5U2KA

Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactoside O-acetyltransferase
publication title Crystal structure of Galactoside O-acetyltransferase complex with CoA (H3 space group)
rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Transferase
total genus 72
structure length 190
sequence length 190
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5u2kA00
2GGQA 3IGJA 3EH0A 4K6RA 4M9CA 4EQYA 4M99A 4KQLA 1V3WA 4E79A 3CJ8A 1QRGA 2IUAA 3P1BA 1XATA 5U2KA 4DCLA 3KWEA 1KK6A 1G97A 2VD4A 5E3PA 3DJ4A 3KWDA 4R36A 3EG4A 2V0LA 1YP4A 4EA8A 2JF2A 3DHOA 1FWYA 1QQ0A 3VBJA 3OW5A 2V0JA 3DK5A 3HJJA 1KGTA 2JF3A 2NPOA 3FSBA 3HSQA 4KNXA 2VHEA 2OEFA 4R37A 3FSCA 3TIOA 2Q4JA 5AFUV 4KNRA 3FSXA 2IC7A 1THJA 2V0HA 5DG3A 3MC4A 2IU9A 1KRRA 1J2ZA 1HM9A 3SRTA 2V0KA 3VBIA 2OI5A 1SSMA 1KHRA 1G95A 1MR9A 2GGOA 3R0SA 2ICYA 2WLCA 5L6SA 1KK4A 5E3QA 1KGQA 1MR7A 2OI7A 2AQ9A 3FTTA 4IHFA 5L6VA 4J09A 2RIJA 4KPXA 3ST8A 4G87A 2WLGA 4EAAA 4G3QA 4J18A 3I3XA 3VNPA 4HURA 4MZUA 3D8VA 1QRMA 2I5KA 3TK8A 3ECTA 3I3AA 4IHGA 3VBMA 5ADXV 2WLDA 1TDTA 1KRUA 1HV9A 3R5AA 1YP2A 3V4EA 5ADXU 3KWCA 1YP3A 3GOSA 5AFUU 3C8VA 3MQHA 4AAWA 1KQAA 3OU9A 2P2OA 3PMOA 4MYOA 3F1XA 1QREA 2QKXA 3FWWA 4N6AA 2W0WA 3OTMA 5F42A 1MRLA 3R2WA 4H7OA 1KRVA 5DEMA 3T57A 4MFGA 5E3RA 3R5BA 3R8YA 3SPTA 3TISA 4EABA 3NZ2A 1SSQA 1KK5A 4HZDA 3TWDA 4HUSA 4EGGA 3D98A 4KPZA 4M2BA 2XATA 3FOQA 2W0VA 3TDTA 3VBKA 1S80A 3TV0A 4E6TA 4R7PA 3R3IA 2WLEA 3VBPA 3P47A 1OCXA 4N6BA 4EA9A 3JQYA 4HZCA 4G3SA 4E1KA 2IU8A 1HM0A 4AC3A 4EA7A 3BXYA 4M2AA 1QRLA 1LXAA 3VBNA 3IXCA 4FCEA 3R5DA 4M28A 3BFPA 3BSWA 1FXJA 3MQGA 2QIVX 1XHDA 1HM8A 1SSTA 3R1WA 1T3DA 4N69A 3FSYA 2FKOA 3BRKX 4M98A 3OTZA 1QRFA 1Z90A 4N27A 3R3RA 2WLFA 2V0IA 5DEPA 3GVDA 2ICXA 1V67A 3R5CA 4G3PA 3OUPA 4ISXA 4HCQA 3BSSA 3FS8A 2OI6A 2QIAA 4IHHA 4E6UA 3EEVA 4E75A 3GUEA 3VBLA 2OEGA 2TDTA 3BSYA 4AA7A 3Q1XA
chains in the Genus database with same CATH superfamily
