4R7PA

Human udp-glucose pyrophosphorylase isoform 1 in complex with udp-glucose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
485
structure length
485
Chain Sequence
IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Quaternary Mechanism Enables the Complex Biological Functions of Octameric Human UDP-glucose Pyrophosphorylase, a Key Enzyme in Cell Metabolism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
total genus 141
structure length 485
sequence length 485
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4r7pA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4r7pA01
2AM4A 4FRLA 3E25A 1QGSA 1MP4A 1YP4A 1MR7A 1H5RA 1JVDA 4DDZA 4DECA 3T7NA 3Q80A 4HOCA 1YP2A 3SXEA 3TISA 1H4CA 1LL2A 2W0WA 1KRUA 3EE5A 4P02A 1QRFA 1ZJ3A 2APCA 5CMIA 4J09A 3P47A 1NF5B 2RIXA 3IGJA 2O1GA 4EEGA 3CKOA 1TDTA 1H5TA 4C2SA 4CJBA 3K8DA 3FWWA 4Y6NA 2VXMA 4D11A 4Y7GA 2FYCB 1G0RA 3R5CA 3USRA 1NKHB 5C49A 4B2XA 3OUPA 1G97A 1XHDA 3U2TA 1IINA 2UX8A 2D7IA 2IU8A 1R82A 4J18A 1ZDFA 2AESA 3BCVA 4Y7TA 4ARWA 1VGZA 1G1LA 3V90A 3I0GA 3U2UA 2RJ1A 2V0KA 2FKOA 2W0VA 1ZCVA 4EE3A 3GVDA 3F1YA 1FO9A 1V3WA 2WLGA 4HO5A 2RJ7A 1YP3A 3V0LA 2Y4JA 3CJ8A 4EA7A 5CQMX 1TZFA 1H7TA 3U0XA 3VBJA 3I3AA 4EVWA 1S4PA 2NPOA 1JYKA 4CJ8A 4FRHA 3ZGGA 3OW5A 3T7MA 3U2VA 1WT3A 1MC3A 3U2WA 1R80A 1FOAA 2VFZA 1LZ0A 3RSBA 4GBPA 2X60A 1NWGB 1H7QA 5CQPA 5FV9A 3HSQA 2JF2A 1LZJA 1H5RB 2YC5A 1WT0A 2YQSA 3EG4A 3K8EA 1V67A 4Y9XA 3BSWA 1SSMA 3KWCA 1FO8A 4L41C 1W77A 3TIOA 5U2KA 1PZYB 3D5NA 4KPXA 4D0TA 5I1FA 2Y4MA 5EJZA 2IC7A 3JUKA 4P00A 2VD4A 1ZCYA 3JTJA 2RJ9A 2P73A 1O7QA 3PKPA 2RJ6A 4KRVA 3CKQA 4D48A 1KRVA 2NXVA 1FZWA 5C1HA 2YQJA 1FGGA 3MC4A 1MP3A 1OMZA 2DPWA 3FSYA 4EEOA 4EABA 1FRWA 4Y63A 3CKNA 4EA9A 2OI6A 3OTMA 2I5KA 4FROA 2Z87A 3I0JA 4KNRA 3V0OA 4Y62A 1QRMA 1VGUA 2O1FA 2Y6PA 3IOHA 3SXAA 1ZI4A 1PZTA 5C36A 2RIJA 4M99A 1LL3A 4K6RA 2WLEA 1G93A 1JVGA 2XWLA 1H4EA 3CKVA 5BXCA 1VH1A 3CGXA 1R7TA 5FYEA 4N27A 4R37A 1V84A 4HO9A 1GQCA 3C8VA 3TDTA 3NGWA 3SXGA 2OI5A 1H5SB 3POLA 3BSYA 1ZJOA 1ON6A 5FUHA 3ZGFA 1R7VA 3QVBA 4FRMA 2AM5A 4ASJA 3JUJA 4KNXA 1H5TB 3T7OA 3DJ4A 4EA8A 1VPAA 1GWVA 3R3RA 1H4DA 1GQ9A 2VS4A 3I0HA 1H7HA 2Y4LA 4FRPA 1GA8A 4BQHA 1MRLA 2PGVA 3OH3A 3BRKX 2P6WA 2P72A 2WVKA 4KC4A 2QH5A 3TWDA 4EAAA 5CQOA 5FTVA 1G95A 3N9WA 2AE7A 2BO7A 2YESA 1LXAA 3VBLA 2QIAA 1R81A 4R36A 2CU2A 2MZBA 1HM8A 4ASYA 2RJ8A 5C4BA 1ZHJA 1GX0A 3HL3A 4ZDQA 3V91A 3VBNA 3TV0A 1HJLA 3PNNA 5L6SA 2ZU9A 2JF3A 3PMOA 5FTSA 3Q7UA 1VZTA 1TVYA 5C48A 3F1XA 1ZJ1A 3DK5A 3VBPA 1TW1A 1VGWA 4HO8A 2JCJA 5E3QA 1ZI3A 1KGQA 2D7RA 3CU0A 3DUVA 2AH9A 4YS8A 1VICA 3SX3A 5C8RA 5CQNX 1VZXA 3V8ZA 1QQ0A 4HZCA 2AECA 4HO4A 1XZ6A 4M2BA 3D98A 3GOSA 3ECTA 1SS9A 4E75A 5AJPA 1FR8A 4LW6A 4IHFA 3JQYA 3CKJA 2BO8A 2QGIA 1FGXA 2Y7AA 2AGDA 2OEFA 2JCLA 1G9RA 3ZLKA 3MQHA 3OH2A 3ZF8A 5DEPA 3ST8A 1OCXA 1WT2A 4B5BA 1QWJA 2PGYA 5C3DA 2PA4A 4B2WA 1INIA 3BFPA 1E5KA 1G2VA 4BMAA 2QIVX 1ON8A 3SXDA 3SX8A 5FU8A 1GX4A 3R1WA 2Q4JA 3R2WA 1IIMA 3FS8A 4KC2A 4DE7A 1KWSA 3OH4A 2XMHA 5AFUV 2GGOA 2Y4KA 4ISXA 3IOIA 3OH0A 2GGQA 4G87A 3U0YA 2IU9A 2WVLA 3EH0A 2A8WA 3I0DA 1H7EA 5AJOA 3FTTA 3RMVA 2WLCA 2XATA 4ECMA 2YQHA 1KHRA 4B3UA 3SX7A 4E79A 4XWIA 1V82A 5DDVA 1QRGA 1KGTA 4JISA 4MNDA 4EEMA 5F42A 4NALA 5CMJA 2ICYA 4AAWA 3V8YA 1FXJA 5AFUU 2V0JA 4FREA 1H7FA 2YCMA 4LW3A 2PX7A 2OI7A 3Q1XA 3GUEA 2V0HA 2RITA 4KXOA 2VS5A 2X5ZA 1W55A 1H7GA 2YQCA 5IDSA 2AQ9A 4AC3A 1THJA 2FFVA 4EE5A 4G3QA 4HG6A 1XATA 3R3IA 2V0LA 1R7YA 3Q4SA 3OGZA 4D0ZA 1OQMB 4HO3A 3E26A 5AJNA 1YROB 1QREA 3F1CA 1H7LA 4DCLA 1QG8A 2A8UA 4EEAA 3OH1A 1GWWA 3HJJA 1FWYA 3TQDA 2ICXA 1KK5A 1MR9A 1T3DA 4H7OA 3KWDA 3SXCA 2BO6A 1EZIA 2XWMA 3I0KA 1S80A 3T57A 1VZUA 1NMMB 1SSQA 1HV9A 1ZJ2A 2JCOA 2I7BA 4N69A 1QRLA 2FYDB 3OU9A 5ADXU 4M98A 3FSCA 2WE9A 1LL0A 1ZDGA 4IRPA 3I0FA 3DHOA 3P1BA 5CMGX 1WVCA 5E3RA 4MYOA 1EYRA 4Y64A 4KQLA 1JV3A 3ZLLA 2XMEA 2FYAA 5CMHA 3IOJA 3V4EA 3R5DA 2FY7A 4KT7A 2I5EA 1Z90A 1JV1A 1FXOA 1ZCUA 3D8VA 4FRDA 1O0RA 1S4OA 4B42A 2RJ5A 4N6BA 1I52A 4M4KA 5EJ1A 3I0EA 1KK6A 2ZU7A 4IRQA 3BXYA 4Y7VA 1QGQA 4HO2A 2TDTA 1JYLA 2WAWA 4Y7FA 4CJCA 1HM0A 4B4BA 4M2AA 3SPTA 2IUAA 3O3PA 4N6AA 3OTZA 3SRTA 3SXBA 2VS3A 4EE4A 1OMXA 2P2OA 4HUSA 2O1HA 4E1KA 1G8OA 1LZIA 5C4FA 1MP5A 4FCUA 2OEGA 4NAKA 2V0IA 3I0CA 1J2ZA 1ZCTA 3SX5A 1NHEB 5FU0A 2X65A 3BSSA 2BO4A 5JQQA 3NZ2A 1ZJPA 4HO6A 4MFGA 5L6VA 3MQGA 1ZI5A 1SSTA 4FRAA 1H5SC 1O7OA 3VBKA 1INJA 3FOQA 3EEVA 2ZU8A 3U2XA 4UEGA 1KK4A 5C38A 2E3DA 4G3SA 3FSBA 3V0PA 2XWNA 4Y6UA 3V0QA 5C47A 1KRRA 3KWEA 2WEEA 5IDTA 1HM9A 4HCQA 1VM8A 3OAMA 1G23A 4NANA 3TK8A 3FSXA 1K4VA 2D0JA 