H A;  1IIM A;  1LZI A;  1O7Q A;  3V8Y A;  3GQA A;  4EAB A;  2WVM A;  2X65 A;  3KWE A;  2OEF A;  3CKN A;  1GWV A;  5JQQ A;  4Y6N A;  5CQL X;  3OGZ A;  5C3D A;  2FYD B;  1S4O A;  4Y63 A;  3T7N A;  2I5E A;  2RIZ A;  3U2V A;  1ZJ1 A;  1QRM A;  1INJ A;  3F1Y A;  2C0N A;  2D0J A;  2BO8 A;  3HSQ A;  4N27 A;  1R80 A;  2QKX A;  2RJ8 A;  2AQ9 A;  1OCX A;  1ZCU A;  1OQM B;  1YP3 A;  3SX5 A;  1JV3 A;  2A8U A;  3CU0 A;  4AAW A;  1QGQ A;  2XWM A;  2J0A A;  4ISX A;  2P6W A;  2VD4 A;  2XWN A;  4MIX A;  4M2A A;  2PA4 A;  1TW1 A;  3SXB A;  2FY7 A;  3DHO A;  4E6T A;  1R81 A;  2AM3 A;  4HO0 A;  1ZI4 A;  4BMA A;  2YC3 A;  4Q7C A;  3Q1X A;  1ZJ0 A;  4MZU A;  3VBM A;  5FYE A;  1WT3 A;  2JCO A;  4HO8 A;  4KNR A;  2RIJ A;  4Y9X A;  1ZI3 A;  1L0S A;  4HOC A;  3FS8 A;  3JQY A;  3U0X A;  4J18 A;  3MQH A;  4K6R A;  1FO8 A;  1ZHJ A;  4M4K A;  2PX7 A;  1GX4 A;  3QVB A;  2Z87 A;  1FOA A;  1GA8 A;  2RIX A;  2RJ9 A;  1LVW A;  2V0H A;  2W0W A;  2YQC A;  4FRB A;  3SXD A;  2RJ6 A;  4ZDQ A;  3I0I X;  4UEG A;  3RSB A;  2Y7A A;  3KWD A;  4EA7 A;  3EEV A;  4EEA A;  4Y7U A;  4AYL A;  3MQG A;  1H7G A;  3I0G A;  2FFU A;  4Y62 A;  2VFZ A;  3R3I A;  2QH5 A;  3I0D A;  5BXC A;  3R3R A;  5FTS A;  3JUK A;  2UX8 A;  3PNN A;  3R8Y A;  1KK5 A;  1G0R A;  5FTV A;  4D48 A;  4MYO A;  3SXC A;  1WVC A;  2Y4M A;  2NXV A;  1ZDG A;  4HUR A;  1QG8 A;  3FSB A;  1H4E A;  4B4B A;  3SRT A;  2WGZ A;  5C48 A;  2AGD A;  1R7X A;  3OH0 A;  5J49 A;  4D11 C;  2FKO A;  3OH4 A;  4G3Q A;  1LL2 A;  2WE9 A;  3KIA A;  4R37 A;  4CJB A;  5CMJ A;  1LL3 A;  2X60 A;  2YES A;  3VBP A;  3E25 A;  4N6B A;  1QRF A;  4FRD A;  5AJN A;  2AES A;  2XAT A;  1SSQ A;  4EA9 A;  4FQW A;  3ECT A;  5AFU U;  1G8O A;  4EGG A;  1FR8 A;  1FZW A;  3TK8 A;  1ZI5 A;  1ZIZ A;  2FYB A;  2VSI A;  1QGS A;  1H5R B;  3OTM A;  3VBI A;  4KXO A;  1SST A;  3K8E A;  2YCM A;  4B4M A;  1HM8 A;  2P2O A;  3FSC A;  5I1F A;  2AEC A;  3V0P A;  5U2K A;  4L41 C;  3FTT A;  4IHH A;  3I0F A;  3T57 A;  1ZJ3 A;  4KC2 A;  4B4G A;  3R0S A;  1GQ9 A;  3NGW A;  1ON8 A;  4FRQ A;  3VBJ A;  