3OH3A 2GGQA 3IGJA 3EH0A 4K6RA 4M9CA 4EQYA 4M99A 4KQLA 1V3WA 4E79A 3CJ8A 1QRGA 2IUAA 3P1BA 1XATA 5U2KA 4DCLA 3KWEA 1KK6A 1G97A 2VD4A 5E3PA 3DJ4A 3KWDA 4R36A 3SUCA 3EG4A 2V0LA 1YP4A 4EA8A 2JF2A 1M8NA 1FWYA 3DHOA 1QQ0A 3VBJA 3OW5A 2V0JA 3DK5A 3HJJA 1KGTA 2JF3A 2NPOA 3FSBA 3HSQA 4KNXA 2VHEA 2OEFA 4R37A 3FSCA 3TIOA 2Q4JA 5AFUV 4KNRA 3FSXA 2IC7A 1THJA 2V0HA 5DG3A 3MC4A 2IU9A 1KRRA 1J2ZA 1HM9A 3SRTA 2V0KA 3VBIA 2OI5A 1SSMA 3GQ7A 1KHRA 1G95A 1MR9A 2GGOA 3R0SA 2ICYA 2WLCA 5L6SA 1KK4A 5E3QA 1KGQA 1MR7A 2OI7A 2AQ9A 3FTTA 1L0SA 4IHFA 5L6VA 4J09A 2RIJA 4KPXA 3ST8A 4G87A 2WLGA 4EAAA 1EWWA 4G3QA 4J18A 3I3XA 3OH4A 3VNPA 4HURA 1N4IA 4MZUA 3D8VA 1QRMA 2I5KA 3OH0A 3TK8A 3ECTA 3I3AA 4IHGA 3VBMA 5ADXV 2WLDA 1TDTA 1KRUA 1HV9A 3R5AA 1YP2A 3V4EA 5ADXU 3KWCA 1YP3A 3GOSA 5AFUU 3C8VA 3MQHA 4AAWA 1KQAA 3OU9A 3GQ8A 2P2OA 3PMOA 4MYOA 3F1XA 1QREA 2QKXA 3FWWA 4N6AA 2W0WA 3OTMA 5F42A 1MRLA 3R2WA 4H7OA 1KRVA 5DEMA 3T57A 4MFGA 5E3RA 3R5BA 1Z2FA 3R8YA 3SPTA 3TISA 4EABA 3NZ2A 1SSQA 1KK5A 4HZDA 3TWDA 4HUSA 4EGGA 3D98A 4KPZA 4M2BA 2XATA 3FOQA 2W0VA 3OH2A 3TDTA 3VBKA 1S80A 3TV0A 4E6TA 4R7PA 3R3IA 2WLEA 3VBPA 3P47A 1OCXA 4N6BA 4EA9A 3JQYA 4HZCA 4G3SA 4E1KA 2IU8A 1HM0A 4AC3A 4EA7A 3BXYA 4M2AA 3OH1A 1QRLA 1LXAA 3VBNA 3IXCA 4FCEA 3R5DA 4M28A 3BFPA 3BSWA 1FXJA 3MQGA 2QIVX 1XHDA 1HM8A 1SSTA 3R1WA 1T3DA 4N69A 3FSYA 2FKOA 3BRKX 4M98A 3OTZA 1QRFA 1Z90A 4N27A 3R3RA 2WLFA 2V0IA 5DEPA 3GVDA 2ICXA 1V67A 3R5CA 3GQAA 4G3PA 3OGZA 3OUPA 4ISXA 4HCQA 3BSSA 3FS8A 2OI6A 2QIAA 4IHHA 4E6UA 3EEVA 4E75A 3GUEA 3VBLA 2OEGA 2TDTA 3BSYA 3GQ9A 4AA7A 3Q1XA
chains in the Genus database with same CATH topology
2GGQA 3IGJA 3EH0A 4K6RA 4M9CA 4EQYA 4M99A 4KQLA 1V3WA 4E79A 3CJ8A 1QRGA 2IUAA 3P1BA 1XATA 5U2KA 4DCLA 3KWEA 1KK6A 1G97A 2VD4A 5E3PA 3DJ4A 3KWDA 4R36A 3EG4A 2V0LA 1YP4A 4EA8A 2JF2A 3DHOA 1FWYA 1QQ0A 3VBJA 3OW5A 2V0JA 3DK5A 3HJJA 1KGTA 2JF3A 2NPOA 3FSBA 3HSQA 4KNXA 2VHEA 2OEFA 4R37A 3FSCA 3TIOA 2Q4JA 5AFUV 4KNRA 3FSXA 2IC7A 1THJA 2V0HA 5DG3A 3MC4A 2IU9A 1KRRA 1J2ZA 1HM9A 3SRTA 2V0KA 3VBIA 2OI5A 1SSMA 1KHRA 1G95A 1MR9A 2GGOA 3R0SA 2ICYA 