5C3BA 4E6UA 3I0IX 1WSZA 1WT1A 3RMWA 3VBMA 5DG3A 2WLFA 1H3MA 4EQYA 2VHEA 3R0SA 3PKQA 5IFYA 3I3XA 1LZ7A 4JD0A 5CQLX 1TW5A 4AYLA 3V0MA 1H5SD 5DEMA 3OC9A 1ZJ0A 4HZDA 4FCEA 4G3PA 3R8YA 2WGZA 1XHBA 1ZI1A 3OKRA 2FFUA 1S4NA 1R7UA 2WVMA 2VXLA 4D11C 4IHHA 5CMFX 2JCKA 1O23B 3LW6A 5HS2A 4KPZA 1FG5N 1KQAA 2WLDA 2VSIA 4FQWA 3V0NA 4B4MA 1H5SA 1ZIZA 1R7XA 5DDTA 4B4GA 2VSHA 3VBIA 3USQA 5E3PA 4M9CA 1NQIB 3IXCA 4Y7UA 2RJ0A 4NAIA 5C1LA 1LVWA 4FRBA 1V83A 4HURA 3R5BA 4E6TA 4AA7A 1FR9A 4R7PA 2RIYA 2Z86A 4HO0A 5C4DA 2QKXA 2E8BA 2YC3A 3R5AA 4AYJA 4IHGA 2RIZA 1VH3A 1HJJA 3KIAA 5C4CA 5C4EA 5ADXV 4KC1A 1W57A 1VGTA 1G3LA 2RJ4A 4M28A 5EIYA 4CVHA 2X5SA 4MYBA 4EGGA 5C3AA 2FYBA 2AM3A 3VNPA 4FRQA 5J49A 3TZTA 5C1GA 3I0LA 4MZUA
chains in the Genus database with same CATH superfamily
2AM4A 4FRLA 3E25A 1QGSA 1MP4A 1YP4A 1MR7A 1H5RA 1JVDA 4DDZA 4DECA 3T7NA 3Q80A 4HOCA 1YP2A 3SXEA 3TISA 1H4CA 1LL2A 2W0WA 1KRUA 3EE5A 4P02A 1QRFA 1ZJ3A 2APCA 5CMIA 4J09A 3P47A 1NF5B 2RIXA 3IGJA 2O1GA 4EEGA 3CKOA 1TDTA 1H5TA 4C2SA 4CJBA 3K8DA 3FWWA 4Y6NA 2VXMA 4D11A 4Y7GA 2FYCB 1G0RA 3R5CA 3USRA 1NKHB 5C49A 4B2XA 1N4IA 3OUPA 3GQ9A 1G97A 1XHDA 3U2TA 1IINA 2UX8A 2D7IA 2IU8A 1R82A 4J18A 1ZDFA 2AESA 3BCVA 4Y7TA 4ARWA 1VGZA 1G1LA 3V90A 3I0GA 3U2UA 2RJ1A 2V0KA 2FKOA 2W0VA 1ZCVA 4EE3A 3GVDA 3F1YA 1FO9A 1V3WA 2WLGA 4HO5A 2RJ7A 1YP3A 3V0LA 2Y4JA 3CJ8A 4EA7A 5CQMX 1TZFA 1H7TA 3U0XA 3VBJA 3I3AA 4EVWA 1S4PA 2NPOA 1JYKA 4CJ8A 4FRHA 3ZGGA 3OW5A 3T7MA 3U2VA 1WT3A 1MC3A 3U2WA 1R80A 1FOAA 2VFZA 1LZ0A 3RSBA 4GBPA 2X60A 1NWGB 1H7QA 5CQPA 5FV9A 3HSQA 2JF2A 1LZJA 1H5RB 2YC5A 1WT0A 2YQSA 3EG4A 3K8EA 1V67A 4Y9XA 3BSWA 1SSMA 3KWCA 1FO8A 4L41C 1W77A 3TIOA 5U2KA 1PZYB 3D5NA 4KPXA 4D0TA 5I1FA 2Y4MA 5EJZA 2IC7A 3JUKA 4P00A 2VD4A 1ZCYA 3JTJA 2RJ9A 2P73A 1O7QA 3PKPA 2RJ6A 4KRVA 3CKQA 4D48A 1KRVA 2NXVA 1FZWA 5C1HA 2YQJA 1FGGA 3MC4A 1MP3A 1OMZA 2DPWA 3FSYA 2VK9A 4EABA 1FRWA 4Y63A 4EEOA 3CKNA 4EA9A 2OI6A 3OTMA 2I5KA 4FROA 2Z87A 3I0JA 4KNRA 3V0OA 4Y62A 1QRMA 1VGUA 2O1FA 2Y6PA 3IOHA 4Q7CA 3SXAA 1ZI4A 1PZTA 5C36A 2RIJA 4M99A 1LL3A 4K6RA 2WLEA 1G93A 1JVGA 2XWLA 1H4EA 3CKVA 5BXCA 1VH1A 3CGXA 1R7TA 5FYEA 2J0AA 4N27A 4R37A 1V84A 4HO9A 1GQCA 3C8VA 3TDTA 3NGWA 3SXGA 2OI5A 1H5SB 3POLA 3BSYA 1ZJOA 1ON6A 5FUHA 3ZGFA 1R7VA 3QVBA 4FRMA 2AM5A 4ASJA 3JUJA 4KNXA 1H5TB 3T7OA 3DJ4A 4EA8A 1VPAA 1GWVA 3R3RA 1H4DA 1GQ9A 2VS4A 3I0HA 1H7HA 2Y4LA 4FRPA 1GA8A 4BQHA 1MRLA 2PGVA 3OH3A 3BRKX 2P6WA 2P72A 2WVKA 4KC4A 2QH5A 3TWDA 4EAAA 5CQOA 5FTVA 5D91A 1G95A 3N9WA 2AE7A 2BO7A 2YESA 1LXAA 3VBLA 2QIAA 3GQAA 1R81A 4R36A 2CU2A 2MZBA 1HM8A 4ASYA 2RJ8A 5C4BA 1ZHJA 1GX0A 3HL3A 4ZDQA 3V91A 3VBNA 3TV0A 1HJLA 3PNNA 5L6SA 2ZU9A 2JF3A 3PMOA 5FTSA 3Q7UA 1VZTA 1TVYA 5C48A 3F1XA 1ZJ1A 3DK5A 3VBPA 1TW1A 1VGWA 4HO8A 1L0SA 2JCJA 5E3QA 1ZI3A 4MIXA 1KGQA 2D7RA 3CU0A 3DUVA 2AH9A 4YS8A 1VICA 3SX3A 5C8RA 5CQNX 1VZXA 3V8ZA 1QQ0A 4HZCA 2AECA 4HO4A 1EWWA 1XZ6A 4M2BA 3D98A 3GOSA 3ECTA 1SS9A 4E75A 5AJPA 1FR8A 4LW6A 4IHFA 3JQYA 3CKJA 2BO8A 2QGIA 1FGXA 2Y7AA 2AGDA 2OEFA 2JCLA 1G9RA 3ZLKA 3MQHA 3OH2A 3ZF8A 5DEPA 3ST8A 1OCXA 1WT2A 4B5BA 1QWJA 2PGYA 5C3DA 2PA4A 4B2WA 1INIA 3BFPA 1E5KA 1G2VA 4BMAA 2QIVX 1ON8A 3SXDA 3SX8A 5FU8A 1GX4A 3R1WA 2Q4JA 3R2WA 1IIMA 3FS8A 4KC2A 4DE7A 1KWSA 3OH4A 2XMHA 5AFUV 2GGOA 2Y4KA 4ISXA 3IOIA 2J0BA 3OH0A 2GGQA 4G87A 3U0YA 2IU9A 2WVLA 3EH0A 2A8WA 3I0DA 1H7EA 5AJOA 3FTTA 3RMVA 2WLCA 2XATA 4ECMA 2YQHA 1KHRA 4B3UA 3SX7A 4E79A 4XWIA 1V82A 4O6MA 5DDVA 1QRGA 1KGTA 4JISA 4MNDA 4EEMA 5F42A 4NALA 5CMJA 2ICYA 4AAWA 3V8YA 1FXJA 5AFUU 2V0JA 4FREA 3SUCA 1H7FA 2YCMA 4LW3A 2PX7A 2OI7A 3Q1XA 3GUEA 2V0HA 2RITA 4KXOA 2VS5A 2X5ZA 1W55A 1H7GA 2YQCA 5IDSA 2AQ9A 4AC3A 1THJA 2FFVA 4EE5A 4G3QA 4HG6A 1XATA 3R3IA 2V0LA 1R7YA 3Q4SA 5D92A 3OGZA 4D0ZA 1OQMB 4HO3A 3E26A 5AJNA 1YROB 1QREA 1Z2FA 3F1CA 1H7LA 4DCLA 1QG8A 2A8UA 4EEAA 3OH1A 1GWWA 3HJJA 1FWYA 3TQDA 2ICXA 1KK5A 1MR9A 1T3DA 4H7OA 3KWDA 3SXCA 2BO6A 1EZIA 2XWMA 3I0KA 1S80A 3T57A 1VZUA 1NMMB 1SSQA 1HV9A 1ZJ2A 2JCOA 2I7BA 4N69A 1QRLA 2FYDB 3OU9A 5ADXU 4M98A 3FSCA 2WE9A 1LL0A 1ZDGA 4IRPA 3I0FA 3DHOA 3P1BA 5CMGX 1WVCA 5E3RA 4MYOA 1EYRA 4Y64A 4KQLA 1JV3A 3ZLLA 2XMEA 2FYAA 5CMHA 4FIXA 3GQ7A 3IOJA 3V4EA 3R5DA 2FY7A 4KT7A 2I5EA 1Z90A 1JV1A 1FXOA 1ZCUA 3D8VA 4FRDA 1O0RA 1S4OA 4B42A 2RJ5A 4N6BA 1I52A 4M4KA 5EJ1A 3I0EA 1KK6A 2ZU7A 4IRQA 3BXYA 4Y7VA 1QGQA 4HO2A 2TDTA 1JYLA 2WAWA 4Y7FA 4CJCA 1HM0A 4B4BA 4M2AA 3SPTA 2IUAA 3O3PA 4N6AA 3OTZA 3SRTA 3SXBA 2VS3A 4EE4A 1OMXA 2P2OA 4HUSA 2O1HA 4E1KA 1LZIA 1G8OA 5C4FA 1MP5A 4FCUA 2OEGA 4NAKA 2V0IA 3I0CA 1J2ZA 1ZCTA 3SX5A 1NHEB 5FU0A 2X65A 3BSSA 2BO4A 