3BRKX

Crystal structure of adp-glucose pyrophosphorylase from agrobacterium tumefaciens
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
412
structure length
395
Chain Sequence
QPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFRPERNESFDILPASWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural analysis of ADP-glucose pyrophosphorylase from the bacterium Agrobacterium tumefaciens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transferase
total genus 107
structure length 395
sequence length 412
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3brkX02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3brkX01
5U2KA 4EA9A 4G3SA 3CJ8A 5CQPA 1LL3A 4R36A 3R8YA 2RJ7A 2WVKA 4DDZA 1HM8A 3FSCA 2X5ZA 4EE4A 4M28A 2RJ9A 5IDTA 5E3RA 2IU8A 1VH1A 3PNNA 1H7TA 2AESA 3D98A 3Q1XA 2P72A 1EYRA 1VICA 2O1FA 2VD4A 3TDTA 3KIAA 4B42A 1PZTA 1QRFA 3OTMA 3R5CA 1ZCUA 2RJ4A 3OH0A 5FV9A 4HO9A 1H5SA 1G3LA 4FRQA 2MZBA 4EE3A 3V4EA 2AGDA 4EE5A 4MFGA 3VBKA 2FKOA 4M2AA 4FRPA 4HCQA 1KHRA 4FRAA 3N9WA 1ZDFA 1NHEB 1ZI4A 4MYBA 5C1HA 5ADXU 5C47A 2OEGA 1E5KA 2OI6A 3MQGA 2BO7A 2JCLA 3SXGA 3C8VA 1JV3A 3QVBA 3ZLKA 2IU9A 2VHEA 5CMIA 3BCVA 1VGWA 4CJ8A 4LW3A 1S4PA 4KC4A 2E3DA 3JUKA 4Y6NA 1FR9A 5C3AA 2UX8A 4J18A 1YROB 1TZFA 4N27A 4E6TA 1ZHJA 1GWWA 3USQA 1S4NA 3U2VA 3D5NA 1KRUA 3I0CA 2AE7A 3OH4A 3PKPA 4CVHA 1R7VA 3T7MA 3CKQA 1H7EA 5C4CA 4Y62A 4MZUA 2AM5A 4EAAA 4BQHA 1H4CA 2RJ1A 1ZJ0A 2FYDB 4MNDA 5C49A 2JF3A 1PZYB 1QRMA 1ZI5A 3I0DA 4HO4A 2E8BA 1H5RA 2Y4MA 2Y7AA 4HG6A 3MC4A 1O7OA 3V8YA 1FZWA 4B5BA 3NZ2A 3SXDA 2I5KA 2Q4JA 4DECA 2Z86A 1WVCA 1FWYA 4L41C 1EZIA 2WAWA 5C4BA 2XWMA 1LVWA 3BSSA 1OQMB 1WSZA 1ZDGA 4AAWA 4D0TA 2GGOA 3R3RA 1KRRA 1O23B 1FOAA 5JQQA 3V0OA 1HJJA 5BXCA 5ADXV 3IOIA 2V0IA 4N6BA 5CQOA 3TZTA 3U2XA 1YP4A 3KWCA 4EA7A 3ZGFA 4EEMA 1JYKA 1S4OA 3FTTA 4FROA 2RJ5A 3POLA 1ZJPA 4IHFA 2APCA 5DEMA 1ZCVA 3VBMA 2VFZA 4ISXA 1FR8A 1H5SB 4ECMA 2IUAA 2P6WA 4HO8A 1V3WA 3U2TA 2WLFA 3F1YA 3I0JA 5I1FA 1HM9A 1W55A 4GBPA 3LW6A 1H5TA 5EIYA 3OTZA 5DDTA 3IXCA 1H7LA 3V0QA 2OI5A 2RJ6A 5DDVA 2V0KA 3GOSA 1XHDA 3ZLLA 4HO5A 3DK5A 4CJBA 4K6RA 5C3DA 1QGSA 5AJNA 3FWWA 3I0KA 4HUSA 3EG4A 3I0HA 3OW5A 4Y63A 3T7NA 5C1LA 5HS2A 3TV0A 5C4DA 1HV9A 1INJA 3SXBA 4LW6A 1G93A 3KWDA 2I5EA 1MRLA 1IIMA 2PGVA 4NAKA 1GQ9A 3BXYA 2D7IA 4CJCA 1LXAA 4KPZA 1K4VA 1SSMA 4KXOA 4R37A 2X65A 3SXAA 1OCXA 3SX8A 3SPTA 1SSQA 2NXVA 4B4GA 1GX4A 5FU8A 1GA8A 3OH2A 4Y6UA 4Y7FA 3TK8A 4FRBA 2WLGA 3DHOA 2V0LA 3IGJA 4FRDA 1H5RB 1MP5A 1XHBA 4B4MA 4FRHA 4KC1A 4HURA 3V91A 3V0LA 2ZU9A 3VBJA 4ZDQA 2D0JA 4FCEA 4NALA 2WVMA 2Y6PA 1VZTA 4EEGA 4KRVA 4NANA 4EVWA 4M2BA 3SXEA 2ZU7A 4HZDA 4FRMA 5C4EA 3EE5A 3JQYA 2WVLA 3VNPA 4FCUA 3F1CA 4E75A 1GWVA 1MR9A 2JCOA 4HO2A 1WT0A 1THJA 4AC3A 3OUPA 5FU0A 1TDTA 1JV1A 1INIA 4DCLA 5E3PA 3BRKX 3T57A 5AFUU 5C3BA 1R80A 1NF5B 4HOCA 1LZ0A 1H4DA 3E26A 1VZUA 1VH3A 2YQHA 2O1GA 1QQ0A 3MQHA 1QREA 3V0PA 5C48A 2GGQA 3U0XA 3U2WA 1G1LA 4MYOA 5CMFX 3OC9A 1LZ7A 1W77A 4E1KA 4UEGA 5C36A 2JF2A 2WLDA 3IOHA 5CQNX 1FGGA 4FQWA 1TW5A 3SX3A 2VS5A 3I3AA 4P02A 2XATA 2QKXA 1H5TB 1XATA 3KWEA 3D8VA 1ZIZA 5CQLX 2JCKA 2P2OA 5DEPA 2RJ8A 4KC2A 2W0WA 2BO8A 5IFYA 1H4EA 4Y7UA 2FYCB 4B4BA 4DE7A 2X5SA 4FREA 4G3QA 4B2XA 3FOQA 1H5SD 1FGXA 2IC7A 4N69A 4Y9XA 4AYLA 1R81A 5C38A 3CU0A 2WE9A 1G97A 1VPAA 1FO9A 5C4FA 2VSIA 1V84A 2FYAA 2AECA 5FYEA 3GVDA 1R7TA 2D7RA 1ON6A 2A8UA 3SX5A 1R7YA 3OGZA 1VZXA 2PA4A 2YQCA 3Q80A 3OKRA 3P1BA 1O7QA 3R5BA 1QGQA 3U0YA 4JISA 4HZCA 1ZI3A 1LL2A 1FXJA 1G95A 1V82A 4EEOA 5E3QA 1ZJ1A 3U2UA 4ASYA 3R2WA 2P73A 2YCMA 3CKJA 1MP3A 1KK5A 3EH0A 1G0RA 4NAIA 1QG8A 4Y7VA 1WT2A 1JVDA 4XWIA 4Y64A 4AA7A 1WT3A 1VM8A 1IINA 2WEEA 5AFUV 1T3DA 1YP2A 2QH5A 5C1GA 3V90A 1H7GA 4G87A 2Y4LA 1WT1A 4M98A 3R1WA 2X60A 2FFUA 4YS8A 3DJ4A 3FS8A 1KRVA 4FRLA 4EGGA 3K8EA 1VGZA 1KQAA 2YQJA 1NKHB 2NPOA 1KK4A 4B3UA 2RJ0A 2ZU8A 1R82A 3RMVA 2WGZA 5L6SA 2OI7A 1G9RA 1ZI1A 4R7PA 1FO8A 3HL3A 1TW1A 1QRGA 4M9CA 1ZCTA 5AJPA 3OU9A 3TIOA 1I52A 4ASJA 4KPXA 2FYBA 3Q7UA 3ZGGA 1OMXA 1ZJ3A 3Q4SA 4D0ZA 5FTSA 1ZCYA 4KT7A 4EABA 1VGTA 5AJOA 2QGIA 4Y7TA 3CKOA 1XZ6A 5EJ1A 4KQLA 3EEVA 2WLEA 2XMEA 1KGTA 4N6AA 3CGXA 2QIAA 4EEAA 3I0LA 3SXCA 4EA8A 2RIXA 1ZJOA 5L6VA 1HM0A 1MC3A 3GUEA 3JTJA 5F42A 1MR7A 4G3PA 3I0EA 3SRTA 1YP3A 2ICYA 3VBNA 2VXMA 3F1XA 4HO3A 4M4KA 5DG3A 1KWSA 3V0MA 2Y4KA 1S80A 4HO0A 3R5AA 2RIZA 3RMWA 2W0VA 1R7UA 5CMJA 3BFPA 4B2WA 3I0IX 3PMOA 1H7HA 3I3XA 5C8RA 2YESA 3FSBA 1G8OA 1V83A 2TDTA 2XMHA 5FTVA 2AM3A 2V0JA 1OMZA 2VXLA 1O0RA 5J49A 2QIVX 1LL0A 2PX7A 2Y4JA 5FUHA 3OAMA 3ECTA 3V0NA 3T7OA 4ARWA 4J09A 2RIYA 4E79A 3CKVA 2V0HA 