2AM5 A;  2VHE A;  1XAT A;  2WAW A;  3U2W A;  3ZGG A;  4B2X A;  4B5B A;  2JCK A;  3RMW A;  1G3L A;  1VGZ A;  2RJ7 A;  2BO4 A;  2PGY A;  4DCL A;  2IC7 A;  1EWW A;  2ZU8 A;  3HL3 A;  2FYA A;  1MP3 A;  3VBK A;  3DK5 A;  3FOQ A;  2APC A;  3SXE A;  1NWG B;  3EE5 A;  2RJ4 A;  2YC5 A;  2YQS A;  3BRK X;  4EA8 A;  4KNX A;  2VXL A;  2Y6P A;  3ZF8 A;  4O6M A;  4NAI A;  5DG3 A;  3ZLK A;  3FSX A;  1Z90 A;  3D5N A;  5EIY A;  5C1G A;  3V0Q A;  5CMI A;  4FRL A;  3I0J A;  4KPZ A;  3VNP A;  4EE5 A;  1NQI B;  4M2B A;  4ECM A;  5E3Q A;  1G2V A;  3CKO A;  1H5T B;  1Z2F A;  3GQ9 A;  3GQ7 A;  3N9W A;  4G87 A;  2AH9 A;  2V0K A;  1WT0 A;  4HZD A;  4KRV A;  1H5S C;  3U2T A;  4EEG A;  3SPT A;  2VXM A;  4M28 A;  4KT7 A;  1H4C A;  3OU9 A;  4E75 A;  4HO9 A;  2P72 A;  3OH3 A;  4HO2 A;  2CU2 A;  3MC4 A;  3FWW A;  2VS3 A;  1H5R A;  5CQP A;  1YRO B;  1H4D A;  1V84 A;  3IOI A;  4AYJ A;  1H5S D;  1LZJ A;  4NAN A;  3OC9 A;  1VZU A;  4HG6 A;  4ASJ A;  4IRQ A;  1S4P A;  2NPO A;  3CJ8 A;  3V4E A;  4B3U A;  3EH0 A;  2YQJ A;  5CQM X;  1WT1 A;  2ICY A;  1NKH B;  2FYC B;  2JF2 A; 
#chains in the Genus database with same CATH homology
 4M99 A;  2GGQ A;  1GQC A;  1HV9 A;  4YS8 A;  3BSY A;  1O7O A;  2WVK A;  5C4D A;  2PGV A;  5FU0 A;  3T7M A;  5C4F A;  1S80 A;  4FRA A;  3TDT A;  1G23 A;  2RIY A;  3SX7 A;  3I0L A;  1SS9 A;  1WT2 A;  1MR7 A;  2WEE A;  3CKQ A;  2JF3 A;  2BO6 A;  4FCU A;  3BCV A;  1G97 A;  1XZ6 A;  4E1K A;  1TZF A;  4EAA A;  2V0J A;  3OUP A;  1R7U A;  2J0B A;  1O0R A;  4EEM A;  1KQA A;  1R82 A;  4G3S A;  2OI7 A;  3TIS A;  2OEG A;  1VH3 A;  4FRP A;  4CJ8 A;  4O6N A;  3Q80 A;  3I3A A;  2QIA A;  3LW6 A;  4KQL A;  1FGX A;  5ADX V;  1WSZ A;  2TDT A;  2VS4 A;  2WLD A;  1QRL A;  3GUE A;  2MZB A;  1YP4 A;  3PMO A;  2ZU7 A;  3E26 A;  5IFY A;  4JD0 A;  1W55 A;  3BSS A;  2VSH A;  3Q7U A;  1ZJ2 A;  1FO9 A;  3PKQ A;  3DJ4 A;  4C2S A;  2I5K A;  3F1X A;  5EJZ A;  4EE4 A;  5D92 A;  3SXA A;  2XME A;  4M9C A;  4LW6 A;  2RJ5 A;  2RIT A;  5C4C A;  4Y7V A;  3ZGF A;  3C8V A;  2JCL A;  1VZT A;  1PZY B;  1XHB A;  