1M8NA 5JQQA 3NZ2A 1ZJPA 4HO6A 4MFGA 5L6VA 3MQGA 1ZI5A 1SSTA 4FRAA 1H5SC 1O7OA 3VBKA 1INJA 3FOQA 3EEVA 2ZU8A 4O6NA 3U2XA 4UEGA 2C0NA 1KK4A 5C38A 2E3DA 4G3SA 3FSBA 3V0PA 2XWNA 4Y6UA 3V0QA 5C47A 1KRRA 3KWEA 3GQ8A 2WEEA 1HM9A 4HCQA 1VM8A 5IDTA 3OAMA 1G23A 4NANA 3TK8A 3FSXA 1K4VA 2D0JA 5C3BA 4E6UA 3I0IX 1WSZA 1WT1A 3RMWA 3VBMA 5DG3A 2WLFA 1H3MA 4EQYA 2VHEA 3R0SA 3PKQA 5IFYA 3I3XA 1LZ7A 4JD0A 5CQLX 1TW5A 4AYLA 3V0MA 1H5SD 5DEMA 3OC9A 1ZJ0A 4HZDA 4FCEA 4G3PA 3R8YA 2WGZA 1XHBA 1ZI1A 3OKRA 2FFUA 1S4NA 1R7UA 2WVMA 2VXLA 4D11C 4IHHA 5CMFX 2JCKA 1O23B 3LW6A 5HS2A 4KPZA 1FG5N 1KQAA 2WLDA 2VSIA 4FQWA 3V0NA 4B4MA 1H5SA 1ZIZA 1R7XA 5DDTA 4B4GA 2VSHA 3VBIA 3USQA 5E3PA 4M9CA 1NQIB 3IXCA 4Y7UA 2RJ0A 4NAIA 5C1LA 1LVWA 4FRBA 1V83A 4HURA 3R5BA 4E6TA 4AA7A 1FR9A 4R7PA 2RIYA 2Z86A 4HO0A 5C4DA 2QKXA 2E8BA 2YC3A 3R5AA 4AYJA 4IHGA 2RIZA 1VH3A 1HJJA 3KIAA 5C4CA 5C4EA 5ADXV 4KC1A 1W57A 1VGTA 1G3LA 4FIYA 2RJ4A 4M28A 5EIYA 4CVHA 2X5SA 4MYBA 4EGGA 5C3AA 2FYBA 2AM3A 3VNPA 4FRQA 5J49A 3TZTA 5C1GA 3I0LA 4MZUA
chains in the Genus database with same CATH topology
2AM4A 4FRLA 3E25A 1QGSA 1MP4A 1YP4A 1MR7A 1H5RA 1JVDA 4DDZA 4DECA 3T7NA 3Q80A 4HOCA 1YP2A 3SXEA 3TISA 1H4CA 1LL2A 2W0WA 1KRUA 3EE5A 4P02A 1QRFA 1ZJ3A 2APCA 5CMIA 4J09A 3P47A 1NF5B 2RIXA 3IGJA 2O1GA 4EEGA 3CKOA 1TDTA 1H5TA 4C2SA 4CJBA 3K8DA 3FWWA 4Y6NA 2VXMA 4D11A 4Y7GA 2FYCB 1G0RA 3R5CA 3USRA 1NKHB 5C49A 4B2XA 3OUPA 1G97A 1XHDA 3U2TA 1IINA 2UX8A 2D7IA 2IU8A 1R82A 4J18A 1ZDFA 2AESA 3BCVA 4Y7TA 4ARWA 1VGZA 1G1LA 3V90A 3I0GA 3U2UA 2RJ1A 2V0KA 2FKOA 2W0VA 1ZCVA 4EE3A 3GVDA 3F1YA 1FO9A 1V3WA 2WLGA 4HO5A 2RJ7A 1YP3A 3V0LA 2Y4JA 3CJ8A 4EA7A 5CQMX 1TZFA 1H7TA 3U0XA 3VBJA 3I3AA 4EVWA 1S4PA 2NPOA 1JYKA 4CJ8A 4FRHA 3ZGGA 3OW5A 3T7MA 3U2VA 1WT3A 1MC3A 3U2WA 1R80A 1FOAA 2VFZA 1LZ0A 3RSBA 4GBPA 2X60A 1NWGB 1H7QA 5CQPA 5FV9A 3HSQA 2JF2A 1LZJA 1H5RB 2YC5A 1WT0A 2YQSA 3EG4A 3K8EA 1V67A 4Y9XA 3BSWA 1SSMA 3KWCA 1FO8A 4L41C 1W77A 3TIOA 5U2KA 1PZYB 3D5NA 4KPXA 4D0TA 5I1FA 2Y4MA 5EJZA 2IC7A 3JUKA 4P00A 2VD4A 1ZCYA 3JTJA 2RJ9A 2P73A 1O7QA 3PKPA 2RJ6A 4KRVA 3CKQA 4D48A 1KRVA 2NXVA 1FZWA 5C1HA 2YQJA 1FGGA 3MC4A 1MP3A 1OMZA 2DPWA 3FSYA 2VK9A 4EABA 1FRWA 4Y63A 4EEOA 3CKNA 4EA9A 2OI6A 3OTMA 2I5KA 4FROA 2Z87A 3I0JA 4KNRA 3V0OA 4Y62A 1QRMA 1VGUA 2O1FA 2Y6PA 3IOHA 4Q7CA 3SXAA 1ZI4A 1PZTA 5C36A 2RIJA 4M99A 1LL3A 4K6RA 2WLEA 1G93A 1JVGA 2XWLA 1H4EA 3CKVA 5BXCA 1VH1A 3CGXA 1R7TA 5FYEA 2J0AA 4N27A 4R37A 1V84A 4HO9A 1GQCA 3C8VA 3TDTA 3NGWA 3SXGA 2OI5A 1H5SB 3POLA 3BSYA 1ZJOA 1ON6A 5FUHA 3ZGFA 1R7VA 3QVBA 4FRMA 2AM5A 4ASJA 3JUJA 4KNXA 1H5TB 3T7OA 3DJ4A 4EA8A 1VPAA 1GWVA 3R3RA 1H4DA 1GQ9A 2VS4A 3I0HA 1H7HA 2Y4LA 4FRPA 1GA8A 4BQHA 1MRLA 2PGVA 3OH3A 3BRKX 2P6WA 2P72A 2WVKA 4KC4A 2QH5A 3TWDA 4EAAA 5CQOA 5FTVA 5D91A 1G95A 3N9WA 2AE7A 2BO7A 2YESA 1LXAA 3VBLA 2QIAA 1R81A 4R36A 2CU2A 2MZBA 1HM8A 4ASYA 2RJ8A 5C4BA 1ZHJA 1GX0A 3HL3A 4ZDQA 3V91A 3VBNA 3TV0A 1HJLA 3PNNA 5L6SA 2ZU9A 2JF3A 3PMOA 5FTSA 3Q7UA 1VZTA 1TVYA 5C48A 3F1XA 1ZJ1A 3DK5A 3VBPA 1TW1A 1VGWA 4HO8A 2JCJA 5E3QA 1ZI3A 4MIXA 1KGQA 2D7RA 3CU0A 3DUVA 2AH9A 4YS8A 1VICA 3SX3A 5C8RA 5CQNX 1VZXA 3V8ZA 1QQ0A 4HZCA 2AECA 4HO4A 1XZ6A 4M2BA 3D98A 3GOSA 3ECTA 1SS9A 4E75A 5AJPA 1FR8A 4LW6A 4IHFA 3JQYA 3CKJA 2BO8A 2QGIA 1FGXA 2Y7AA 2AGDA 2OEFA 2JCLA 1G9RA 3ZLKA 3MQHA 3OH2A 3ZF8A 5DEPA 3ST8A 1OCXA 1WT2A 4B5BA 1QWJA 2PGYA 5C3DA 2PA4A 4B2WA 1INIA 3BFPA 1E5KA 1G2VA 4BMAA 2QIVX 1ON8A 3SXDA 3SX8A 5FU8A 1GX4A 3R1WA 2Q4JA 3R2WA 1IIMA 3FS8A 4KC2A 4DE7A 1KWSA 3OH4A 2XMHA 5AFUV 2GGOA 2Y4KA 4ISXA 3IOIA 2J0BA 3OH0A 2GGQA 4G87A 3U0YA 2IU9A 2WVLA 3EH0A 2A8WA 3I0DA 1H7EA 5AJOA 3FTTA 3RMVA 2WLCA 2XATA 4ECMA 2YQHA 1KHRA 4B3UA 3SX7A 4E79A 4XWIA 1V82A 4O6MA 5DDVA 1QRGA 1KGTA 4JISA 4MNDA 4EEMA 5F42A 4NALA 5CMJA 2ICYA 4AAWA 3V8YA 1FXJA 5AFUU 2V0JA 4FREA 1H7FA 2YCMA 4LW3A 2PX7A 2OI7A 3Q1XA 3GUEA 2V0HA 2RITA 4KXOA 2VS5A 2X5ZA 1W55A 1H7GA 2YQCA 5IDSA 2AQ9A 4AC3A 1THJA 2FFVA 4EE5A 4G3QA 4HG6A 1XATA 3R3IA 2V0LA 1R7YA 3Q4SA 5D92A 3OGZA 4D0ZA 1OQMB 4HO3A 3E26A 5AJNA 1YROB 1QREA 3F1CA 1H7LA 4DCLA 1QG8A 2A8UA 4EEAA 3OH1A 1GWWA 3HJJA 1FWYA 3TQDA 2ICXA 1KK5A 1MR9A 1T3DA 4H7OA 3KWDA 3SXCA 2BO6A 1EZIA 2XWMA 3I0KA 1S80A 3T57A 1VZUA 1NMMB 1SSQA 1HV9A 1ZJ2A 2JCOA 2I7BA 4N69A 1QRLA 2FYDB 3OU9A 5ADXU 4M98A 3FSCA 2WE9A 1LL0A 1ZDGA 4IRPA 3I0FA 3DHOA 3P1BA 5CMGX 1WVCA 5E3RA 4MYOA 1EYRA 4Y64A 4KQLA 1JV3A 3ZLLA 2XMEA 2FYAA 5CMHA 4FIXA 3IOJA 3V4EA 3R5DA 2FY7A 4KT7A 2I5EA 1Z90A 1JV1A 1FXOA 1ZCUA 3D8VA 4FRDA 1O0RA 1S4OA 4B42A 2RJ5A 4N6BA 1I52A 4M4KA 5EJ1A 3I0EA 1KK6A 2ZU7A 4IRQA 3BXYA 4Y7VA 1QGQA 4HO2A 