3IOJA 3TISA 1LZIA 3OH1A 2AM4A 1GQCA 1W57A 2VS4A 3VBIA 4KNXA 3JUJA 1JVGA 4D11C 2A8WA 1KGQA 3SX7A 2OEFA 1TVYA 4E6UA 4EQYA 1G23A 2DPWA 2RITA 3RSBA 3BSWA 1VGUA 1HJLA 2PGYA 3ST8A 4HO6A 4P00A 1NWGB 3R0SA 1V67A 2O1HA 3PKQA 1FXOA 2ICXA 2WLCA 1R7XA 1NQIB 1FG5N 4IHHA 3I0GA 2BO6A 1JYLA 2XWLA 1SS9A 2VSHA 2YC5A 4D11A 4C2SA 2BO4A 4KNRA 5CMHA 4D48A 1H7FA 3I0FA 2I7BA 1MP4A 4JD0A 2AQ9A 2XWNA 1H7QA 2Z87A 2AH9A 3HSQA 2FFVA 2JCJA 1ON8A 3FSXA 2VS3A 3OH3A 1SSTA 3NGWA 4H7OA 4IRPA 2RIJA 3VBLA 1QWJA 1GX0A 2YQSA 1LZJA 1H3MA 3P47A 4M99A 5IDSA 3R5DA 4IHGA 1QRLA 3CKNA 4Y7GA 3USRA 3DUVA 5CQMX 1NMMB 3BSYA 5EJZA 4BMAA 5CMGX 3V8ZA 3FSYA 2FY7A 3K8DA 3TWDA 1G2VA 3HJJA 1KK6A 3VBPA 4AYJA 1ZJ2A 3TQDA 3O3PA 4IRQA 1Z90A 3E25A 3R3IA 1J2ZA 2CU2A 3ZF8A 1FRWA 2YC3A 1H5SC
chains in the Genus database with same CATH superfamily
5U2KA 4EA9A 4G3SA 3CJ8A 5CQPA 1LL3A 4R36A 3R8YA 2RJ7A 2WVKA 4DDZA 1HM8A 3FSCA 2X5ZA 4EE4A 4M28A 2RJ9A 5IDTA 5E3RA 2IU8A 1VH1A 3PNNA 1H7TA 2AESA 3D98A 3Q1XA 2P72A 1EYRA 1VICA 2O1FA 2VD4A 3TDTA 3KIAA 4B42A 1PZTA 1QRFA 3OTMA 3R5CA 1ZCUA 3OH0A 2RJ4A 5FV9A 4HO9A 1H5SA 1G3LA 4FRQA 2MZBA 4EE3A 3V4EA 2AGDA 4EE5A 4MFGA 3VBKA 2FKOA 4M2AA 4FRPA 4HCQA 1KHRA 4FRAA 3N9WA 1ZDFA 1NHEB 1ZI4A 4MYBA 5C1HA 5ADXU 5C47A 2OEGA 1E5KA 2OI6A 3MQGA 2BO7A 2JCLA 4FIYA 3SXGA 3C8VA 1JV3A 3QVBA 3ZLKA 2IU9A 2VHEA 5CMIA 3BCVA 1VGWA 4CJ8A 4LW3A 1S4PA 4KC4A 2E3DA 3JUKA 4Y6NA 1M8NA 1FR9A 5C3AA 2UX8A 4J18A 1YROB 1TZFA 4N27A 4E6TA 1ZHJA 1GWWA 3USQA 1S4NA 3U2VA 3D5NA 1KRUA 3I0CA 2AE7A 3OH4A 3PKPA 4CVHA 1R7VA 3T7MA 3CKQA 1H7EA 5C4CA 4Y62A 4MZUA 2AM5A 4EAAA 4BQHA 1H4CA 2RJ1A 1ZJ0A 2FYDB 4MNDA 5C49A 2JF3A 1PZYB 1QRMA 1ZI5A 3I0DA 4HO4A 2E8BA 1H5RA 2Y4MA 2Y7AA 4HG6A 3MC4A 1O7OA 3V8YA 1FZWA 4B5BA 3NZ2A 3SXDA 2I5KA 2Q4JA 1EWWA 4DECA 2Z86A 1WVCA 1FWYA 4L41C 1N4IA 1EZIA 2WAWA 5C4BA 2XWMA 1LVWA 3BSSA 1OQMB 1WSZA 1ZDGA 4AAWA 4D0TA 2GGOA 3R3RA 1KRRA 1O23B 1FOAA 5JQQA 3V0OA 1HJJA 5BXCA 5ADXV 3IOIA 2V0IA 4N6BA 5CQOA 3TZTA 3U2XA 1YP4A 3KWCA 4EA7A 3ZGFA 4EEMA 1JYKA 1S4OA 3FTTA 4FROA 2RJ5A 3POLA 1ZJPA 4IHFA 2APCA 5DEMA 1ZCVA 3VBMA 2VFZA 4ISXA 1FR8A 1H5SB 4ECMA 2IUAA 2P6WA 4HO8A 1V3WA 3U2TA 2WLFA 3F1YA 3I0JA 5I1FA 1HM9A 1W55A 4FIXA 4GBPA 3LW6A 1H5TA 5EIYA 3OTZA 5DDTA 3IXCA 1H7LA 3V0QA 2OI5A 2RJ6A 5DDVA 2V0KA 3GOSA 1XHDA 3ZLLA 4HO5A 3DK5A 4CJBA 4K6RA 5C3DA 1QGSA 5AJNA 3FWWA 3I0KA 4HUSA 3EG4A 3I0HA 3OW5A 4Y63A 3T7NA 5C1LA 5HS2A 3TV0A 5C4DA 1HV9A 1INJA 3SXBA 4LW6A 1G93A 3KWDA 2I5EA 1MRLA 1IIMA 2PGVA 4NAKA 1GQ9A 3BXYA 2D7IA 4CJCA 1LXAA 4KPZA 1K4VA 1SSMA 4KXOA 4R37A 2X65A 3SXAA 1OCXA 3SX8A 3SPTA 1SSQA 2NXVA 4B4GA 1GX4A 3GQ9A 3GQAA 1GA8A 5FU8A 3OH2A 4Q7CA 4Y6UA 4Y7FA 3TK8A 4FRBA 2WLGA 3DHOA 2V0LA 3IGJA 4FRDA 1H5RB 1MP5A 1XHBA 4B4MA 4FRHA 4KC1A 4HURA 3V91A 3V0LA 2ZU9A 3VBJA 4ZDQA 2D0JA 4FCEA 4NALA 2WVMA 2Y6PA 1VZTA 4EEGA 4KRVA 4NANA 4EVWA 4M2BA 3SXEA 2ZU7A 4HZDA 4FRMA 5C4EA 3EE5A 3JQYA 2WVLA 3VNPA 4FCUA 3F1CA 4E75A 1GWVA 1MR9A 2JCOA 4HO2A 1WT0A 1THJA 4AC3A 3OUPA 5FU0A 1TDTA 1JV1A 1INIA 4DCLA 5E3PA 3BRKX 3T57A 5AFUU 5C3BA 1R80A 1NF5B 4HOCA 1LZ0A 1H4DA 3E26A 1VZUA 1VH3A 2YQHA 2O1GA 1QQ0A 3GQ7A 3MQHA 1QREA 3V0PA 5C48A 2GGQA 3U0XA 3U2WA 1G1LA 4MYOA 5CMFX 3OC9A 1LZ7A 1W77A 4O6MA 4E1KA 4UEGA 5C36A 2JF2A 2WLDA 3IOHA 5CQNX 1FGGA 4FQWA 1TW5A 3SX3A 2VS5A 3I3AA 4P02A 2XATA 2QKXA 1H5TB 1XATA 3KWEA 3D8VA 1ZIZA 5CQLX 2JCKA 2P2OA 5DEPA 2RJ8A 4KC2A 2W0WA 2BO8A 5IFYA 1H4EA 4Y7UA 2FYCB 4B4BA 4DE7A 2X5SA 4FREA 4G3QA 4B2XA 3FOQA 1H5SD 1FGXA 2IC7A 4N69A 4Y9XA 4AYLA 1R81A 5C38A 3CU0A 2WE9A 1G97A 1VPAA 1FO9A 5C4FA 2VSIA 1V84A 2FYAA 2AECA 5FYEA 3GVDA 1R7TA 2D7RA 1ON6A 2A8UA 3SX5A 3OGZA 1R7YA 1VZXA 2PA4A 2YQCA 3Q80A 3OKRA 3P1BA 1O7QA 3R5BA 1QGQA 3U0YA 4JISA 4HZCA 1ZI3A 1LL2A 1FXJA 1G95A 1V82A 4EEOA 5E3QA 1ZJ1A 3U2UA 4ASYA 3R2WA 2P73A 2YCMA 3CKJA 1MP3A 1KK5A 3EH0A 1G0RA 4NAIA 1QG8A 4Y7VA 1WT2A 1JVDA 4XWIA 5D91A 4Y64A 4AA7A 4O6NA 1WT3A 1VM8A 1IINA 2WEEA 5AFUV 1T3DA 1YP2A 2QH5A 5C1GA 3V90A 1H7GA 4G87A 2Y4LA 1WT1A 4M98A 3R1WA 2X60A 2FFUA 4YS8A 3DJ4A 3FS8A 1KRVA 4FRLA 4EGGA 3K8EA 1VGZA 1KQAA 2YQJA 1NKHB 2NPOA 1KK4A 4B3UA 2RJ0A 2ZU8A 1R82A 3RMVA 2WGZA 5L6SA 2OI7A 1G9RA 1ZI1A 4R7PA 1FO8A 3HL3A 1TW1A 1QRGA 4M9CA 1ZCTA 5AJPA 3OU9A 3TIOA 1I52A 4ASJA 4KPXA 2FYBA 3Q7UA 3ZGGA 1OMXA 1ZJ3A 3Q4SA 4D0ZA 5FTSA 1ZCYA 4KT7A 4EABA 1VGTA 5AJOA 2QGIA 4Y7TA 3CKOA 1XZ6A 2VK9A 5EJ1A 4KQLA 3EEVA 2WLEA 2XMEA 1KGTA 4N6AA 3CGXA 2QIAA 4EEAA 3I0LA 3SXCA 4EA8A 2RIXA 5D92A 1ZJOA 5L6VA 1HM0A 1MC3A 3GUEA 3JTJA 5F42A 1MR7A 4G3PA 3I0EA 3SRTA 3GQ8A 1YP3A 2ICYA 3VBNA 2C0NA 2VXMA 3F1XA 4HO3A 4M4KA 5DG3A 1KWSA 3V0MA 2Y4KA 1S80A 4HO0A 