4R36 A;  2E3D A;  4FCE A;  1H7F A;  4FIX A;  3VBL A;  4KPX A;  4EQY A;  2WVL A;  3V8Z A;  4FIY A;  1GX0 A;  1QRE A;  3P47 A;  1JYL A;  5HS2 A;  2IU9 A;  5CQN X;  5DDV A;  3V90 A;  3T7O A;  1G93 A;  5C3A A;  1FWY A;  3U2X A;  2O1G A;  1OMZ A;  3OH1 A;  4FRE A;  5C36 A;  1H7T A;  2FFV A;  5D91 A;  1TDT A;  4HUS A;  5C4E A;  5E3R A;  2IUA A;  4E79 A;  5C1H A;  1HJJ A;  4EE3 A;  4NAL A;  4HO6 A;  3VBN A;  1THJ A;  2WLE A;  3OW5 A;  5CMH A;  4R7P A;  1O23 B;  4JIS A;  1V3W A;  4IRP A;  4Y7G A;  3U0Y A;  3D8V A;  1QWJ A;  1INI A;  3I3X A;  3TWD A;  2E8B A;  3V0N A;  4ARW A;  1HM9 A;  1ZI1 A;  4D11 A;  1H7E A;  3CKJ A;  1I52 A;  1KGT A;  3R2W A;  2AE7 A;  5FU8 A;  3ZLL A;  1MP5 A;  4E6U A;  1TVY A;  1MRL A;  3JUJ A;  1H5S B;  2Y4L A;  4MND A;  3V0O A;  4MFG A;  1JVD A;  4N69 A;  1KHR A;  1H3M A;  3DUV A;  1KGQ A;  4Y6U A;  5C1L A;  3BFP A;  1QRG A;  3D98 A;  4AA7 A;  2OI6 A;  1V82 A;  3O3P A;  4P00 A;  4KC1 A;  1H7H A;  1LZ0 A;  3CKV A;  2P73 A;  3IOJ A;  1QQ0 A;  4M98 A;  3V0L A;  3TQD A;  4DDZ A;  1G9R A;  2BO7 A;  2YQH A;  5CQO A;  5IDS A;  1MR9 A;  1NHE B;  4B42 A;  1JV1 A;  1VGU A;  1ON6 A;  3IGJ A;  5DDT A;  4FRH A;  1LL0 A;  5CMF X;  2Q4J A;  1ZCV A;  4Y7T A;  1W77 A;  2V0L A;  2X5Z A;  1KRR A;  1KK6 A;  2O1F A;  5C4B A;  2WLC A;  1R7V A;  4ASY A;  3ST8 A;  5FV9 A;  5C8R A;  3V91 A;  1VGW A;  4FRO A;  1T3D A;  3BSW A;  3R5A A;  4CJC A;  4HO5 A;  5AJP A;  4GBP A;  1MC3 A;  2I7B A;  1KK4 A;  5AJO A;  1IIN A;  3TIO A;  2VK9 A;  1FXJ A;  3I0H A;  1OMX A;  2IU8 A;  1W57 A;  5FUH A;  2X5S A;  1ZCT A;  4D0T A;  5ADX U;  5CMG X;  4IHF A;  4DEC A;  4KC4 A;  3FSY A;  2D7I A;  4D0Z A;  3I0K A;  1V67 A;  2D7R A;  1NMM B;  2RJ0 A;  3GVD A;  1H5S A;  1VPA A;  3SX8 A;  3OH2 A;  4LW3 A;  3R5B A;  3R5D A;  1H7Q A;  3TZT A;  3OTZ A;  2ICX A;  1H5T A;  2RJ1 A;  1S4N A;  3NZ2 A;  4Y64 A;  1SSM A;  4AC3 A;  3U2U A;  1LXA A;  1J2Z A;  3I0E A;  2Z86 A;  1EYR A;  3OAM A;  1VGT A;  3I0C A;  3EG4 A;  3CGX A;  4FRM A;  1KRU A;  5L6V A;  1ZCY A;  3P1B A;  3K8D A;  4N6A A;  5C3B A;  