2TDTA 1JYLA 2WAWA 4Y7FA 4CJCA 1HM0A 4B4BA 4M2AA 3SPTA 2IUAA 3O3PA 4N6AA 3OTZA 3SRTA 3SXBA 2VS3A 4EE4A 1OMXA 2P2OA 4HUSA 2O1HA 4E1KA 1G8OA 1LZIA 5C4FA 1MP5A 4FCUA 2OEGA 4NAKA 2V0IA 3I0CA 1J2ZA 1ZCTA 3SX5A 1NHEB 5FU0A 2X65A 3BSSA 2BO4A 5JQQA 3NZ2A 1ZJPA 4HO6A 4MFGA 5L6VA 3MQGA 1ZI5A 1SSTA 4FRAA 1H5SC 1O7OA 3VBKA 1INJA 3FOQA 3EEVA 2ZU8A 4O6NA 3U2XA 4UEGA 2C0NA 1KK4A 5C38A 2E3DA 4G3SA 3FSBA 3V0PA 2XWNA 4Y6UA 3V0QA 5C47A 1KRRA 3KWEA 2WEEA 5IDTA 1HM9A 4HCQA 1VM8A 3OAMA 1G23A 4NANA 3TK8A 3FSXA 1K4VA 2D0JA 5C3BA 4E6UA 3I0IX 1WSZA 1WT1A 3RMWA 3VBMA 5DG3A 2WLFA 1H3MA 4EQYA 2VHEA 3R0SA 3PKQA 5IFYA 3I3XA 1LZ7A 4JD0A 5CQLX 1TW5A 4AYLA 3V0MA 1H5SD 5DEMA 3OC9A 1ZJ0A 4HZDA 4FCEA 4G3PA 3R8YA 2WGZA 1XHBA 1ZI1A 3OKRA 2FFUA 1S4NA 1R7UA 2WVMA 2VXLA 4D11C 4IHHA 5CMFX 2JCKA 1O23B 3LW6A 5HS2A 4KPZA 1FG5N 1KQAA 2WLDA 2VSIA 4FQWA 3V0NA 4B4MA 1H5SA 1ZIZA 1R7XA 5DDTA 4B4GA 2VSHA 3VBIA 3USQA 5E3PA 4M9CA 1NQIB 3IXCA 4Y7UA 2RJ0A 4NAIA 5C1LA 1LVWA 4FRBA 1V83A 4HURA 3R5BA 4E6TA 4AA7A 1FR9A 4R7PA 2RIYA 2Z86A 4HO0A 5C4DA 2QKXA 2E8BA 2YC3A 3R5AA 4AYJA 4IHGA 2RIZA 1VH3A 1HJJA 3KIAA 5C4CA 5C4EA 5ADXV 4KC1A 1W57A 1VGTA 1G3LA 4FIYA 2RJ4A 4M28A 5EIYA 4CVHA 2X5SA 4MYBA 4EGGA 5C3AA 2FYBA 2AM3A 3VNPA 4FRQA 5J49A 3TZTA 5C1GA 3I0LA 4MZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AM4 A;  4FRL A;  3E25 A;  1QGS A;  1MP4 A;  1YP4 A;  1MR7 A;  1H5R A;  1JVD A;  4DDZ A;  4DEC A;  3T7N A;  3Q80 A;  4HOC A;  1YP2 A;  3SXE A;  3TIS A;  1H4C A;  1LL2 A;  2W0W A;  1KRU A;  3EE5 A;  4P02 A;  1QRF A;  1ZJ3 A;  2APC A;  5CMI A;  4J09 A;  3P47 A;  1NF5 B;  2RIX A;  3IGJ A;  2O1G A;  4EEG A;  3CKO A;  1TDT A;  1H5T A;  4C2S A;  4CJB A;  3K8D A;  3FWW A;  4Y6N A;  2VXM A;  4D11 A;  4Y7G A;  2FYC B;  1G0R A;  3R5C A;  3USR A;  1NKH B;  5C49 A;  4B2X A;  3OUP A;  1G97 A;  1XHD A;  3U2T A;  1IIN A;  2UX8 A;  2D7I A;  2IU8 A;  1R82 A;  4J18 A;  1ZDF A;  2AES A;  3BCV A;  4Y7T A;  4ARW A;  1VGZ A;  1G1L A;  3V90 A;  3I0G A;  3U2U A;  2RJ1 A;  2V0K A;  2FKO A;  2W0V A;  1ZCV A;  4EE3 A;  3GVD A;  3F1Y A;  1FO9 A;  1V3W A;  2WLG A;  4HO5 A;  2RJ7 A;  1YP3 A;  3V0L A;  2Y4J A;  3CJ8 A;  4EA7 A;  5CQM X;  1TZF A;  1H7T A;  3U0X A;  3VBJ A;  3I3A A;  4EVW A;  1S4P A;  2NPO A;  1JYK A;  4CJ8 A;  4FRH A;  3ZGG A;  3OW5 A;  3T7M A;  3U2V A;  1WT3 A;  1MC3 A;  3U2W A;  1R80 A;  1FOA A;  2VFZ A;  1LZ0 A;  3RSB A;  4GBP A;  2X60 A;  1NWG B;  1H7Q A;  5CQP A;  5FV9 A;  3HSQ A;  2JF2 A;  1LZJ A;  1H5R B;  2YC5 A;  1WT0 A;  2YQS A;  3EG4 A;  3K8E A;  1V67 A;  4Y9X A;  3BSW A;  1SSM A;  3KWC A;  1FO8 A;  4L41 C;  1W77 A;  3TIO A;  5U2K A;  1PZY B;  3D5N A;  4KPX A;  4D0T A;  5I1F A;  2Y4M A;  5EJZ A;  2IC7 A;  3JUK A;  4P00 A;  2VD4 A;  1ZCY A;  3JTJ A;  2RJ9 A;  2P73 A;  1O7Q A;  3PKP A;  2RJ6 A;  4KRV A;  3CKQ A;  4D48 A;  1KRV A;  2NXV A;  1FZW A;  5C1H A;  2YQJ A;  1FGG A;  3MC4 A;  1MP3 A;  1OMZ A;  2DPW A;  3FSY A;  4EEO A;  4EAB A;  1FRW A;  4Y63 A;  3CKN A;  4EA9 A;  2OI6 A;  3OTM A;  2I5K A;  4FRO A;  2Z87 A;  3I0J A;  4KNR A;  3V0O A;  4Y62 A;  1QRM A;  1VGU A;  2O1F A;  2Y6P A;  3IOH A;  3SXA A;  1ZI4 A;  1PZT A;  5C36 A;  2RIJ A;  4M99 A;  1LL3 A;  4K6R A;  2WLE A;  1G93 A;  1JVG A;  2XWL A;  1H4E A;  3CKV A;  5BXC A;  1VH1 A;  3CGX A;  1R7T A;  5FYE A;  4N27 A;  4R37 A;  1V84 A;  4HO9 A;  1GQC A;  3C8V A;  3TDT A;  3NGW A;  3SXG A;  2OI5 A;  1H5S B;  3POL A;  3BSY A;  1ZJO A;  1ON6 A;  5FUH A;  3ZGF A;  1R7V A;  3QVB A;  4FRM A;  2AM5 A;  4ASJ A;  3JUJ A;  4KNX A;  1H5T B;  3T7O A;  3DJ4 A;  4EA8 A;  1VPA A;  1GWV A;  3R3R A;  1H4D A;  1GQ9 A;  2VS4 A;  3I0H A;  1H7H A;  2Y4L A;  4FRP A;  1GA8 A;  4BQH A;  1MRL A;  2PGV A;  3OH3 A;  3BRK X;  2P6W A;  2P72 A;  2WVK A;  4KC4 A;  2QH5 A;  3TWD A;  4EAA A;  5CQO A;  5FTV A;  1G95 A;  3N9W A;  2AE7 A;  2BO7 A;  2YES A;  1LXA A;  3VBL A;  2QIA A;  1R81 A;  4R36 A;  2CU2 A;  2MZB A;  1HM8 A;  4ASY A;  2RJ8 A;  5C4B A;  1ZHJ A;  1GX0 A;  3HL3 A;  4ZDQ A;  3V91 A;  3VBN A;  3TV0 A;  1HJL A;  3PNN A;  5L6S A;  2ZU9 A;  2JF3 A;  3PMO A;  5FTS A;  3Q7U A;  1VZT A;  1TVY A;  5C48 A;  3F1X A;  1ZJ1 A;  3DK5 A;  3VBP A;  1TW1 A;  1VGW A;  4HO8 A;  2JCJ A;  5E3Q A;  1ZI3 A;  1KGQ A;  2D7R A;  3CU0 A;  3DUV A;  2AH9 A;  4YS8 A;  1VIC A;  3SX3 A;  5C8R A;  5CQN X;  1VZX A;  3V8Z A;  1QQ0 A;  4HZC A;  2AEC A;  4HO4 A;  1XZ6 A;  4M2B A;  3D98 A;  3GOS A;  3ECT A;  1SS9 A;  4E75 A;  5AJP A;  1FR8 A;  4LW6 A;  4IHF A;  3JQY A;  3CKJ A;  2BO8 A;  2QGI A;  1FGX A;  2Y7A A;  2AGD A;  2OEF A;  2JCL A;  1G9R A;  