3R5AA 2RIZA 3RMWA 2W0VA 1R7UA 5CMJA 3BFPA 4B2WA 3I0IX 3PMOA 1H7HA 3I3XA 5C8RA 2YESA 3FSBA 1G8OA 1V83A 2TDTA 3SUCA 2XMHA 5FTVA 2AM3A 2V0JA 1OMZA 2VXLA 1O0RA 5J49A 2QIVX 1LL0A 2PX7A 2Y4JA 5FUHA 3OAMA 3ECTA 3V0NA 3T7OA 4ARWA 4J09A 2RIYA 4E79A 3CKVA 2J0BA 2V0HA 3IOJA 3TISA 3OH1A 1LZIA 2AM4A 1GQCA 1W57A 2VS4A 3VBIA 4MIXA 4KNXA 3JUJA 1JVGA 4D11C 2A8WA 1KGQA 3SX7A 2OEFA 1TVYA 1L0SA 4E6UA 4EQYA 1G23A 2DPWA 2RITA 3RSBA 3BSWA 1VGUA 1HJLA 2PGYA 3ST8A 4HO6A 4P00A 1NWGB 3R0SA 1V67A 2O1HA 3PKQA 1FXOA 2ICXA 2WLCA 1R7XA 1NQIB 1FG5N 4IHHA 3I0GA 2BO6A 1JYLA 2XWLA 1SS9A 2VSHA 2YC5A 4D11A 4C2SA 2BO4A 4KNRA 5CMHA 4D48A 1H7FA 3I0FA 2I7BA 1MP4A 4JD0A 2AQ9A 1Z2FA 2XWNA 1H7QA 2Z87A 2AH9A 3HSQA 2FFVA 2JCJA 3OH3A 3FSXA 1ON8A 2VS3A 1SSTA 3NGWA 4H7OA 4IRPA 2RIJA 3VBLA 1QWJA 1GX0A 2YQSA 3P47A 1H3MA 4M99A 1LZJA 5IDSA 3R5DA 4IHGA 1QRLA 3CKNA 4Y7GA 3USRA 3DUVA 5CQMX 1NMMB 3BSYA 5EJZA 4BMAA 5CMGX 3V8ZA 3FSYA 2FY7A 2J0AA 3K8DA 3TWDA 1G2VA 3HJJA 1KK6A 3VBPA 4AYJA 1ZJ2A 3TQDA 3O3PA 4IRQA 1Z90A 3E25A 3R3IA 1J2ZA 2CU2A 3ZF8A 1FRWA 2YC3A 1H5SC
chains in the Genus database with same CATH topology
5U2KA 4EA9A 4G3SA 3CJ8A 5CQPA 1LL3A 4R36A 3R8YA 2RJ7A 2WVKA 4DDZA 1HM8A 3FSCA 2X5ZA 4EE4A 4M28A 2RJ9A 5IDTA 5E3RA 2IU8A 1VH1A 3PNNA 1H7TA 2AESA 3D98A 3Q1XA 2P72A 1EYRA 1VICA 2O1FA 2VD4A 3TDTA 3KIAA 4B42A 1PZTA 1QRFA 3OTMA 3R5CA 1ZCUA 2RJ4A 3OH0A 5FV9A 4HO9A 1H5SA 1G3LA 4FRQA 2MZBA 4EE3A 3V4EA 2AGDA 4EE5A 4MFGA 3VBKA 2FKOA 4M2AA 4FRPA 4HCQA 1KHRA 4FRAA 3N9WA 1ZDFA 1NHEB 1ZI4A 4MYBA 5C1HA 5ADXU 5C47A 2OEGA 1E5KA 2OI6A 3MQGA 2BO7A 2JCLA 4FIYA 3SXGA 3C8VA 1JV3A 3QVBA 3ZLKA 2IU9A 2VHEA 5CMIA 3BCVA 1VGWA 4CJ8A 4LW3A 1S4PA 4KC4A 2E3DA 3JUKA 4Y6NA 1FR9A 5C3AA 2UX8A 4J18A 1YROB 1TZFA 4N27A 4E6TA 1ZHJA 1GWWA 3USQA 1S4NA 3U2VA 3D5NA 1KRUA 3I0CA 2AE7A 3OH4A 3PKPA 4CVHA 1R7VA 3T7MA 3CKQA 1H7EA 5C4CA 4Y62A 4MZUA 2AM5A 4EAAA 4BQHA 1H4CA 2RJ1A 1ZJ0A 2FYDB 4MNDA 5C49A 2JF3A 1PZYB 1QRMA 1ZI5A 3I0DA 4HO4A 2E8BA 1H5RA 2Y4MA 2Y7AA 4HG6A 3MC4A 1O7OA 3V8YA 1FZWA 4B5BA 3NZ2A 3SXDA 2I5KA 2Q4JA 4DECA 2Z86A 1WVCA 1FWYA 4L41C 1EZIA 2WAWA 5C4BA 2XWMA 1LVWA 3BSSA 1OQMB 1WSZA 1ZDGA 4AAWA 4D0TA 2GGOA 3R3RA 1KRRA 1O23B 1FOAA 5JQQA 3V0OA 1HJJA 5BXCA 5ADXV 3IOIA 2V0IA 4N6BA 5CQOA 3TZTA 3U2XA 1YP4A 3KWCA 4EA7A 3ZGFA 4EEMA 1JYKA 1S4OA 3FTTA 4FROA 2RJ5A 3POLA 1ZJPA 4IHFA 2APCA 5DEMA 1ZCVA 3VBMA 2VFZA 4ISXA 1FR8A 1H5SB 4ECMA 2IUAA 2P6WA 4HO8A 1V3WA 3U2TA 2WLFA 3F1YA 3I0JA 5I1FA 1HM9A 1W55A 4FIXA 4GBPA 3LW6A 1H5TA 5EIYA 3OTZA 5DDTA 3IXCA 1H7LA 3V0QA 2OI5A 2RJ6A 5DDVA 2V0KA 3GOSA 1XHDA 3ZLLA 4HO5A 3DK5A 4CJBA 4K6RA 5C3DA 1QGSA 5AJNA 3FWWA 3I0KA 4HUSA 3EG4A 3I0HA 3OW5A 4Y63A 3T7NA 5C1LA 5HS2A 3TV0A 5C4DA 1HV9A 1INJA 3SXBA 4LW6A 1G93A 3KWDA 2I5EA 1MRLA 1IIMA 2PGVA 4NAKA 1GQ9A 3BXYA 2D7IA 4CJCA 1LXAA 4KPZA 1K4VA 1SSMA 4KXOA 4R37A 2X65A 3SXAA 1OCXA 3SX8A 3SPTA 1SSQA 2NXVA 4B4GA 1GX4A 5FU8A 1GA8A 3OH2A 4Q7CA 4Y6UA 4Y7FA 3TK8A 4FRBA 2WLGA 3DHOA 2V0LA 3IGJA 4FRDA 1H5RB 1MP5A 1XHBA 4B4MA 4FRHA 4KC1A 4HURA 3V91A 3V0LA 2ZU9A 3VBJA 4ZDQA 2D0JA 4FCEA 4NALA 2WVMA 2Y6PA 1VZTA 4EEGA 4KRVA 4NANA 4EVWA 4M2BA 3SXEA 2ZU7A 4HZDA 4FRMA 5C4EA 3EE5A 3JQYA 2WVLA 3VNPA 4FCUA 3F1CA 4E75A 1GWVA 1MR9A 2JCOA 4HO2A 1WT0A 1THJA 4AC3A 3OUPA 5FU0A 1TDTA 1JV1A 1INIA 4DCLA 5E3PA 3BRKX 3T57A 5AFUU 5C3BA 1R80A 1NF5B 4HOCA 1LZ0A 1H4DA 3E26A 1VZUA 1VH3A 2YQHA 2O1GA 1QQ0A 3MQHA 1QREA 3V0PA 5C48A 2GGQA 3U0XA 3U2WA 1G1LA 4MYOA 5CMFX 3OC9A 1LZ7A 1W77A 4O6MA 4E1KA 4UEGA 5C36A 2JF2A 2WLDA 3IOHA 5CQNX 1FGGA 4FQWA 1TW5A 3SX3A 2VS5A 3I3AA 4P02A 2XATA 2QKXA 1H5TB 1XATA 3KWEA 3D8VA 1ZIZA 5CQLX 2JCKA 2P2OA 5DEPA 2RJ8A 4KC2A 2W0WA 2BO8A 5IFYA 1H4EA 4Y7UA 2FYCB 4B4BA 4DE7A 2X5SA 4FREA 4G3QA 4B2XA 3FOQA 1H5SD 1FGXA 2IC7A 4N69A 4Y9XA 4AYLA 1R81A 5C38A 3CU0A 2WE9A 1G97A 1VPAA 1FO9A 5C4FA 2VSIA 1V84A 2FYAA 2AECA 5FYEA 3GVDA 1R7TA 2D7RA 1ON6A 2A8UA 3SX5A 1R7YA 3OGZA 1VZXA 2PA4A 2YQCA 3Q80A 3OKRA 3P1BA 1O7QA 3R5BA 1QGQA 3U0YA 4JISA 4HZCA 1ZI3A 1LL2A 1FXJA 1G95A 1V82A 4EEOA 5E3QA 1ZJ1A 3U2UA 4ASYA 3R2WA 2P73A 2YCMA 3CKJA 1MP3A 1KK5A 3EH0A 1G0RA 4NAIA 1QG8A 4Y7VA 1WT2A 1JVDA 4XWIA 5D91A 4Y64A 4AA7A 4O6NA 1WT3A 1VM8A 1IINA 2WEEA 5AFUV 1T3DA 1YP2A 2QH5A 5C1GA 3V90A 1H7GA 4G87A 2Y4LA 1WT1A 4M98A 3R1WA 2X60A 2FFUA 4YS8A 3DJ4A 3FS8A 1KRVA 4FRLA 4EGGA 3K8EA 1VGZA 1KQAA 2YQJA 1NKHB 2NPOA 1KK4A 4B3UA 2RJ0A 2ZU8A 1R82A 3RMVA 2WGZA 5L6SA 2OI7A 1G9RA 1ZI1A 4R7PA 1FO8A 3HL3A 1TW1A 1QRGA 4M9CA 1ZCTA 5AJPA 3OU9A 3TIOA 1I52A 4ASJA 4KPXA 2FYBA 3Q7UA 3ZGGA 1OMXA 1ZJ3A 3Q4SA 4D0ZA 5FTSA 1ZCYA 4KT7A 4EABA 1VGTA 5AJOA 2QGIA 4Y7TA 3CKOA 1XZ6A 2VK9A 5EJ1A 