2WLCA 5L6SA 1KK4A 5E3QA 1KGQA 1MR7A 2OI7A 2AQ9A 3FTTA 4IHFA 5L6VA 4J09A 2RIJA 4KPXA 3ST8A 4G87A 2WLGA 4EAAA 4G3QA 4J18A 3I3XA 3VNPA 4HURA 4MZUA 3D8VA 1QRMA 2I5KA 3TK8A 3ECTA 3I3AA 4IHGA 3VBMA 5ADXV 2WLDA 1TDTA 1KRUA 1HV9A 3R5AA 1YP2A 3V4EA 5ADXU 3KWCA 1YP3A 3GOSA 5AFUU 3C8VA 3MQHA 4AAWA 1KQAA 3OU9A 2P2OA 3PMOA 4MYOA 3F1XA 1QREA 2QKXA 3FWWA 4N6AA 2W0WA 3OTMA 5F42A 1MRLA 3R2WA 4H7OA 1KRVA 5DEMA 3T57A 4MFGA 5E3RA 3R5BA 3R8YA 3SPTA 3TISA 4EABA 3NZ2A 1SSQA 1KK5A 4HZDA 3TWDA 4HUSA 4EGGA 3D98A 4KPZA 4M2BA 2XATA 3FOQA 2W0VA 3TDTA 3VBKA 1S80A 3TV0A 4E6TA 4R7PA 3R3IA 2WLEA 3VBPA 3P47A 1OCXA 4N6BA 4EA9A 3JQYA 4HZCA 4G3SA 4E1KA 2IU8A 1HM0A 4AC3A 4EA7A 3BXYA 4M2AA 1QRLA 1LXAA 3VBNA 3IXCA 4FCEA 3R5DA 4M28A 3BFPA 3BSWA 1FXJA 3MQGA 2QIVX 1XHDA 1HM8A 1SSTA 3R1WA 1T3DA 4N69A 3FSYA 2FKOA 3BRKX 4M98A 3OTZA 1QRFA 1Z90A 4N27A 3R3RA 2WLFA 2V0IA 5DEPA 3GVDA 2ICXA 1V67A 3R5CA 4G3PA 3OUPA 4ISXA 4HCQA 3BSSA 3FS8A 2OI6A 2QIAA 4IHHA 4E6UA 3EEVA 4E75A 3GUEA 3VBLA 2OEGA 2TDTA 3BSYA 4AA7A 3Q1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGQ A;  3IGJ A;  3EH0 A;  4K6R A;  4M9C A;  4EQY A;  4M99 A;  4KQL A;  1V3W A;  4E79 A;  3CJ8 A;  1QRG A;  2IUA A;  3P1B A;  1XAT A;  5U2K A;  4DCL A;  3KWE A;  1KK6 A;  1G97 A;  2VD4 A;  5E3P A;  3DJ4 A;  3KWD A;  4R36 A;  3EG4 A;  2V0L A;  1YP4 A;  4EA8 A;  2JF2 A;  3DHO A;  1FWY A;  1QQ0 A;  3VBJ A;  3OW5 A;  2V0J A;  3DK5 A;  3HJJ A;  1KGT A;  2JF3 A;  2NPO A;  3FSB A;  3HSQ A;  4KNX A;  2VHE A;  2OEF A;  4R37 A;  3FSC A;  3TIO A;  2Q4J A;  5AFU V;  4KNR A;  3FSX A;  2IC7 A;  1THJ A;  2V0H A;  5DG3 A;  3MC4 A;  2IU9 A;  1KRR A;  1J2Z A;  1HM9 A;  3SRT A;  2V0K A;  3VBI A;  2OI5 A;  1SSM A;  1KHR A;  1G95 A;  1MR9 A;  2GGO A;  3R0S A;  2ICY A;  2WLC A;  5L6S A;  1KK4 A;  5E3Q A;  1KGQ A;  1MR7 A;  2OI7 A;  2AQ9 A;  3FTT A;  4IHF A;  5L6V A;  4J09 A;  2RIJ A;  4KPX A;  3ST8 A;  4G87 A;  2WLG A;  4EAA A;  4G3Q A;  4J18 A;  3I3X A;  3VNP A;  4HUR A;  4MZU A;  3D8V A;  1QRM A;  2I5K A;  