3ZLK A;  3MQH A;  3OH2 A;  3ZF8 A;  5DEP A;  3ST8 A;  1OCX A;  1WT2 A;  4B5B A;  1QWJ A;  2PGY A;  5C3D A;  2PA4 A;  4B2W A;  1INI A;  3BFP A;  1E5K A;  1G2V A;  4BMA A;  2QIV X;  1ON8 A;  3SXD A;  3SX8 A;  5FU8 A;  1GX4 A;  3R1W A;  2Q4J A;  3R2W A;  1IIM A;  3FS8 A;  4KC2 A;  4DE7 A;  1KWS A;  3OH4 A;  2XMH A;  5AFU V;  2GGO A;  2Y4K A;  4ISX A;  3IOI A;  3OH0 A;  2GGQ A;  4G87 A;  3U0Y A;  2IU9 A;  2WVL A;  3EH0 A;  2A8W A;  3I0D A;  1H7E A;  5AJO A;  3FTT A;  3RMV A;  2WLC A;  2XAT A;  4ECM A;  2YQH A;  1KHR A;  4B3U A;  3SX7 A;  4E79 A;  4XWI A;  1V82 A;  5DDV A;  1QRG A;  1KGT A;  4JIS A;  4MND A;  4EEM A;  5F42 A;  4NAL A;  5CMJ A;  2ICY A;  4AAW A;  3V8Y A;  1FXJ A;  5AFU U;  2V0J A;  4FRE A;  1H7F A;  2YCM A;  4LW3 A;  2PX7 A;  2OI7 A;  3Q1X A;  3GUE A;  2V0H A;  2RIT A;  4KXO A;  2VS5 A;  2X5Z A;  1W55 A;  1H7G A;  2YQC A;  5IDS A;  2AQ9 A;  4AC3 A;  1THJ A;  2FFV A;  4EE5 A;  4G3Q A;  4HG6 A;  1XAT A;  3R3I A;  2V0L A;  1R7Y A;  3Q4S A;  3OGZ A;  4D0Z A;  1OQM B;  4HO3 A;  3E26 A;  5AJN A;  1YRO B;  1QRE A;  3F1C A;  1H7L A;  4DCL A;  1QG8 A;  2A8U A;  4EEA A;  3OH1 A;  1GWW A;  3HJJ A;  1FWY A;  3TQD A;  2ICX A;  1KK5 A;  1MR9 A;  1T3D A;  4H7O A;  3KWD A;  3SXC A;  2BO6 A;  1EZI A;  2XWM A;  3I0K A;  1S80 A;  3T57 A;  1VZU A;  1NMM B;  1SSQ A;  1HV9 A;  1ZJ2 A;  2JCO A;  2I7B A;  4N69 A;  1QRL A;  2FYD B;  3OU9 A;  5ADX U;  4M98 A;  3FSC A;  2WE9 A;  1LL0 A;  1ZDG A;  4IRP A;  3I0F A;  3DHO A;  3P1B A;  5CMG X;  1WVC A;  5E3R A;  4MYO A;  1EYR A;  4Y64 A;  4KQL A;  1JV3 A;  3ZLL A;  2XME A;  2FYA A;  5CMH A;  3IOJ A;  3V4E A;  3R5D A;  2FY7 A;  4KT7 A;  2I5E A;  1Z90 A;  1JV1 A;  1FXO A;  1ZCU A;  3D8V A;  4FRD A;  1O0R A;  1S4O A;  4B42 A;  2RJ5 A;  4N6B A;  1I52 A;  4M4K A;  5EJ1 A;  3I0E A;  1KK6 A;  2ZU7 A;  4IRQ A;  3BXY A;  4Y7V A;  1QGQ A;  4HO2 A;  2TDT A;  1JYL A;  2WAW A;  4Y7F A;  4CJC A;  1HM0 A;  4B4B A;  4M2A A;  3SPT A;  2IUA A;  3O3P A;  4N6A A;  3OTZ A;  3SRT A;  3SXB A;  2VS3 A;  4EE4 A;  1OMX A;  2P2O A;  4HUS A;  2O1H A;  4E1K A;  1G8O A;  1LZI A;  5C4F A;  1MP5 A;  4FCU A;  2OEG A;  4NAK A;  2V0I A;  3I0C A;  1J2Z A;  1ZCT A;  3SX5 A;  1NHE B;  5FU0 A;  2X65 A;  3BSS A;  2BO4 A;  5JQQ A;  3NZ2 A;  1ZJP A;  4HO6 A;  4MFG A;  5L6V A;  3MQG A;  1ZI5 A;  1SST A;  4FRA A;  1H5S C;  1O7O A;  3VBK A;  1INJ A;  3FOQ A;  3EEV A;  2ZU8 A;  3U2X A;  4UEG A;  1KK4 A;  5C38 A;  2E3D A;  4G3S A;  3FSB A;  3V0P A;  2XWN A;  4Y6U A;  3V0Q A;  5C47 A;  1KRR A;  3KWE A;  2WEE A;  5IDT A;  1HM9 A;  4HCQ A;  1VM8 A;  3OAM A;  1G23 A;  4NAN A;  3TK8 A;  3FSX A;  1K4V A;  2D0J A;  5C3B A;  4E6U A;  3I0I X;  1WSZ A;  1WT1 A;  3RMW A;  3VBM A;  5DG3 A;  2WLF A;  1H3M A;  4EQY A;  2VHE A;  3R0S A;  3PKQ A;  5IFY A;  3I3X A;  1LZ7 A;  4JD0 A;  5CQL X;  1TW5 A;  4AYL A;  3V0M A;  1H5S D;  5DEM A;  3OC9 A;  1ZJ0 A;  4HZD A;  4FCE A;  4G3P A;  3R8Y A;  2WGZ A;  1XHB A;  1ZI1 A;  3OKR A;  2FFU A;  1S4N A;  1R7U A;  2WVM A;  2VXL A;  4D11 C;  4IHH A;  5CMF X;  2JCK A;  1O23 B;  3LW6 A;  5HS2 A;  4KPZ A;  1FG5 N;  1KQA A;  2WLD A;  2VSI A;  4FQW A;  3V0N A;  4B4M A;  1H5S A;  1ZIZ A;  1R7X A;  5DDT A;  4B4G A;  2VSH A;  3VBI A;  3USQ A;  5E3P A;  4M9C A;  1NQI B;  3IXC A;  4Y7U A;  2RJ0 A;  4NAI A;  5C1L A;  1LVW A;  4FRB A;  1V83 A;  4HUR A;  3R5B A;  4E6T A;  4AA7 A;  1FR9 A;  4R7P A;  2RIY A;  2Z86 A;  4HO0 A;  5C4D A;  2QKX A;  2E8B A;  2YC3 A;  3R5A A;  4AYJ A;  4IHG A;  2RIZ A;  1VH3 A;  1HJJ A;  3KIA A;  5C4C A;  5C4E A;  5ADX V;  4KC1 A;  1W57 A;  1VGT A;  1G3L A;  2RJ4 A;  4M28 A;  5EIY A;  4CVH A;  2X5S A;  4MYB A;  4EGG A;  5C3A A;  2FYB A;  2AM3 A;  3VNP A;  4FRQ A;  5J49 A;  3TZT A;  5C1G A;  3I0L A;  4MZU A; 
#chains in the Genus database with same CATH topology
 2AM4 A;  4FRL A;  3E25 A;  1QGS A;  1MP4 A;  1YP4 A;  1MR7 A;  1H5R A;  1JVD A;  4DDZ A;  4DEC A;  3T7N A;  3Q80 A;  4HOC A;  1YP2 A;  3SXE A;  3TIS A;  1H4C A;  1LL2 A;  2W0W A;  1KRU A;  3EE5 A;  4P02 A;  1QRF A;  1ZJ3 A;  2APC A;  5CMI A;  4J09 A;  3P47 A;  1NF5 B;  2RIX A;  3IGJ A;  2O1G A;  4EEG A;  3CKO A;  1TDT A;  1H5T A;  4C2S A;  4CJB A;  3K8D A;  3FWW A;  4Y6N A;  2VXM A;  4D11 A;  4Y7G A;  2FYC B;  1G0R A;  3R5C A;  3USR A;  1NKH B;  5C49 A;  4B2X A;  1N4I A;  3OUP A;  3GQ9 A;  1G97 A;  1XHD A;  3U2T A;  1IIN A;  2UX8 A;  2D7I A;  2IU8 A;  1R82 A;  4J18 A;  1ZDF A;  2AES A;  3BCV A;  4Y7T A;  4ARW A;  1VGZ A;  1G1L A;  3V90 A;  3I0G A;  3U2U A;  2RJ1 A;  2V0K A;  2FKO A;  2W0V A;  1ZCV A;  