4KQLA 3EEVA 2WLEA 2XMEA 1KGTA 4N6AA 3CGXA 2QIAA 4EEAA 3I0LA 3SXCA 4EA8A 2RIXA 5D92A 1ZJOA 5L6VA 1HM0A 1MC3A 3GUEA 3JTJA 5F42A 1MR7A 4G3PA 3I0EA 3SRTA 1YP3A 2ICYA 3VBNA 2C0NA 2VXMA 3F1XA 4HO3A 4M4KA 5DG3A 1KWSA 3V0MA 2Y4KA 1S80A 4HO0A 3R5AA 2RIZA 3RMWA 2W0VA 1R7UA 5CMJA 3BFPA 4B2WA 3I0IX 3PMOA 1H7HA 3I3XA 5C8RA 2YESA 3FSBA 1G8OA 1V83A 2TDTA 2XMHA 5FTVA 2AM3A 2V0JA 1OMZA 2VXLA 1O0RA 5J49A 2QIVX 1LL0A 2PX7A 2Y4JA 5FUHA 3OAMA 3ECTA 3V0NA 3T7OA 4ARWA 4J09A 2RIYA 4E79A 3CKVA 2J0BA 2V0HA 3IOJA 3TISA 1LZIA 3OH1A 2AM4A 1GQCA 1W57A 2VS4A 3VBIA 4MIXA 4KNXA 3JUJA 1JVGA 4D11C 2A8WA 1KGQA 3SX7A 2OEFA 1TVYA 4E6UA 4EQYA 1G23A 2DPWA 2RITA 3RSBA 3BSWA 1VGUA 1HJLA 2PGYA 3ST8A 4HO6A 4P00A 1NWGB 3R0SA 1V67A 2O1HA 3PKQA 1FXOA 2ICXA 2WLCA 1R7XA 1NQIB 1FG5N 4IHHA 3I0GA 2BO6A 1JYLA 2XWLA 1SS9A 2VSHA 2YC5A 4D11A 4C2SA 2BO4A 4KNRA 5CMHA 4D48A 1H7FA 3I0FA 2I7BA 1MP4A 4JD0A 2AQ9A 2XWNA 1H7QA 2Z87A 2AH9A 3HSQA 2FFVA 2JCJA 1ON8A 3FSXA 2VS3A 3OH3A 1SSTA 3NGWA 4H7OA 4IRPA 2RIJA 3VBLA 1QWJA 1GX0A 2YQSA 1LZJA 1H3MA 3P47A 4M99A 5IDSA 3R5DA 4IHGA 1QRLA 3CKNA 4Y7GA 3USRA 3DUVA 5CQMX 1NMMB 3BSYA 5EJZA 4BMAA 5CMGX 3V8ZA 3FSYA 2FY7A 2J0AA 3K8DA 3TWDA 1G2VA 3HJJA 1KK6A 3VBPA 4AYJA 1ZJ2A 3TQDA 3O3PA 4IRQA 1Z90A 3E25A 3R3IA 1J2ZA 2CU2A 3ZF8A 1FRWA 2YC3A 1H5SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5U2K A;  4EA9 A;  4G3S A;  3CJ8 A;  5CQP A;  1LL3 A;  4R36 A;  3R8Y A;  2RJ7 A;  2WVK A;  4DDZ A;  1HM8 A;  3FSC A;  2X5Z A;  4EE4 A;  4M28 A;  2RJ9 A;  5IDT A;  5E3R A;  2IU8 A;  1VH1 A;  3PNN A;  1H7T A;  2AES A;  3D98 A;  3Q1X A;  2P72 A;  1EYR A;  1VIC A;  2O1F A;  2VD4 A;  3TDT A;  3KIA A;  4B42 A;  1PZT A;  1QRF A;  3OTM A;  3R5C A;  1ZCU A;  2RJ4 A;  3OH0 A;  5FV9 A;  4HO9 A;  1H5S A;  1G3L A;  4FRQ A;  2MZB A;  4EE3 A;  3V4E A;  2AGD A;  4EE5 A;  4MFG A;  3VBK A;  2FKO A;  4M2A A;  4FRP A;  4HCQ A;  1KHR A;  4FRA A;  3N9W A;  1ZDF A;  1NHE B;  1ZI4 A;  4MYB A;  5C1H A;  5ADX U;  5C47 A;  2OEG A;  1E5K A;  2OI6 A;  3MQG A;  2BO7 A;  2JCL A;  3SXG A;  3C8V A;  1JV3 A;  3QVB A;  3ZLK A;  2IU9 A;  2VHE A;  5CMI A;  3BCV A;  1VGW A;  4CJ8 A;  4LW3 A;  1S4P A;  4KC4 A;  2E3D A;  3JUK A;  4Y6N A;  1FR9 A;  5C3A A;  2UX8 A;  4J18 A;  1YRO B;  1TZF A;  4N27 A;  4E6T A;  1ZHJ A;  1GWW A;  3USQ A;  1S4N A;  3U2V A;  3D5N A;  1KRU A;  3I0C A;  2AE7 A;  3OH4 A;  3PKP A;  4CVH A;  1R7V A;  3T7M A;  3CKQ A;  1H7E A;  5C4C A;  4Y62 A;  4MZU A;  2AM5 A;  4EAA A;  4BQH A;  1H4C A;  2RJ1 A;  1ZJ0 A;  2FYD B;  4MND A;  5C49 A;  2JF3 A;  1PZY B;  1QRM A;  1ZI5 A;  3I0D A;  4HO4 A;  2E8B A;  1H5R A;  2Y4M A;  2Y7A A;  4HG6 A;  3MC4 A;  1O7O A;  3V8Y A;  1FZW A;  4B5B A;  3NZ2 A;  3SXD A;  2I5K A;  2Q4J A;  4DEC A;  2Z86 A;  1WVC A;  1FWY A;  4L41 C;  1EZI A;  2WAW A;  5C4B A;  2XWM A;  1LVW A;  3BSS A;  1OQM B;  1WSZ A;  1ZDG A;  4AAW A;  4D0T A;  2GGO A;  3R3R A;  1KRR A;  1O23 B;  1FOA A;  5JQQ A;  3V0O A;  1HJJ A;  5BXC A;  5ADX V;  3IOI A;  2V0I A;  4N6B A;  5CQO A;  3TZT A;  3U2X A;  1YP4 A;  3KWC A;  4EA7 A;  3ZGF A;  4EEM A;  1JYK A;  1S4O A;  3FTT A;  4FRO A;  2RJ5 A;  3POL A;  1ZJP A;  4IHF A;  2APC A;  5DEM A;  1ZCV A;  3VBM A;  2VFZ A;  4ISX A;  1FR8 A;  1H5S B;  4ECM A;  2IUA A;  2P6W A;  4HO8 A;  1V3W A;  3U2T A;  2WLF A;  3F1Y A;  3I0J A;  5I1F A;  1HM9 A;  1W55 A;  4GBP A;  3LW6 A;  1H5T A;  5EIY A;  3OTZ A;  5DDT A;  3IXC A;  1H7L A;  3V0Q A;  2OI5 A;  2RJ6 A;  5DDV A;  2V0K A;  3GOS A;  1XHD A;  3ZLL A;  4HO5 A;  3DK5 A;  4CJB A;  4K6R A;  5C3D A;  1QGS A;  5AJN A;  3FWW A;  3I0K A;  4HUS A;  3EG4 A;  3I0H A;  3OW5 A;  4Y63 A;  3T7N A;  5C1L A;  5HS2 A;  3TV0 A;  5C4D A;  1HV9 A;  1INJ A;  3SXB A;  4LW6 A;  1G93 A;  3KWD A;  2I5E A;  1MRL A;  1IIM A;  2PGV A;  4NAK A;  1GQ9 A;  3BXY A;  2D7I A;  4CJC A;  1LXA A;  4KPZ A;  1K4V A;  1SSM A;  4KXO A;  4R37 A;  2X65 A;  3SXA A;  1OCX A;  3SX8 A;  3SPT A;  1SSQ A;  2NXV A;  4B4G A;  1GX4 A;  5FU8 A;  1GA8 A;  3OH2 A;  4Y6U A;  4Y7F A;  3TK8 A;  4FRB A;  2WLG A;  3DHO A;  2V0L A;  3IGJ A;  4FRD A;  1H5R B;  1MP5 A;  1XHB A;  4B4M A;  4FRH A;  4KC1 A;  4HUR A;  3V91 A;  3V0L A;  2ZU9 A;  3VBJ A;  4ZDQ A;  2D0J A;  4FCE A;  4NAL A;  2WVM A;  2Y6P A;  1VZT A;  4EEG A;  4KRV A;  4NAN A;  4EVW A;  4M2B A;  3SXE A;  2ZU7 A;  4HZD A;  4FRM A;  5C4E A;  3EE5 A;  3JQY A;  2WVL A;  3VNP A;  4FCU A;  3F1C A;  4E75 A;  1GWV A;  1MR9 A;  2JCO A;  4HO2 A;  1WT0 A;  1THJ A;  4AC3 A;  3OUP A;  5FU0 A;  1TDT A;  1JV1 A;  1INI A;  4DCL A;  5E3P A;  3BRK X;  3T57 A;  5AFU U;  5C3B A;  1R80 