1JYK A;  1VIC A;  5C49 A;  4XWI A;  1FRW A;  4J09 A;  1LZ7 A;  2A8W A;  5DEP A;  2Y4J A;  1ZJP A;  2JCJ A;  4B2W A;  3JTJ A;  3R5C A;  3F1C A;  1FG5 N;  1TW5 A;  2OI5 A;  4BQH A;  5IDT A;  1E5K A;  2QIV X;  1R7T A;  4EVW A;  4HCQ A;  4HO4 A;  3SXG A;  2DPW A;  1JVG A;  3R1W A;  4EEO A;  3IOH A;  4DE7 A;  5C38 A;  1PZT A;  2WLG A;  3SX3 A;  3Q4S A;  1KWS A;  4HO3 A;  2AM4 A;  3GOS A;  1H7L A;  2Y4K A;  1HM0 A;  2V0I A;  2VS5 A;  5AFU V;  2WLF A;  1KRV A;  4MYB A;  4CVH A;  3IXC A;  5F42 A;  4G3P A;  1G95 A;  2XMH A;  1K4V A;  1ZDF A;  5E3P A;  1NF5 B;  1V83 A;  2XWL A;  2ZU9 A;  4P02 A;  2W0V A;  1MP4 A;  4IHG A;  3OKR A;  5L6S A;  5C47 A;  1R7Y A;  3HJJ A;  1EZI A;  1YP2 A;  3PKP A;  3BXY A;  3V0M A;  3RMV A;  1FGG A;  1FR9 A;  3KWC A;  2QGI A;  5EJ1 A;  1VZX A;  3TV0 A;  1FXO A;  3USQ A;  4Y7F A;  3POL A;  1HJL A;  1VH1 A;  1GWW A;  1VM8 A;  4HZC A;  1ZJO A;  5DEM A;  1G1L A;  3USR A;  4H7O A;  4NAK A;  1XHD A;  2GGO A;  2O1H A;  1IIM A;  1LZI A;  1O7Q A;  3V8Y A;  4EAB A;  2X65 A;  2WVM A;  5JQQ A;  3KWE A;  2OEF A;  3CKN A;  1GWV A;  4Y6N A;  5CQL X;  3OGZ A;  5C3D A;  2FYD B;  1S4O A;  4Y63 A;  3T7N A;  2I5E A;  2RIZ A;  3U2V A;  1ZJ1 A;  1QRM A;  1INJ A;  3F1Y A;  2C0N A;  2D0J A;  2BO8 A;  3HSQ A;  4N27 A;  1R80 A;  2QKX A;  2RJ8 A;  2AQ9 A;  1OCX A;  1ZCU A;  1OQM B;  1YP3 A;  3SX5 A;  1JV3 A;  2A8U A;  3CU0 A;  4AAW A;  1QGQ A;  2XWM A;  2J0A A;  4ISX A;  2P6W A;  2VD4 A;  2XWN A;  4MIX A;  4M2A A;  2PA4 A;  1TW1 A;  3SXB A;  2FY7 A;  3DHO A;  4E6T A;  1R81 A;  2AM3 A;  4HO0 A;  1ZI4 A;  4BMA A;  2YC3 A;  4Q7C A;  3Q1X A;  1ZJ0 A;  4MZU A;  3VBM A;  5FYE A;  1WT3 A;  2JCO A;  4HO8 A;  4KNR A;  2RIJ A;  4Y9X A;  1ZI3 A;  4HOC A;  3FS8 A;  3JQY A;  3U0X A;  4J18 A;  3MQH A;  4K6R A;  1FO8 A;  1ZHJ A;  4M4K A;  2PX7 A;  1GX4 A;  3QVB A;  2Z87 A;  1FOA A;  1GA8 A;  2RIX A;  2RJ9 A;  1LVW A;  2V0H A;  2W0W A;  2YQC A;  4FRB A;  3SXD A;  2RJ6 A;  4ZDQ A;  3I0I X;  4UEG A;  3RSB A;  2Y7A A;  3KWD A;  4EA7 A;  3EEV A;  4EEA A;  4Y7U A;  4AYL A;  3MQG