3TK8 A;  3ECT A;  3I3A A;  4IHG A;  3VBM A;  5ADX V;  2WLD A;  1TDT A;  1KRU A;  1HV9 A;  3R5A A;  1YP2 A;  3V4E A;  5ADX U;  3KWC A;  1YP3 A;  3GOS A;  5AFU U;  3C8V A;  3MQH A;  4AAW A;  1KQA A;  3OU9 A;  2P2O A;  3PMO A;  4MYO A;  3F1X A;  1QRE A;  2QKX A;  3FWW A;  4N6A A;  2W0W A;  3OTM A;  5F42 A;  1MRL A;  3R2W A;  4H7O A;  1KRV A;  5DEM A;  3T57 A;  4MFG A;  5E3R A;  3R5B A;  3R8Y A;  3SPT A;  3TIS A;  4EAB A;  3NZ2 A;  1SSQ A;  1KK5 A;  4HZD A;  3TWD A;  4HUS A;  4EGG A;  3D98 A;  4KPZ A;  4M2B A;  2XAT A;  3FOQ A;  2W0V A;  3TDT A;  3VBK A;  1S80 A;  3TV0 A;  4E6T A;  4R7P A;  3R3I A;  2WLE A;  3VBP A;  3P47 A;  1OCX A;  4N6B A;  4EA9 A;  3JQY A;  4HZC A;  4G3S A;  4E1K A;  2IU8 A;  1HM0 A;  4AC3 A;  4EA7 A;  3BXY A;  4M2A A;  1QRL A;  1LXA A;  3VBN A;  3IXC A;  4FCE A;  3R5D A;  4M28 A;  3BFP A;  3BSW A;  1FXJ A;  3MQG A;  2QIV X;  1XHD A;  1HM8 A;  1SST A;  3R1W A;  1T3D A;  4N69 A;  3FSY A;  2FKO A;  3BRK X;  4M98 A;  3OTZ A;  1QRF A;  1Z90 A;  4N27 A;  3R3R A;  2WLF A;  2V0I A;  5DEP A;  3GVD A;  2ICX A;  1V67 A;  3R5C A;  4G3P A;  3OUP A;  4ISX A;  4HCQ A;  3BSS A;  3FS8 A;  2OI6 A;  2QIA A;  4IHH A;  4E6U A;  3EEV A;  4E75 A;  3GUE A;  3VBL A;  2OEG A;  2TDT A;  3BSY A;  4AA7 A;  3Q1X A; 
#chains in the Genus database with same CATH topology
 3OH3 A;  2GGQ A;  3IGJ A;  3EH0 A;  4K6R A;  4M9C A;  4EQY A;  4M99 A;  4KQL A;  1V3W A;  4E79 A;  3CJ8 A;  1QRG A;  2IUA A;  3P1B A;  1XAT A;  5U2K A;  4DCL A;  3KWE A;  1KK6 A;  1G97 A;  2VD4 A;  5E3P A;  3DJ4 A;  3KWD A;  4R36 A;  3SUC A;  3EG4 A;  2V0L A;  1YP4 A;  4EA8 A;  2JF2 A;  1M8N A;  1FWY A;  3DHO A;  1QQ0 A;  3VBJ A;  3OW5 A;  2V0J A;  3DK5 A;  3HJJ A;  1KGT A;  2JF3 A;  2NPO A;  3FSB A;  3HSQ A;  4KNX A;  2VHE A;  2OEF A;  4R37 A;  3FSC A;  3TIO A;  2Q4J A;  5AFU V;  4KNR A;  3FSX A;  2IC7 A;  1THJ A;  2V0H A;  5DG3 A;  3MC4 A;  2IU9 A;  1KRR A;  1J2Z A;  1HM9 A;  3SRT A;  2V0K A;  3VBI A;  2OI5 A;  1SSM A;  3GQ7 A;  1KHR