A;  1NF5 B;  4HOC A;  1LZ0 A;  1H4D A;  3E26 A;  1VZU A;  1VH3 A;  2YQH A;  2O1G A;  1QQ0 A;  3MQH A;  1QRE A;  3V0P A;  5C48 A;  2GGQ A;  3U0X A;  3U2W A;  1G1L A;  4MYO A;  5CMF X;  3OC9 A;  1LZ7 A;  1W77 A;  4E1K A;  4UEG A;  5C36 A;  2JF2 A;  2WLD A;  3IOH A;  5CQN X;  1FGG A;  4FQW A;  1TW5 A;  3SX3 A;  2VS5 A;  3I3A A;  4P02 A;  2XAT A;  2QKX A;  1H5T B;  1XAT A;  3KWE A;  3D8V A;  1ZIZ A;  5CQL X;  2JCK A;  2P2O A;  5DEP A;  2RJ8 A;  4KC2 A;  2W0W A;  2BO8 A;  5IFY A;  1H4E A;  4Y7U A;  2FYC B;  4B4B A;  4DE7 A;  2X5S A;  4FRE A;  4G3Q A;  4B2X A;  3FOQ A;  1H5S D;  1FGX A;  2IC7 A;  4N69 A;  4Y9X A;  4AYL A;  1R81 A;  5C38 A;  3CU0 A;  2WE9 A;  1G97 A;  1VPA A;  1FO9 A;  5C4F A;  2VSI A;  1V84 A;  2FYA A;  2AEC A;  5FYE A;  3GVD A;  1R7T A;  2D7R A;  1ON6 A;  2A8U A;  3SX5 A;  1R7Y A;  3OGZ A;  1VZX A;  2PA4 A;  2YQC A;  3Q80 A;  3OKR A;  3P1B A;  1O7Q A;  3R5B A;  1QGQ A;  3U0Y A;  4JIS A;  4HZC A;  1ZI3 A;  1LL2 A;  1FXJ A;  1G95 A;  1V82 A;  4EEO A;  5E3Q A;  1ZJ1 A;  3U2U A;  4ASY A;  3R2W A;  2P73 A;  2YCM A;  3CKJ A;  1MP3 A;  1KK5 A;  3EH0 A;  1G0R A;  4NAI A;  1QG8 A;  4Y7V A;  1WT2 A;  1JVD A;  4XWI A;  4Y64 A;  4AA7 A;  1WT3 A;  1VM8 A;  1IIN A;  2WEE A;  5AFU V;  1T3D A;  1YP2 A;  2QH5 A;  5C1G A;  3V90 A;  1H7G A;  4G87 A;  2Y4L A;  1WT1 A;  4M98 A;  3R1W A;  2X60 A;  2FFU A;  4YS8 A;  3DJ4 A;  3FS8 A;  1KRV A;  4FRL A;  4EGG A;  3K8E A;  1VGZ A;  1KQA A;  2YQJ A;  1NKH B;  2NPO A;  1KK4 A;  4B3U A;  2RJ0 A;  2ZU8 A;  1R82 A;  3RMV A;  2WGZ A;  5L6S A;  2OI7 A;  1G9R A;  1ZI1 A;  4R7P A;  1FO8 A;  3HL3 A;  1TW1 A;  1QRG A;  4M9C A;  1ZCT A;  5AJP A;  3OU9 A;  3TIO A;  1I52 A;  4ASJ A;  4KPX A;  2FYB A;  3Q7U A;  3ZGG A;  1OMX A;  1ZJ3 A;  3Q4S A;  4D0Z A;  5FTS A;  1ZCY A;  4KT7 A;  4EAB A;  1VGT A;  5AJO A;  2QGI A;  4Y7T A;  3CKO A;  1XZ6 A;  5EJ1 A;  4KQL A;  3EEV A;  2WLE A;  2XME A;  1KGT A;  4N6A A;  3CGX A;  2QIA A;  4EEA A;  3I0L A;  3SXC A;  4EA8 A;  2RIX A;  1ZJO A;  5L6V A;  1HM0 A;  1MC3 A;  3GUE A;  3JTJ A;  5F42 A;  1MR7 A;  4G3P A;  3I0E A;  3SRT A;  1YP3 A;  2ICY A;  3VBN A;  2VXM A;  3F1X A;  4HO3 A;  4M4K A;  5DG3 A;  1KWS A;  3V0M A;  2Y4K A;  1S80 A;  4HO0 A;  3R5A A;  2RIZ A;  3RMW A;  2W0V A;  1R7U A;  5CMJ A;  3BFP A;  4B2W A;  3I0I X;  3PMO A;  1H7H A;  3I3X A;  5C8R A;  2YES A;  3FSB A;  1G8O A;  1V83 A;  2TDT A;  2XMH A;  5FTV A;  2AM3 A;  2V0J A;  1OMZ A;  2VXL A;  1O0R A;  5J49 A;  2QIV X;  1LL0 A;  2PX7 A;  2Y4J A;  5FUH A;  3OAM A;  3ECT A;  3V0N A;  3T7O A;  4ARW A;  4J09 A;  2RIY A;  4E79 A;  3CKV A;  2V0H A;  3IOJ A;  3TIS A;  1LZI A;  3OH1 A;  2AM4 A;  1GQC A;  1W57 A;  2VS4 A;  3VBI A;  4KNX A;  3JUJ A;  1JVG A;  4D11 C;  2A8W A;  1KGQ A;  3SX7 A;  2OEF A;  1TVY A;  4E6U A;  4EQY A;  1G23 A;  2DPW A;  2RIT A;  3RSB A;  3BSW A;  1VGU A;  1HJL A;  2PGY A;  3ST8 A;  4HO6 A;  4P00 A;  1NWG B;  3R0S A;  1V67 A;  2O1H A;  3PKQ A;  1FXO A;  2ICX A;  2WLC A;  1R7X A;  1NQI B;  1FG5 N;  4IHH A;  3I0G A;  2BO6 A;  1JYL A;  2XWL A;  1SS9 A;  2VSH A;  2YC5 A;  4D11 A;  4C2S A;  2BO4 A;  4KNR A;  5CMH A;  4D48 A;  1H7F A;  3I0F A;  2I7B A;  1MP4 A;  4JD0 A;  2AQ9 A;  2XWN A;  1H7Q A;  2Z87 A;  2AH9 A;  3HSQ A;  2FFV A;  2JCJ A;  1ON8 A;  3FSX A;  2VS3 A;  3OH3 A;  1SST A;  3NGW A;  4H7O A;  4IRP A;  2RIJ A;  3VBL A;  1QWJ A;  1GX0 A;  2YQS A;  1LZJ A;  1H3M A;  3P47 A;  4M99 A;  5IDS A;  3R5D A;  4IHG A;  1QRL A;  3CKN A;  4Y7G A;  3USR A;  3DUV A;  5CQM X;  1NMM B;  3BSY A;  5EJZ A;  4BMA A;  5CMG X;  3V8Z A;  3FSY A;  2FY7 A;  3K8D A;  3TWD A;  1G2V A;  3HJJ A;  1KK6 A;  3VBP A;  4AYJ A;  1ZJ2 A;  3TQD A;  3O3P A;  4IRQ A;  1Z90 A;  3E25 A;  3R3I A;  1J2Z A;  2CU2 A;  3ZF8 A;  1FRW A;  2YC3 A;  1H5S C; 
#chains in the Genus database with same CATH topology
 5U2K A;  4EA9 A;  4G3S A;  3CJ8 A;  5CQP A;  1LL3 A;  4R36 A;  3R8Y A;  2RJ7 A;  2WVK A;  4DDZ A;  1HM8 A;  3FSC A;  2X5Z A;  4EE4 A;  4M28 A;  2RJ9 A;  5IDT A;  5E3R A;  2IU8 A;  1VH1 A;  3PNN A;  1H7T A;  2AES A;  3D98 A;  3Q1X A;  2P72 A;  1EYR A;  1VIC A;  2O1F A;  2VD4 A;  3TDT A;  3KIA A;  4B42 A;  1PZT A;  1QRF A;  3OTM A;  3R5C A;  1ZCU A;  3OH0 A;  2RJ4 A;  5FV9 A;  4HO9 A;  1H5S A;  1G3L A;  4FRQ A;  2MZB A;  4EE3 A;  3V4E A;  2AGD A;  4EE5 A;  4MFG A;  3VBK A;  2FKO A;  4M2A A;  4FRP A;  4HCQ A;  1KHR A;  4FRA A;  3N9W A;  1ZDF A;  1NHE B;  1ZI4 A;  4MYB A;  5C1H A;  5ADX U;  5C47 A;  2OEG A;  1E5K A;  2OI6 A;  3MQG A;  2BO7 A;  2JCL A;  4FIY A;  3SXG A;  3C8V A;  1JV3 A;  3QVB