4EE3 A;  3GVD A;  3F1Y A;  1FO9 A;  1V3W A;  2WLG A;  4HO5 A;  2RJ7 A;  1YP3 A;  3V0L A;  2Y4J A;  3CJ8 A;  4EA7 A;  5CQM X;  1TZF A;  1H7T A;  3U0X A;  3VBJ A;  3I3A A;  4EVW A;  1S4P A;  2NPO A;  1JYK A;  4CJ8 A;  4FRH A;  3ZGG A;  3OW5 A;  3T7M A;  3U2V A;  1WT3 A;  1MC3 A;  3U2W A;  1R80 A;  1FOA A;  2VFZ A;  1LZ0 A;  3RSB A;  4GBP A;  2X60 A;  1NWG B;  1H7Q A;  5CQP A;  5FV9 A;  3HSQ A;  2JF2 A;  1LZJ A;  1H5R B;  2YC5 A;  1WT0 A;  2YQS A;  3EG4 A;  3K8E A;  1V67 A;  4Y9X A;  3BSW A;  1SSM A;  3KWC A;  1FO8 A;  4L41 C;  1W77 A;  3TIO A;  5U2K A;  1PZY B;  3D5N A;  4KPX A;  4D0T A;  5I1F A;  2Y4M A;  5EJZ A;  2IC7 A;  3JUK A;  4P00 A;  2VD4 A;  1ZCY A;  3JTJ A;  2RJ9 A;  2P73 A;  1O7Q A;  3PKP A;  2RJ6 A;  4KRV A;  3CKQ A;  4D48 A;  1KRV A;  2NXV A;  1FZW A;  5C1H A;  2YQJ A;  1FGG A;  3MC4 A;  1MP3 A;  1OMZ A;  2DPW A;  3FSY A;  2VK9 A;  4EAB A;  1FRW A;  4Y63 A;  4EEO A;  3CKN A;  4EA9 A;  2OI6 A;  3OTM A;  2I5K A;  4FRO A;  2Z87 A;  3I0J A;  4KNR A;  3V0O A;  4Y62 A;  1QRM A;  1VGU A;  2O1F A;  2Y6P A;  3IOH A;  4Q7C A;  3SXA A;  1ZI4 A;  1PZT A;  5C36 A;  2RIJ A;  4M99 A;  1LL3 A;  4K6R A;  2WLE A;  1G93 A;  1JVG A;  2XWL A;  1H4E A;  3CKV A;  5BXC A;  1VH1 A;  3CGX A;  1R7T A;  5FYE A;  2J0A A;  4N27 A;  4R37 A;  1V84 A;  4HO9 A;  1GQC A;  3C8V A;  3TDT A;  3NGW A;  3SXG A;  2OI5 A;  1H5S B;  3POL A;  3BSY A;  1ZJO A;  1ON6 A;  5FUH A;  3ZGF A;  1R7V A;  3QVB A;  4FRM A;  2AM5 A;  4ASJ A;  3JUJ A;  4KNX A;  1H5T B;  3T7O A;  3DJ4 A;  4EA8 A;  1VPA A;  1GWV A;  3R3R A;  1H4D A;  1GQ9 A;  2VS4 A;  3I0H A;  1H7H A;  2Y4L A;  4FRP A;  1GA8 A;  4BQH A;  1MRL A;  2PGV A;  3OH3 A;  3BRK X;  2P6W A;  2P72 A;  2WVK A;  4KC4 A;  2QH5 A;  3TWD A;  4EAA A;  5CQO A;  5FTV A;  5D91 A;  1G95 A;  3N9W A;  2AE7 A;  2BO7 A;  2YES A;  1LXA A;  3VBL A;  2QIA A;  3GQA A;  1R81 A;  4R36 A;  2CU2 A;  2MZB A;  1HM8 A;  4ASY A;  2RJ8 A;  5C4B A;  1ZHJ A;  1GX0 A;  3HL3 A;  4ZDQ A;  3V91 A;  3VBN A;  3TV0 A;  1HJL A;  3PNN A;  5L6S A;  2ZU9 A;  2JF3 A;  3PMO A;  5FTS A;  3Q7U A;  1VZT A;  1TVY A;  5C48 A;  3F1X A;  1ZJ1 A;  3DK5 A;  3VBP A;  1TW1 A;  1VGW A;  4HO8 A;  1L0S A;  2JCJ A;  5E3Q A;  1ZI3 A;  4MIX A;  1KGQ A;  2D7R A;  3CU0 A;  3DUV A;  2AH9 A;  4YS8 A;  1VIC A;  3SX3 A;  5C8R A;  5CQN X;  1VZX A;  3V8Z A;  1QQ0 A;  4HZC A;  2AEC A;  4HO4 A;  1EWW A;  1XZ6 A;  4M2B A;  3D98 A;  3GOS A;  3ECT A;  1SS9 A;  4E75 A;  5AJP A;  1FR8 A;  4LW6 A;  4IHF A;  3JQY A;  3CKJ A;  2BO8 A;  2QGI A;  1FGX A;  2Y7A A;  2AGD A;  2OEF A;  2JCL A;  1G9R A;  3ZLK A;  3MQH A;  3OH2 A;  3ZF8 A;  5DEP A;  3ST8 A;  1OCX A;  1WT2 A;  4B5B A;  1QWJ A;  2PGY A;  5C3D A;  2PA4 A;  4B2W A;  1INI A;  3BFP A;  1E5K A;  1G2V A;  4BMA A;  2QIV X;  1ON8 A;  3SXD A;  3SX8 A;  5FU8 A;  1GX4 A;  3R1W A;  2Q4J A;  3R2W A;  1IIM A;  3FS8 A;  4KC2 A;  4DE7 A;  1KWS A;  3OH4 A;  2XMH A;  5AFU V;  2GGO A;  2Y4K A;  4ISX A;  3IOI A;  2J0B A;  3OH0 A;  2GGQ A;  4G87 A;  3U0Y A;  2IU9 A;  2WVL A;  3EH0 A;  2A8W A;  3I0D A;  1H7E A;  5AJO A;  3FTT A;  3RMV A;  2WLC A;  2XAT A;  4ECM A;  2YQH A;  1KHR A;  4B3U A;  3SX7 A;  4E79 A;  4XWI A;  1V82 A;  4O6M A;  5DDV A;  1QRG A;  1KGT A;  4JIS A;  4MND A;  4EEM A;  5F42 A;  4NAL A;  5CMJ A;  2ICY A;  4AAW A;  3V8Y A;  1FXJ A;  5AFU U;  2V0J A;  4FRE A;  3SUC A;  1H7F A;  2YCM A;  4LW3 A;  2PX7 A;  2OI7 A;  3Q1X A;  3GUE A;  2V0H A;  2RIT A;  4KXO A;  2VS5 A;  2X5Z A;  1W55 A;  1H7G A;  2YQC A;  5IDS A;  2AQ9 A;  4AC3 A;  1THJ A;  2FFV A;  4EE5 A;  4G3Q A;  4HG6 A;  1XAT A;  3R3I A;  2V0L A;  1R7Y A;  3Q4S A;  5D92 A;  3OGZ A;  4D0Z A;  1OQM B;  4HO3 A;  3E26 A;  5AJN A;  1YRO B;  1QRE A;  1Z2F A;  3F1C A;  1H7L A;  4DCL A;  1QG8 A;  2A8U A;  4EEA A;  3OH1 A;  1GWW A;  3HJJ A;  1FWY A;  3TQD A;  2ICX A;  1KK5 A;  1MR9 A;  1T3D A;  4H7O A;  3KWD A;  3SXC A;  2BO6 A;  1EZI A;  2XWM A;  3I0K A;  1S80 A;  3T57 A;  1VZU A;  1NMM B;  1SSQ A;  1HV9 A;  1ZJ2 A;  2JCO A;  2I7B A;  4N69 A;  1QRL A;  2FYD B;  3OU9 A;  5ADX U;  4M98 A;  3FSC A;  2WE9 A;  1LL0 A;  1ZDG A;  4IRP A;  3I0F A;  3DHO A;  3P1B A;  5CMG X;  1WVC A;  5E3R A;  4MYO A;  1EYR A;  4Y64 A;  4KQL A;  1JV3 A;  3ZLL A;  2XME A;  2FYA A;  5CMH A;  4FIX A;  3GQ7 A;  3IOJ A;  3V4E A;  3R5D A;  2FY7 A;  4KT7 A;  2I5E A;  1Z90 A;  1JV1 A;  1FXO A;  1ZCU A;  3D8V A;  4FRD A;  1O0R A;  1S4O A;  4B42 A;  2RJ5 A;  4N6B A;  1I52 A;  4M4K A;  5EJ1 A;  3I0E A;  1KK6 A;  2ZU7 A;  4IRQ A;  3BXY A;  4Y7V A;  1QGQ A;  4HO2 A;  2TDT A;  1JYL A;  