A;  1H7G A;  3I0G A;  2FFU A;  4Y62 A;  2VFZ A;  3R3I A;  2QH5 A;  3I0D A;  5BXC A;  3R3R A;  5FTS A;  3JUK A;  2UX8 A;  3PNN A;  3R8Y A;  1KK5 A;  1G0R A;  5FTV A;  4D48 A;  4MYO A;  3SXC A;  1WVC A;  2Y4M A;  2NXV A;  1ZDG A;  4HUR A;  1QG8 A;  3FSB A;  1H4E A;  4B4B A;  3SRT A;  2WGZ A;  5C48 A;  2AGD A;  1R7X A;  3OH0 A;  5J49 A;  4D11 C;  2FKO A;  3OH4 A;  4G3Q A;  1LL2 A;  2WE9 A;  3KIA A;  4R37 A;  4CJB A;  5CMJ A;  1LL3 A;  2X60 A;  2YES A;  3VBP A;  3E25 A;  4N6B A;  1QRF A;  4FRD A;  5AJN A;  2AES A;  2XAT A;  1SSQ A;  4EA9 A;  4FQW A;  3ECT A;  5AFU U;  1G8O A;  4EGG A;  1FR8 A;  1FZW A;  3TK8 A;  1ZI5 A;  1ZIZ A;  2FYB A;  2VSI A;  1QGS A;  1H5R B;  3OTM A;  3VBI A;  4KXO A;  1SST A;  3K8E A;  2YCM A;  4B4M A;  1HM8 A;  2P2O A;  3FSC A;  5I1F A;  2AEC A;  3V0P A;  5U2K A;  4L41 C;  3FTT A;  4IHH A;  3I0F A;  3T57 A;  1ZJ3 A;  4KC2 A;  4B4G A;  3R0S A;  1GQ9 A;  3NGW A;  1ON8 A;  4FRQ A;  3VBJ A;  2AM5 A;  2VHE A;  1XAT A;  2WAW A;  3U2W A;  3ZGG A;  4B2X A;  4B5B A;  2JCK A;  3RMW A;  1G3L A;  1VGZ A;  2RJ7 A;  2BO4 A;  2PGY A;  4DCL A;  2IC7 A;  2ZU8 A;  3HL3 A;  2FYA A;  1MP3 A;  3VBK A;  3DK5 A;  3FOQ A;  2APC A;  3SXE A;  1NWG B;  3EE5 A;  2RJ4 A;  2YC5 A;  2YQS A;  3BRK X;  4EA8 A;  4KNX A;  2VXL A;  2Y6P A;  3ZF8 A;  4O6M A;  4NAI A;  5DG3 A;  3ZLK A;  3FSX A;  1Z90 A;  3D5N A;  5EIY A;  5C1G A;  3V0Q A;  5CMI A;  4FRL A;  3I0J A;  4KPZ A;  3VNP A;  4EE5 A;  1NQI B;  4M2B A;  4ECM A;  5E3Q A;  1G2V A;  3CKO A;  1H5T B;  3N9W A;  4G87 A;  2AH9 A;  2V0K A;  1WT0 A;  4HZD A;  4KRV A;  1H5S C;  3U2T A;  4EEG A;  3SPT A;  2VXM A;  4M28 A;  4KT7 A;  1H4C A;  3OU9 A;  4E75 A;  4HO9 A;  2P72 A;  3OH3 A;  4HO2 A;  2CU2 A;  3MC4 A;  3FWW A;  2VS3 A;  1H5R A;  5CQP A;  1YRO B;  1H4D A;  1V84 A;  3IOI A;  4AYJ A;  1H5S D;  1LZJ A;  4NAN A;  3OC9 A;  1VZU A;  4HG6 A;  4ASJ A;  4IRQ A;  1S4P A;  2NPO A;  3CJ8 A;  3V4E A;  4B3U A;  3EH0 A;  2YQJ A;  5CQM X;  1WT1 A;  2ICY A;  1NKH B;  2FYC B;  2JF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...