A;  3ZLK A;  2IU9 A;  2VHE A;  5CMI A;  3BCV A;  1VGW A;  4CJ8 A;  4LW3 A;  1S4P A;  4KC4 A;  2E3D A;  3JUK A;  4Y6N A;  1M8N A;  1FR9 A;  5C3A A;  2UX8 A;  4J18 A;  1YRO B;  1TZF A;  4N27 A;  4E6T A;  1ZHJ A;  1GWW A;  3USQ A;  1S4N A;  3U2V A;  3D5N A;  1KRU A;  3I0C A;  2AE7 A;  3OH4 A;  3PKP A;  4CVH A;  1R7V A;  3T7M A;  3CKQ A;  1H7E A;  5C4C A;  4Y62 A;  4MZU A;  2AM5 A;  4EAA A;  4BQH A;  1H4C A;  2RJ1 A;  1ZJ0 A;  2FYD B;  4MND A;  5C49 A;  2JF3 A;  1PZY B;  1QRM A;  1ZI5 A;  3I0D A;  4HO4 A;  2E8B A;  1H5R A;  2Y4M A;  2Y7A A;  4HG6 A;  3MC4 A;  1O7O A;  3V8Y A;  1FZW A;  4B5B A;  3NZ2 A;  3SXD A;  2I5K A;  2Q4J A;  1EWW A;  4DEC A;  2Z86 A;  1WVC A;  1FWY A;  4L41 C;  1N4I A;  1EZI A;  2WAW A;  5C4B A;  2XWM A;  1LVW A;  3BSS A;  1OQM B;  1WSZ A;  1ZDG A;  4AAW A;  4D0T A;  2GGO A;  3R3R A;  1KRR A;  1O23 B;  1FOA A;  5JQQ A;  3V0O A;  1HJJ A;  5BXC A;  5ADX V;  3IOI A;  2V0I A;  4N6B A;  5CQO A;  3TZT A;  3U2X A;  1YP4 A;  3KWC A;  4EA7 A;  3ZGF A;  4EEM A;  1JYK A;  1S4O A;  3FTT A;  4FRO A;  2RJ5 A;  3POL A;  1ZJP A;  4IHF A;  2APC A;  5DEM A;  1ZCV A;  3VBM A;  2VFZ A;  4ISX A;  1FR8 A;  1H5S B;  4ECM A;  2IUA A;  2P6W A;  4HO8 A;  1V3W A;  3U2T A;  2WLF A;  3F1Y A;  3I0J A;  5I1F A;  1HM9 A;  1W55 A;  4FIX A;  4GBP A;  3LW6 A;  1H5T A;  5EIY A;  3OTZ A;  5DDT A;  3IXC A;  1H7L A;  3V0Q A;  2OI5 A;  2RJ6 A;  5DDV A;  2V0K A;  3GOS A;  1XHD A;  3ZLL A;  4HO5 A;  3DK5 A;  4CJB A;  4K6R A;  5C3D A;  1QGS A;  5AJN A;  3FWW A;  3I0K A;  4HUS A;  3EG4 A;  3I0H A;  3OW5 A;  4Y63 A;  3T7N A;  5C1L A;  5HS2 A;  3TV0 A;  5C4D A;  1HV9 A;  1INJ A;  3SXB A;  4LW6 A;  1G93 A;  3KWD A;  2I5E A;  1MRL A;  1IIM A;  2PGV A;  4NAK A;  1GQ9 A;  3BXY A;  2D7I A;  4CJC A;  1LXA A;  4KPZ A;  1K4V A;  1SSM A;  4KXO A;  4R37 A;  2X65 A;  3SXA A;  1OCX A;  3SX8 A;  3SPT A;  1SSQ A;  2NXV A;  4B4G A;  1GX4 A;  3GQ9 A;  3GQA A;  1GA8 A;  5FU8 A;  3OH2 A;  4Q7C A;  4Y6U A;  4Y7F A;  3TK8 A;  4FRB A;  2WLG A;  3DHO A;  2V0L A;  3IGJ A;  4FRD A;  1H5R B;  1MP5 A;  1XHB A;  4B4M A;  4FRH A;  4KC1 A;  4HUR A;  3V91 A;  3V0L A;  2ZU9 A;  3VBJ A;  4ZDQ A;  2D0J A;  4FCE A;  4NAL A;  2WVM A;  2Y6P A;  1VZT A;  4EEG A;  4KRV A;  4NAN A;  4EVW A;  4M2B A;  3SXE A;  2ZU7 A;  4HZD A;  4FRM A;  5C4E A;  3EE5 A;  3JQY A;  2WVL A;  3VNP A;  4FCU A;  3F1C A;  4E75 A;  1GWV A;  1MR9 A;  2JCO A;  4HO2 A;  1WT0 A;  1THJ A;  4AC3 A;  3OUP A;  5FU0 A;  1TDT A;  1JV1 A;  1INI A;  4DCL A;  5E3P A;  3BRK X;  3T57 A;  5AFU U;  5C3B A;  1R80 A;  1NF5 B;  4HOC A;  1LZ0 A;  1H4D A;  3E26 A;  1VZU A;  1VH3 A;  2YQH A;  2O1G A;  1QQ0 A;  3GQ7 A;  3MQH A;  1QRE A;  3V0P A;  5C48 A;  2GGQ A;  3U0X A;  3U2W A;  1G1L A;  4MYO A;  5CMF X;  3OC9 A;  1LZ7 A;  1W77 A;  4O6M A;  4E1K A;  4UEG A;  5C36 A;  2JF2 A;  2WLD A;  3IOH A;  5CQN X;  1FGG A;  4FQW A;  1TW5 A;  3SX3 A;  2VS5 A;  3I3A A;  4P02 A;  2XAT A;  2QKX A;  1H5T B;  1XAT A;  3KWE A;  3D8V A;  1ZIZ A;  5CQL X;  2JCK A;  2P2O A;  5DEP A;  2RJ8 A;  4KC2 A;  2W0W A;  2BO8 A;  5IFY A;  1H4E A;  4Y7U A;  2FYC B;  4B4B A;  4DE7 A;  2X5S A;  4FRE A;  4G3Q A;  4B2X A;  3FOQ A;  1H5S D;  1FGX A;  2IC7 A;  4N69 A;  4Y9X A;  4AYL A;  1R81 A;  5C38 A;  3CU0 A;  2WE9 A;  1G97 A;  1VPA A;  1FO9 A;  5C4F A;  2VSI A;  1V84 A;  2FYA A;  2AEC A;  5FYE A;  3GVD A;  1R7T A;  2D7R A;  1ON6 A;  2A8U A;  3SX5 A;  3OGZ A;  1R7Y A;  1VZX A;  2PA4 A;  2YQC A;  3Q80 A;  3OKR A;  3P1B A;  1O7Q A;  3R5B A;  1QGQ A;  3U0Y A;  4JIS A;  4HZC A;  1ZI3 A;  1LL2 A;  1FXJ A;  1G95 A;  1V82 A;  4EEO A;  5E3Q A;  1ZJ1 A;  3U2U A;  4ASY A;  3R2W A;  2P73 A;  2YCM A;  3CKJ A;  1MP3 A;  1KK5 A;  3EH0 A;  1G0R A;  4NAI A;  1QG8 A;  4Y7V A;  1WT2 A;  1JVD A;  4XWI A;  5D91 A;  4Y64 A;  4AA7 A;  4O6N A;  1WT3 A;  1VM8 A;  1IIN A;  2WEE A;  5AFU V;  1T3D A;  1YP2 A;  2QH5 A;  5C1G A;  3V90 A;  1H7G A;  4G87 A;  2Y4L A;  1WT1 A;  4M98 A;  3R1W A;  2X60 A;  2FFU A;  4YS8 A;  3DJ4 A;  3FS8 A;  1KRV A;  4FRL A;  4EGG A;  3K8E A;  1VGZ A;  1KQA A;  2YQJ A;  1NKH B;  2NPO A;  1KK4 A;  4B3U A;  2RJ0 A;  2ZU8 A;  1R82 A;  3RMV A;  2WGZ A;  5L6S A;  2OI7 A;  1G9R A;  1ZI1 A;  4R7P A;  1FO8 A;  3HL3 A;  1TW1 A;  1QRG A;  4M9C A;  1ZCT A;  5AJP A;  3OU9 A;  3TIO A;  1I52 A;  4ASJ A;  4KPX A;  2FYB A;  3Q7U A;  3ZGG A;  1OMX A;  1ZJ3 A;  3Q4S A;  4D0Z A;  5FTS A;  1ZCY A;  4KT7 A;  4EAB A;  1VGT A;  5AJO A;  2QGI A;  4Y7T A;  3CKO A;  1XZ6 A;  2VK9 A;  5EJ1 A;  4KQL A;  3EEV A;  2WLE A;  2XME A;  1KGT A;  4N6A A;  3CGX A;  