2WAW A;  4Y7F A;  4CJC A;  1HM0 A;  4B4B A;  4M2A A;  3SPT A;  2IUA A;  3O3P A;  4N6A A;  3OTZ A;  3SRT A;  3SXB A;  2VS3 A;  4EE4 A;  1OMX A;  2P2O A;  4HUS A;  2O1H A;  4E1K A;  1LZI A;  1G8O A;  5C4F A;  1MP5 A;  4FCU A;  2OEG A;  4NAK A;  2V0I A;  3I0C A;  1J2Z A;  1ZCT A;  3SX5 A;  1NHE B;  5FU0 A;  2X65 A;  3BSS A;  2BO4 A;  1M8N A;  5JQQ A;  3NZ2 A;  1ZJP A;  4HO6 A;  4MFG A;  5L6V A;  3MQG A;  1ZI5 A;  1SST A;  4FRA A;  1H5S C;  1O7O A;  3VBK A;  1INJ A;  3FOQ A;  3EEV A;  2ZU8 A;  4O6N A;  3U2X A;  4UEG A;  2C0N A;  1KK4 A;  5C38 A;  2E3D A;  4G3S A;  3FSB A;  3V0P A;  2XWN A;  4Y6U A;  3V0Q A;  5C47 A;  1KRR A;  3KWE A;  3GQ8 A;  2WEE A;  1HM9 A;  4HCQ A;  1VM8 A;  5IDT A;  3OAM A;  1G23 A;  4NAN A;  3TK8 A;  3FSX A;  1K4V A;  2D0J A;  5C3B A;  4E6U A;  3I0I X;  1WSZ A;  1WT1 A;  3RMW A;  3VBM A;  5DG3 A;  2WLF A;  1H3M A;  4EQY A;  2VHE A;  3R0S A;  3PKQ A;  5IFY A;  3I3X A;  1LZ7 A;  4JD0 A;  5CQL X;  1TW5 A;  4AYL A;  3V0M A;  1H5S D;  5DEM A;  3OC9 A;  1ZJ0 A;  4HZD A;  4FCE A;  4G3P A;  3R8Y A;  2WGZ A;  1XHB A;  1ZI1 A;  3OKR A;  2FFU A;  1S4N A;  1R7U A;  2WVM A;  2VXL A;  4D11 C;  4IHH A;  5CMF X;  2JCK A;  1O23 B;  3LW6 A;  5HS2 A;  4KPZ A;  1FG5 N;  1KQA A;  2WLD A;  2VSI A;  4FQW A;  3V0N A;  4B4M A;  1H5S A;  1ZIZ A;  1R7X A;  5DDT A;  4B4G A;  2VSH A;  3VBI A;  3USQ A;  5E3P A;  4M9C A;  1NQI B;  3IXC A;  4Y7U A;  2RJ0 A;  4NAI A;  5C1L A;  1LVW A;  4FRB A;  1V83 A;  4HUR A;  3R5B A;  4E6T A;  4AA7 A;  1FR9 A;  4R7P A;  2RIY A;  2Z86 A;  4HO0 A;  5C4D A;  2QKX A;  2E8B A;  2YC3 A;  3R5A A;  4AYJ A;  4IHG A;  2RIZ A;  1VH3 A;  1HJJ A;  3KIA A;  5C4C A;  5C4E A;  5ADX V;  4KC1 A;  1W57 A;  1VGT A;  1G3L A;  4FIY A;  2RJ4 A;  4M28 A;  5EIY A;  4CVH A;  2X5S A;  4MYB A;  4EGG A;  5C3A A;  2FYB A;  2AM3 A;  3VNP A;  4FRQ A;  5J49 A;  3TZT A;  5C1G A;  3I0L A;  4MZU A; 
#chains in the Genus database with same CATH homology
 2AM4 A;  4FRL A;  3E25 A;  1QGS A;  1MP4 A;  1YP4 A;  1MR7 A;  1H5R A;  1JVD A;  4DDZ A;  4DEC A;  3T7N A;  3Q80 A;  4HOC A;  1YP2 A;  3SXE A;  3TIS A;  1H4C A;  1LL2 A;  2W0W A;  1KRU A;  3EE5 A;  4P02 A;  1QRF A;  1ZJ3 A;  2APC A;  5CMI A;  4J09 A;  3P47 A;  1NF5 B;  2RIX A;  3IGJ A;  2O1G A;  4EEG A;  3CKO A;  1TDT A;  1H5T A;  4C2S A;  4CJB A;  3K8D A;  3FWW A;  4Y6N A;  2VXM A;  4D11 A;  4Y7G A;  2FYC B;  1G0R A;  3R5C A;  3USR A;  1NKH B;  5C49 A;  4B2X A;  3OUP A;  1G97 A;  1XHD A;  3U2T A;  1IIN A;  2UX8 A;  2D7I A;  2IU8 A;  1R82 A;  4J18 A;  1ZDF A;  2AES A;  3BCV A;  4Y7T A;  4ARW A;  1VGZ A;  1G1L A;  3V90 A;  3I0G A;  3U2U A;  2RJ1 A;  2V0K A;  2FKO A;  2W0V A;  1ZCV A;  4EE3 A;  3GVD A;  3F1Y A;  1FO9 A;  1V3W A;  2WLG A;  4HO5 A;  2RJ7 A;  1YP3 A;  3V0L A;  2Y4J A;  3CJ8 A;  4EA7 A;  5CQM X;  1TZF A;  1H7T A;  3U0X A;  3VBJ A;  3I3A A;  4EVW A;  1S4P A;  2NPO A;  1JYK A;  4CJ8 A;  4FRH A;  3ZGG A;  3OW5 A;  3T7M A;  3U2V A;  1WT3 A;  1MC3 A;  3U2W A;  1R80 A;  1FOA A;  2VFZ A;  1LZ0 A;  3RSB A;  4GBP A;  2X60 A;  1NWG B;  1H7Q A;  5CQP A;  5FV9 A;  3HSQ A;  2JF2 A;  1LZJ A;  1H5R B;  2YC5 A;  1WT0 A;  2YQS A;  3EG4 A;  3K8E A;  1V67 A;  4Y9X A;  3BSW A;  1SSM A;  3KWC A;  1FO8 A;  4L41 C;  1W77 A;  3TIO A;  5U2K A;  1PZY B;  3D5N A;  4KPX A;  4D0T A;  5I1F A;  2Y4M A;  5EJZ A;  2IC7 A;  3JUK A;  4P00 A;  2VD4 A;  1ZCY A;  3JTJ A;  2RJ9 A;  2P73 A;  1O7Q A;  3PKP A;  2RJ6 A;  4KRV A;  3CKQ A;  4D48 A;  1KRV A;  2NXV A;  1FZW A;  5C1H A;  2YQJ A;  1FGG A;  3MC4 A;  1MP3 A;  1OMZ A;  2DPW A;  3FSY A;  2VK9 A;  4EAB A;  1FRW A;  4Y63 A;  4EEO A;  3CKN A;  4EA9 A;  2OI6 A;  3OTM A;  2I5K A;  4FRO A;  2Z87 A;  3I0J A;  4KNR A;  3V0O A;  4Y62 A;  1QRM A;  1VGU A;  2O1F A;  2Y6P A;  3IOH A;  4Q7C A;  3SXA A;  1ZI4 A;  1PZT A;  5C36 A;  2RIJ A;  4M99 A;  1LL3 A;  4K6R A;  2WLE A;  1G93 A;  1JVG A;  2XWL A;  1H4E A;  3CKV A;  5BXC A;  1VH1 A;  3CGX A;  1R7T A;  5FYE A;  2J0A A;  4N27 A;  4R37 A;  1V84 A;  4HO9 A;  1GQC A;  3C8V A;  3TDT A;  3NGW A;  3SXG A;  2OI5 A;  1H5S B;  3POL A;  3BSY A;  1ZJO A;  1ON6 A;  5FUH A;  3ZGF A;  1R7V A;  3QVB A;  4FRM A;  2AM5 A;  4ASJ A;  3JUJ A;  4KNX A;  1H5T B;  3T7O A;  3DJ4 A;  4EA8 A;  1VPA A;  1GWV A;  3R3R A;  1H4D A;  1GQ9 A;  2VS4 A;  3I0H A;  1H7H A;  2Y4L A;  4FRP A;  1GA8 A;  4BQH A;  1MRL A;  2PGV A;  3OH3 A;  3BRK X;  2P6W A;  2P72 A;  2WVK A;  4KC4 A;  2QH5 A;  3TWD A;  4EAA A;  5CQO A;  5FTV A;  5D91 A;  1G95 A;  3N9W A;  2AE7 A;  2BO7 A;  2YES A;  1LXA A;  3VBL A;  2QIA A;  1R81 A;  4R36 