A;  1G95 A;  1MR9 A;  2GGO A;  3R0S A;  2ICY A;  2WLC A;  5L6S A;  1KK4 A;  5E3Q A;  1KGQ A;  1MR7 A;  2OI7 A;  2AQ9 A;  3FTT A;  1L0S A;  4IHF A;  5L6V A;  4J09 A;  2RIJ A;  4KPX A;  3ST8 A;  4G87 A;  2WLG A;  4EAA A;  1EWW A;  4G3Q A;  4J18 A;  3I3X A;  3OH4 A;  3VNP A;  4HUR A;  1N4I A;  4MZU A;  3D8V A;  1QRM A;  2I5K A;  3OH0 A;  3TK8 A;  3ECT A;  3I3A A;  4IHG A;  3VBM A;  5ADX V;  2WLD A;  1TDT A;  1KRU A;  1HV9 A;  3R5A A;  1YP2 A;  3V4E A;  5ADX U;  3KWC A;  1YP3 A;  3GOS A;  5AFU U;  3C8V A;  3MQH A;  4AAW A;  1KQA A;  3OU9 A;  3GQ8 A;  2P2O A;  3PMO A;  4MYO A;  3F1X A;  1QRE A;  2QKX A;  3FWW A;  4N6A A;  2W0W A;  3OTM A;  5F42 A;  1MRL A;  3R2W A;  4H7O A;  1KRV A;  5DEM A;  3T57 A;  4MFG A;  5E3R A;  3R5B A;  1Z2F A;  3R8Y A;  3SPT A;  3TIS A;  4EAB A;  3NZ2 A;  1SSQ A;  1KK5 A;  4HZD A;  3TWD A;  4HUS A;  4EGG A;  3D98 A;  4KPZ A;  4M2B A;  2XAT A;  3FOQ A;  2W0V A;  3OH2 A;  3TDT A;  3VBK A;  1S80 A;  3TV0 A;  4E6T A;  4R7P A;  3R3I A;  2WLE A;  3VBP A;  3P47 A;  1OCX A;  4N6B A;  4EA9 A;  3JQY A;  4HZC A;  4G3S A;  4E1K A;  2IU8 A;  1HM0 A;  4AC3 A;  4EA7 A;  3BXY A;  4M2A A;  3OH1 A;  1QRL A;  1LXA A;  3VBN A;  3IXC A;  4FCE A;  3R5D A;  4M28 A;  3BFP A;  3BSW A;  1FXJ A;  3MQG A;  2QIV X;  1XHD A;  1HM8 A;  1SST A;  3R1W A;  1T3D A;  4N69 A;  3FSY A;  2FKO A;  3BRK X;  4M98 A;  3OTZ A;  1QRF A;  1Z90 A;  4N27 A;  3R3R A;  2WLF A;  2V0I A;  5DEP A;  3GVD A;  2ICX A;  1V67 A;  3R5C A;  3GQA A;  4G3P A;  3OGZ A;  3OUP A;  4ISX A;  4HCQ A;  3BSS A;  3FS8 A;  2OI6 A;  2QIA A;  4IHH A;  4E6U A;  3EEV A;  4E75 A;  3GUE A;  3VBL A;  2OEG A;  2TDT A;  3BSY A;  3GQ9 A;  4AA7 A;  3Q1X A; 
#chains in the Genus database with same CATH homology