2QIA A;  4EEA A;  3I0L A;  3SXC A;  4EA8 A;  2RIX A;  5D92 A;  1ZJO A;  5L6V A;  1HM0 A;  1MC3 A;  3GUE A;  3JTJ A;  5F42 A;  1MR7 A;  4G3P A;  3I0E A;  3SRT A;  3GQ8 A;  1YP3 A;  2ICY A;  3VBN A;  2C0N A;  2VXM A;  3F1X A;  4HO3 A;  4M4K A;  5DG3 A;  1KWS A;  3V0M A;  2Y4K A;  1S80 A;  4HO0 A;  3R5A A;  2RIZ A;  3RMW A;  2W0V A;  1R7U A;  5CMJ A;  3BFP A;  4B2W A;  3I0I X;  3PMO A;  1H7H A;  3I3X A;  5C8R A;  2YES A;  3FSB A;  1G8O A;  1V83 A;  2TDT A;  3SUC A;  2XMH A;  5FTV A;  2AM3 A;  2V0J A;  1OMZ A;  2VXL A;  1O0R A;  5J49 A;  2QIV X;  1LL0 A;  2PX7 A;  2Y4J A;  5FUH A;  3OAM A;  3ECT A;  3V0N A;  3T7O A;  4ARW A;  4J09 A;  2RIY A;  4E79 A;  3CKV A;  2J0B A;  2V0H A;  3IOJ A;  3TIS A;  3OH1 A;  1LZI A;  2AM4 A;  1GQC A;  1W57 A;  2VS4 A;  3VBI A;  4MIX A;  4KNX A;  3JUJ A;  1JVG A;  4D11 C;  2A8W A;  1KGQ A;  3SX7 A;  2OEF A;  1TVY A;  1L0S A;  4E6U A;  4EQY A;  1G23 A;  2DPW A;  2RIT A;  3RSB A;  3BSW A;  1VGU A;  1HJL A;  2PGY A;  3ST8 A;  4HO6 A;  4P00 A;  1NWG B;  3R0S A;  1V67 A;  2O1H A;  3PKQ A;  1FXO A;  2ICX A;  2WLC A;  1R7X A;  1NQI B;  1FG5 N;  4IHH A;  3I0G A;  2BO6 A;  1JYL A;  2XWL A;  1SS9 A;  2VSH A;  2YC5 A;  4D11 A;  4C2S A;  2BO4 A;  4KNR A;  5CMH A;  4D48 A;  1H7F A;  3I0F A;  2I7B A;  1MP4 A;  4JD0 A;  2AQ9 A;  1Z2F A;  2XWN A;  1H7Q A;  2Z87 A;  2AH9 A;  3HSQ A;  2FFV A;  2JCJ A;  3OH3 A;  3FSX A;  1ON8 A;  2VS3 A;  1SST A;  3NGW A;  4H7O A;  4IRP A;  2RIJ A;  3VBL A;  1QWJ A;  1GX0 A;  2YQS A;  3P47 A;  1H3M A;  4M99 A;  1LZJ A;  5IDS A;  3R5D A;  4IHG A;  1QRL A;  3CKN A;  4Y7G A;  3USR A;  3DUV A;  5CQM X;  1NMM B;  3BSY A;  5EJZ A;  4BMA A;  5CMG X;  3V8Z A;  3FSY A;  2FY7 A;  2J0A A;  3K8D A;  3TWD A;  1G2V A;  3HJJ A;  1KK6 A;  3VBP A;  4AYJ A;  1ZJ2 A;  3TQD A;  3O3P A;  4IRQ A;  1Z90 A;  3E25 A;  3R3I A;  1J2Z A;  2CU2 A;  3ZF8 A;  1FRW A;  2YC3 A;  1H5S C; 
#chains in the Genus database with same CATH homology
 5U2K A;  4EA9 A;  4G3S A;  3CJ8 A;  5CQP A;  1LL3 A;  4R36 A;  3R8Y A;  2RJ7 A;  2WVK A;  4DDZ A;  1HM8 A;  3FSC A;  2X5Z A;  4EE4 A;  4M28 A;  2RJ9 A;  5IDT A;  5E3R A;  2IU8 A;  1VH1 A;  3PNN A;  1H7T A;  2AES A;  3D98 A;  3Q1X A;  2P72 A;  1EYR A;  1VIC A;  2O1F A;  2VD4 A;  3TDT A;  3KIA A;  4B42 A;  1PZT A;  1QRF A;  3OTM A;  3R5C A;  1ZCU A;  2RJ4 A;  3OH0 A;  5FV9 A;  4HO9 A;  1H5S A;  1G3L A;  4FRQ A;  2MZB A;  4EE3 A;  3V4E A;  2AGD A;  4EE5 A;  4MFG A;  3VBK A;  2FKO A;  4M2A A;  4FRP A;  4HCQ A;  1KHR A;  4FRA A;  3N9W A;  1ZDF A;  1NHE B;  1ZI4 A;  4MYB A;  5C1H A;  5ADX U;  5C47 A;  2OEG A;  1E5K A;  2OI6 A;  3MQG A;  2BO7 A;  2JCL A;  4FIY A;  3SXG A;  3C8V A;  1JV3 A;  3QVB A;  3ZLK A;  2IU9 A;  2VHE A;  5CMI A;  3BCV A;  1VGW A;  4CJ8 A;  4LW3 A;  1S4P A;  4KC4 A;  2E3D A;  3JUK A;  4Y6N A;  1FR9 A;  5C3A A;  2UX8 A;  4J18 A;  1YRO B;  1TZF A;  4N27 A;  4E6T A;  1ZHJ A;  1GWW A;  3USQ A;  1S4N A;  3U2V A;  3D5N A;  1KRU A;  3I0C A;  2AE7 A;  3OH4 A;  3PKP A;  4CVH A;  1R7V A;  3T7M A;  3CKQ A;  1H7E A;  5C4C A;  4Y62 A;  4MZU A;  2AM5 A;  4EAA A;  4BQH A;  1H4C A;  2RJ1 A;  1ZJ0 A;  2FYD B;  4MND A;  5C49 A;  2JF3 A;  1PZY B;  1QRM A;  1ZI5 A;  3I0D A;  4HO4 A;  2E8B A;  1H5R A;  2Y4M A;  2Y7A A;  4HG6 A;  3MC4 A;  1O7O A;  3V8Y A;  1FZW A;  4B5B A;  3NZ2 A;  3SXD A;  2I5K A;  2Q4J A;  4DEC A;  2Z86 A;  1WVC A;  1FWY A;  4L41 C;  1EZI A;  2WAW A;  5C4B A;  2XWM A;  1LVW A;  3BSS A;  1OQM B;  1WSZ A;  1ZDG A;  4AAW A;  4D0T A;  2GGO A;  3R3R A;  1KRR A;  1O23 B;  1FOA A;  5JQQ A;  3V0O A;  1HJJ A;  5BXC A;  5ADX V;  3IOI A;  2V0I A;  4N6B A;  5CQO A;  3TZT A;  3U2X A;  1YP4 A;  3KWC A;  4EA7 A;  3ZGF A;  4EEM A;  1JYK A;  1S4O A;  3FTT A;  4FRO A;  2RJ5 A;  3POL A;  1ZJP A;  4IHF A;  2APC A;  5DEM A;  1ZCV A;  3VBM A;  2VFZ A;  4ISX A;  1FR8 A;  1H5S B;  4ECM A;  2IUA A;  2P6W A;  4HO8 A;  1V3W A;  3U2T A;  2WLF A;  3F1Y A;  3I0J A;  5I1F A;  1HM9 A;  1W55 A;  4FIX A;  4GBP A;  3LW6 A;  1H5T A;  5EIY A;  3OTZ A;  5DDT A;  3IXC A;  1H7L A;  3V0Q A;  2OI5 A;  2RJ6 A;  5DDV A;  2V0K A;  3GOS A;  1XHD A;  3ZLL A;  4HO5 A;  3DK5 A;  4CJB A;  4K6R A;  5C3D A;  1QGS A;  5AJN A;  3FWW A;  3I0K A;  4HUS A;  3EG4 A;  3I0H A;  3OW5 A;  4Y63 A;  3T7N A;  5C1L A;  5HS2 A;  3TV0 A;  5C4D A;  1HV9 A;  1INJ A;  3SXB A;  4LW6 A;  1G93 A;  3KWD A;  2I5E A;  1MRL A;  1IIM A;  2PGV A;  4NAK A;  1GQ9 A;  3BXY A;  2D7I A;  4CJC A;  1LXA A;  4KPZ A;  1K4V A;  1SSM A;  4KXO A;  4R37 A;  2X65 A;  3SXA A;  1OCX A;  3SX8 A;  3SPT A;  1SSQ A;  2NXV A;  