A;  2CU2 A;  2MZB A;  1HM8 A;  4ASY A;  2RJ8 A;  5C4B A;  1ZHJ A;  1GX0 A;  3HL3 A;  4ZDQ A;  3V91 A;  3VBN A;  3TV0 A;  1HJL A;  3PNN A;  5L6S A;  2ZU9 A;  2JF3 A;  3PMO A;  5FTS A;  3Q7U A;  1VZT A;  1TVY A;  5C48 A;  3F1X A;  1ZJ1 A;  3DK5 A;  3VBP A;  1TW1 A;  1VGW A;  4HO8 A;  2JCJ A;  5E3Q A;  1ZI3 A;  4MIX A;  1KGQ A;  2D7R A;  3CU0 A;  3DUV A;  2AH9 A;  4YS8 A;  1VIC A;  3SX3 A;  5C8R A;  5CQN X;  1VZX A;  3V8Z A;  1QQ0 A;  4HZC A;  2AEC A;  4HO4 A;  1XZ6 A;  4M2B A;  3D98 A;  3GOS A;  3ECT A;  1SS9 A;  4E75 A;  5AJP A;  1FR8 A;  4LW6 A;  4IHF A;  3JQY A;  3CKJ A;  2BO8 A;  2QGI A;  1FGX A;  2Y7A A;  2AGD A;  2OEF A;  2JCL A;  1G9R A;  3ZLK A;  3MQH A;  3OH2 A;  3ZF8 A;  5DEP A;  3ST8 A;  1OCX A;  1WT2 A;  4B5B A;  1QWJ A;  2PGY A;  5C3D A;  2PA4 A;  4B2W A;  1INI A;  3BFP A;  1E5K A;  1G2V A;  4BMA A;  2QIV X;  1ON8 A;  3SXD A;  3SX8 A;  5FU8 A;  1GX4 A;  3R1W A;  2Q4J A;  3R2W A;  1IIM A;  3FS8 A;  4KC2 A;  4DE7 A;  1KWS A;  3OH4 A;  2XMH A;  5AFU V;  2GGO A;  2Y4K A;  4ISX A;  3IOI A;  2J0B A;  3OH0 A;  2GGQ A;  4G87 A;  3U0Y A;  2IU9 A;  2WVL A;  3EH0 A;  2A8W A;  3I0D A;  1H7E A;  5AJO A;  3FTT A;  3RMV A;  2WLC A;  2XAT A;  4ECM A;  2YQH A;  1KHR A;  4B3U A;  3SX7 A;  4E79 A;  4XWI A;  1V82 A;  4O6M A;  5DDV A;  1QRG A;  1KGT A;  4JIS A;  4MND A;  4EEM A;  5F42 A;  4NAL A;  5CMJ A;  2ICY A;  4AAW A;  3V8Y A;  1FXJ A;  5AFU U;  2V0J A;  4FRE A;  1H7F A;  2YCM A;  4LW3 A;  2PX7 A;  2OI7 A;  3Q1X A;  3GUE A;  2V0H A;  2RIT A;  4KXO A;  2VS5 A;  2X5Z A;  1W55 A;  1H7G A;  2YQC A;  5IDS A;  2AQ9 A;  4AC3 A;  1THJ A;  2FFV A;  4EE5 A;  4G3Q A;  4HG6 A;  1XAT A;  3R3I A;  2V0L A;  1R7Y A;  3Q4S A;  5D92 A;  3OGZ A;  4D0Z A;  1OQM B;  4HO3 A;  3E26 A;  5AJN A;  1YRO B;  1QRE A;  3F1C A;  1H7L A;  4DCL A;  1QG8 A;  2A8U A;  4EEA A;  3OH1 A;  1GWW A;  3HJJ A;  1FWY A;  3TQD A;  2ICX A;  1KK5 A;  1MR9 A;  1T3D A;  4H7O A;  3KWD A;  3SXC A;  2BO6 A;  1EZI A;  2XWM A;  3I0K A;  1S80 A;  3T57 A;  1VZU A;  1NMM B;  1SSQ A;  1HV9 A;  1ZJ2 A;  2JCO A;  2I7B A;  4N69 A;  1QRL A;  2FYD B;  3OU9 A;  5ADX U;  4M98 A;  3FSC A;  2WE9 A;  1LL0 A;  1ZDG A;  4IRP A;  3I0F A;  3DHO A;  3P1B A;  5CMG X;  1WVC A;  5E3R A;  4MYO A;  1EYR A;  4Y64 A;  4KQL A;  1JV3 A;  3ZLL A;  2XME A;  2FYA A;  5CMH A;  4FIX A;  3IOJ A;  3V4E A;  3R5D A;  2FY7 A;  4KT7 A;  2I5E A;  1Z90 A;  1JV1 A;  1FXO A;  1ZCU A;  3D8V A;  4FRD A;  1O0R A;  1S4O A;  4B42 A;  2RJ5 A;  4N6B A;  1I52 A;  4M4K A;  5EJ1 A;  3I0E A;  1KK6 A;  2ZU7 A;  4IRQ A;  3BXY A;  4Y7V A;  1QGQ A;  4HO2 A;  2TDT A;  1JYL A;  2WAW A;  4Y7F A;  4CJC A;  1HM0 A;  4B4B A;  4M2A A;  3SPT A;  2IUA A;  3O3P A;  4N6A A;  3OTZ A;  3SRT A;  3SXB A;  2VS3 A;  4EE4 A;  1OMX A;  2P2O A;  4HUS A;  2O1H A;  4E1K A;  1G8O A;  1LZI A;  5C4F A;  1MP5 A;  4FCU A;  2OEG A;  4NAK A;  2V0I A;  3I0C A;  1J2Z A;  1ZCT A;  3SX5 A;  1NHE B;  5FU0 A;  2X65 A;  3BSS A;  2BO4 A;  5JQQ A;  3NZ2 A;  1ZJP A;  4HO6 A;  4MFG A;  5L6V A;  3MQG A;  1ZI5 A;  1SST A;  4FRA A;  1H5S C;  1O7O A;  3VBK A;  1INJ A;  3FOQ A;  3EEV A;  2ZU8 A;  4O6N A;  3U2X A;  4UEG A;  2C0N A;  1KK4 A;  5C38 A;  2E3D A;  4G3S A;  3FSB A;  3V0P A;  2XWN A;  4Y6U A;  3V0Q A;  5C47 A;  1KRR A;  3KWE A;  2WEE A;  5IDT A;  1HM9 A;  4HCQ A;  1VM8 A;  3OAM A;  1G23 A;  4NAN A;  3TK8 A;  3FSX A;  1K4V A;  2D0J A;  5C3B A;  4E6U A;  3I0I X;  1WSZ A;  1WT1 A;  3RMW A;  3VBM A;  5DG3 A;  2WLF A;  1H3M A;  4EQY A;  2VHE A;  3R0S A;  3PKQ A;  5IFY A;  3I3X A;  1LZ7 A;  4JD0 A;  5CQL X;  1TW5 A;  4AYL A;  3V0M A;  1H5S D;  5DEM A;  3OC9 A;  1ZJ0 A;  4HZD A;  4FCE A;  4G3P A;  3R8Y A;  2WGZ A;  1XHB A;  1ZI1 A;  3OKR A;  2FFU A;  1S4N A;  1R7U A;  2WVM A;  2VXL A;  4D11 C;  4IHH A;  5CMF X;  2JCK A;  1O23 B;  3LW6 A;  5HS2 A;  4KPZ A;  1FG5 N;  1KQA A;  2WLD A;  2VSI A;  4FQW A;  3V0N A;  4B4M A;  1H5S A;  1ZIZ A;  1R7X A;  5DDT A;  4B4G A;  2VSH A;  3VBI A;  3USQ A;  5E3P A;  4M9C A;  1NQI B;  3IXC A;  4Y7U A;  2RJ0 A;  4NAI A;  5C1L A;  1LVW A;  4FRB A;  1V83 A;  4HUR A;  3R5B A;  4E6T A;  4AA7 A;  1FR9 A;  4R7P A;  2RIY A;  2Z86 A;  4HO0 A;  5C4D A;  2QKX A;  2E8B A;  2YC3 A;  3R5A A;  4AYJ A;  4IHG A;  2RIZ A;  1VH3 A;  1HJJ A;  3KIA A;  5C4C A;  5C4E A;  5ADX V;  4KC1 A;  1W57 A;  1VGT A;  1G3L A;  4FIY A;  2RJ4 A;  4M28 A;  5EIY A;  4CVH A;  2X5S A;  4MYB A;  4EGG A;  5C3A A;  2FYB A;  2AM3 A;  3VNP A;  4FRQ A;  5J49 A;  3TZT A;  5C1G A;  3I0L A;  4MZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...