 2GGQ A;  3IGJ A;  3EH0 A;  4K6R A;  4M9C A;  4EQY A;  4M99 A;  4KQL A;  1V3W A;  4E79 A;  3CJ8 A;  1QRG A;  2IUA A;  3P1B A;  1XAT A;  5U2K A;  4DCL A;  3KWE A;  1KK6 A;  1G97 A;  2VD4 A;  5E3P A;  3DJ4 A;  3KWD A;  4R36 A;  3EG4 A;  2V0L A;  1YP4 A;  4EA8 A;  2JF2 A;  3DHO A;  1FWY A;  1QQ0 A;  3VBJ A;  3OW5 A;  2V0J A;  3DK5 A;  3HJJ A;  1KGT A;  2JF3 A;  2NPO A;  3FSB A;  3HSQ A;  4KNX A;  2VHE A;  2OEF A;  4R37 A;  3FSC A;  3TIO A;  2Q4J A;  5AFU V;  4KNR A;  3FSX A;  2IC7 A;  1THJ A;  2V0H A;  5DG3 A;  3MC4 A;  2IU9 A;  1KRR A;  1J2Z A;  1HM9 A;  3SRT A;  2V0K A;  3VBI A;  2OI5 A;  1SSM A;  1KHR A;  1G95 A;  1MR9 A;  2GGO A;  3R0S A;  2ICY A;  2WLC A;  5L6S A;  1KK4 A;  5E3Q A;  1KGQ A;  1MR7 A;  2OI7 A;  2AQ9 A;  3FTT A;  4IHF A;  5L6V A;  4J09 A;  2RIJ A;  4KPX A;  3ST8 A;  4G87 A;  2WLG A;  4EAA A;  4G3Q A;  4J18 A;  3I3X A;  3VNP A;  4HUR A;  4MZU A;  3D8V A;  1QRM A;  2I5K A;  3TK8 A;  3ECT A;  3I3A A;  4IHG A;  3VBM A;  5ADX V;  2WLD A;  1TDT A;  1KRU A;  1HV9 A;  3R5A A;  1YP2 A;  3V4E A;  5ADX U;  3KWC A;  1YP3 A;  3GOS A;  5AFU U;  3C8V A;  3MQH A;  4AAW A;  1KQA A;  3OU9 A;  2P2O A;  3PMO A;  4MYO A;  3F1X A;  1QRE A;  2QKX A;  3FWW A;  4N6A A;  2W0W A;  3OTM A;  5F42 A;  1MRL A;  3R2W A;  4H7O A;  1KRV A;  5DEM A;  3T57 A;  4MFG A;  5E3R A;  3R5B A;  3R8Y A;  3SPT A;  3TIS A;  4EAB A;  3NZ2 A;  1SSQ A;  1KK5 A;  4HZD A;  3TWD A;  4HUS A;  4EGG A;  3D98 A;  4KPZ A;  4M2B A;  2XAT A;  3FOQ A;  2W0V A;  3TDT A;  3VBK A;  1S80 A;  3TV0 A;  4E6T A;  4R7P A;  3R3I A;  2WLE A;  3VBP A;  3P47 A;  1OCX A;  4N6B A;  4EA9 A;  3JQY A;  4HZC A;  4G3S A;  4E1K A;  2IU8 A;  1HM0 A;  4AC3 A;  4EA7 A;  3BXY A;  4M2A A;  1QRL A;  1LXA A;  3VBN A;  3IXC A;  4FCE A;  3R5D A;  4M28 A;  3BFP A;  3BSW A;  1FXJ A;  3MQG A;  2QIV X;  1XHD A;  1HM8 A;  1SST A;  3R1W A;  1T3D A;  4N69 A;  3FSY A;  2FKO A;  3BRK X;  4M98 A;  3OTZ A;  1QRF A;  1Z90 A;  4N27 A;  3R3R A;  2WLF A;  2V0I A;  5DEP A;  3GVD A;  2ICX A;  1V67 A;  3R5C A;  4G3P A;  3OUP A;  4ISX A;  4HCQ A;  3BSS A;  3FS8 A;  2OI6 A;  2QIA A;  4IHH A;  4E6U A;  3EEV A;  4E75 A;  3GUE A;  3VBL A;  2OEG A;  2TDT A;  3BSY A;  4AA7 A;  3Q1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...