4B4G A;  1GX4 A;  5FU8 A;  1GA8 A;  3OH2 A;  4Q7C A;  4Y6U A;  4Y7F A;  3TK8 A;  4FRB A;  2WLG A;  3DHO A;  2V0L A;  3IGJ A;  4FRD A;  1H5R B;  1MP5 A;  1XHB A;  4B4M A;  4FRH A;  4KC1 A;  4HUR A;  3V91 A;  3V0L A;  2ZU9 A;  3VBJ A;  4ZDQ A;  2D0J A;  4FCE A;  4NAL A;  2WVM A;  2Y6P A;  1VZT A;  4EEG A;  4KRV A;  4NAN A;  4EVW A;  4M2B A;  3SXE A;  2ZU7 A;  4HZD A;  4FRM A;  5C4E A;  3EE5 A;  3JQY A;  2WVL A;  3VNP A;  4FCU A;  3F1C A;  4E75 A;  1GWV A;  1MR9 A;  2JCO A;  4HO2 A;  1WT0 A;  1THJ A;  4AC3 A;  3OUP A;  5FU0 A;  1TDT A;  1JV1 A;  1INI A;  4DCL A;  5E3P A;  3BRK X;  3T57 A;  5AFU U;  5C3B A;  1R80 A;  1NF5 B;  4HOC A;  1LZ0 A;  1H4D A;  3E26 A;  1VZU A;  1VH3 A;  2YQH A;  2O1G A;  1QQ0 A;  3MQH A;  1QRE A;  3V0P A;  5C48 A;  2GGQ A;  3U0X A;  3U2W A;  1G1L A;  4MYO A;  5CMF X;  3OC9 A;  1LZ7 A;  1W77 A;  4O6M A;  4E1K A;  4UEG A;  5C36 A;  2JF2 A;  2WLD A;  3IOH A;  5CQN X;  1FGG A;  4FQW A;  1TW5 A;  3SX3 A;  2VS5 A;  3I3A A;  4P02 A;  2XAT A;  2QKX A;  1H5T B;  1XAT A;  3KWE A;  3D8V A;  1ZIZ A;  5CQL X;  2JCK A;  2P2O A;  5DEP A;  2RJ8 A;  4KC2 A;  2W0W A;  2BO8 A;  5IFY A;  1H4E A;  4Y7U A;  2FYC B;  4B4B A;  4DE7 A;  2X5S A;  4FRE A;  4G3Q A;  4B2X A;  3FOQ A;  1H5S D;  1FGX A;  2IC7 A;  4N69 A;  4Y9X A;  4AYL A;  1R81 A;  5C38 A;  3CU0 A;  2WE9 A;  1G97 A;  1VPA A;  1FO9 A;  5C4F A;  2VSI A;  1V84 A;  2FYA A;  2AEC A;  5FYE A;  3GVD A;  1R7T A;  2D7R A;  1ON6 A;  2A8U A;  3SX5 A;  1R7Y A;  3OGZ A;  1VZX A;  2PA4 A;  2YQC A;  3Q80 A;  3OKR A;  3P1B A;  1O7Q A;  3R5B A;  1QGQ A;  3U0Y A;  4JIS A;  4HZC A;  1ZI3 A;  1LL2 A;  1FXJ A;  1G95 A;  1V82 A;  4EEO A;  5E3Q A;  1ZJ1 A;  3U2U A;  4ASY A;  3R2W A;  2P73 A;  2YCM A;  3CKJ A;  1MP3 A;  1KK5 A;  3EH0 A;  1G0R A;  4NAI A;  1QG8 A;  4Y7V A;  1WT2 A;  1JVD A;  4XWI A;  5D91 A;  4Y64 A;  4AA7 A;  4O6N A;  1WT3 A;  1VM8 A;  1IIN A;  2WEE A;  5AFU V;  1T3D A;  1YP2 A;  2QH5 A;  5C1G A;  3V90 A;  1H7G A;  4G87 A;  2Y4L A;  1WT1 A;  4M98 A;  3R1W A;  2X60 A;  2FFU A;  4YS8 A;  3DJ4 A;  3FS8 A;  1KRV A;  4FRL A;  4EGG A;  3K8E A;  1VGZ A;  1KQA A;  2YQJ A;  1NKH B;  2NPO A;  1KK4 A;  4B3U A;  2RJ0 A;  2ZU8 A;  1R82 A;  3RMV A;  2WGZ A;  5L6S A;  2OI7 A;  1G9R A;  1ZI1 A;  4R7P A;  1FO8 A;  3HL3 A;  1TW1 A;  1QRG A;  4M9C A;  1ZCT A;  5AJP A;  3OU9 A;  3TIO A;  1I52 A;  4ASJ A;  4KPX A;  2FYB A;  3Q7U A;  3ZGG A;  1OMX A;  1ZJ3 A;  3Q4S A;  4D0Z A;  5FTS A;  1ZCY A;  4KT7 A;  4EAB A;  1VGT A;  5AJO A;  2QGI A;  4Y7T A;  3CKO A;  1XZ6 A;  2VK9 A;  5EJ1 A;  4KQL A;  3EEV A;  2WLE A;  2XME A;  1KGT A;  4N6A A;  3CGX A;  2QIA A;  4EEA A;  3I0L A;  3SXC A;  4EA8 A;  2RIX A;  5D92 A;  1ZJO A;  5L6V A;  1HM0 A;  1MC3 A;  3GUE A;  3JTJ A;  5F42 A;  1MR7 A;  4G3P A;  3I0E A;  3SRT A;  1YP3 A;  2ICY A;  3VBN A;  2C0N A;  2VXM A;  3F1X A;  4HO3 A;  4M4K A;  5DG3 A;  1KWS A;  3V0M A;  2Y4K A;  1S80 A;  4HO0 A;  3R5A A;  2RIZ A;  3RMW A;  2W0V A;  1R7U A;  5CMJ A;  3BFP A;  4B2W A;  3I0I X;  3PMO A;  1H7H A;  3I3X A;  5C8R A;  2YES A;  3FSB A;  1G8O A;  1V83 A;  2TDT A;  2XMH A;  5FTV A;  2AM3 A;  2V0J A;  1OMZ A;  2VXL A;  1O0R A;  5J49 A;  2QIV X;  1LL0 A;  2PX7 A;  2Y4J A;  5FUH A;  3OAM A;  3ECT A;  3V0N A;  3T7O A;  4ARW A;  4J09 A;  2RIY A;  4E79 A;  3CKV A;  2J0B A;  2V0H A;  3IOJ A;  3TIS A;  1LZI A;  3OH1 A;  2AM4 A;  1GQC A;  1W57 A;  2VS4 A;  3VBI A;  4MIX A;  4KNX A;  3JUJ A;  1JVG A;  4D11 C;  2A8W A;  1KGQ A;  3SX7 A;  2OEF A;  1TVY A;  4E6U A;  4EQY A;  1G23 A;  2DPW A;  2RIT A;  3RSB A;  3BSW A;  1VGU A;  1HJL A;  2PGY A;  3ST8 A;  4HO6 A;  4P00 A;  1NWG B;  3R0S A;  1V67 A;  2O1H A;  3PKQ A;  1FXO A;  2ICX A;  2WLC A;  1R7X A;  1NQI B;  1FG5 N;  4IHH A;  3I0G A;  2BO6 A;  1JYL A;  2XWL A;  1SS9 A;  2VSH A;  2YC5 A;  4D11 A;  4C2S A;  2BO4 A;  4KNR A;  5CMH A;  4D48 A;  1H7F A;  3I0F A;  2I7B A;  1MP4 A;  4JD0 A;  2AQ9 A;  2XWN A;  1H7Q A;  2Z87 A;  2AH9 A;  3HSQ A;  2FFV A;  2JCJ A;  1ON8 A;  3FSX A;  2VS3 A;  3OH3 A;  1SST A;  3NGW A;  4H7O A;  4IRP A;  2RIJ A;  3VBL A;  1QWJ A;  1GX0 A;  2YQS A;  1LZJ A;  1H3M A;  3P47 A;  4M99 A;  5IDS A;  3R5D A;  4IHG A;  1QRL A;  3CKN A;  4Y7G A;  3USR A;  3DUV A;  5CQM X;  1NMM B;  3BSY A;  5EJZ A;  4BMA A;  5CMG X;  3V8Z A;  3FSY A;  2FY7 A;  2J0A A;  3K8D A;  3TWD A;  1G2V A;  3HJJ A;  1KK6 A;  3VBP A;  4AYJ A;  1ZJ2 A;  3TQD A;  3O3P A;  4IRQ A;  1Z90 A;  3E25 A;  3R3I A;  1J2Z A;  2CU2 A;  3ZF8 A;  1FRW A;  2YC3 A;  1H5S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...