5U2KA

Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Galactoside O-acetyltransferase
publication title Crystal structure of Galactoside O-acetyltransferase complex with CoA (H3 space group)
rcsb
source organism Staphylococcus aureus (strain col)
total genus 72
structure length 190
sequence length 190
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5u2kA00
3D8VA 3OU9A 3IXCA 4EA7A 3BRKX 2ICYA 4KPXA 4EA9A 2WLDA 4ISXA 3EH0A 1MR9A 4M99A 3VBPA 1OCXA 3R1WA 2QKXA 4G87A 4IHFA 2IC7A 1XATA 3TK8A 3FS8A 1QRFA 3R5BA 4AC3A 4MFGA 1HV9A 4E79A 3V4EA 2QIAA 5AFUV 3PMOA 2JF2A 3MC4A 4J18A 1V67A 3VBLA 1KK6A 2NPOA 1HM8A 3FSCA 5E3RA 1KRRA 4AAWA 2V0JA 2VHEA 2W0WA 3VBKA 1V3WA 1SSQA 3R2WA 2XATA 1G95A 2AQ9A 2IU8A 1KRVA 3VBMA 1SSTA 4KNRA 2OI5A 5ADXU 3FSXA 1S80A 1KK5A 2FKOA 4M2BA 4N6AA 1KRUA 4EGGA 1HM0A 3DHOA 2JF3A 4M98A 4N6BA 3GOSA 3FSYA 5E3PA 5E3QA 4E1KA 1KQAA 3OUPA 4IHGA 2V0HA 1YP2A 4E6TA 5U2KA 3TV0A 4EABA 3FOQA 4IHHA 2ICXA 1T3DA 4N27A 3BSYA 3TWDA 1LXAA 3SPTA 4HUSA 4J09A 5DEMA 3T57A 3TDTA 1KGTA 5AFUU 4HZDA 1HM9A 4M2AA 3ST8A 4G3SA 3MQGA 3BFPA 3F1XA 4R36A 3VBNA 3R0SA 3R5CA 1FWYA 4AA7A 3OTZA 4KPZA 2OEFA 5L6SA 2V0IA 1G97A 2WLCA 2GGQA 3P1BA 3VBIA 3TIOA 3R3RA 2OI6A 4M9CA 2GGOA 1YP3A 3HSQA 1KHRA 4N69A 2VD4A 3JQYA 1XHDA 2Q4JA 1TDTA 3SRTA 4MYOA 3KWDA 1FXJA 4G3QA 3C8VA 3GVDA 4G3PA 3BSWA 4HCQA 3MQHA 2IUAA 4KQLA 3R5DA 2OI7A 1MR7A 4EQYA 2V0LA 4KNXA 3IGJA 3NZ2A 4E6UA 2QIVX 3FTTA 2OEGA 4HURA 3R5AA 3OTMA 1QRMA 4M28A 1J2ZA 3BSSA 2WLFA 1SSMA 1Z90A 2W0VA 5DEPA 5ADXV 3GUEA 1THJA 2TDTA 1KK4A 1MRLA 5F42A 3I3XA 3VBJA 3ECTA 2RIJA 3DJ4A 4FCEA 1QRLA 3VNPA 4HZCA 2WLEA 4MZUA 4EA8A 1QQ0A 2WLGA 3TISA 4DCLA 4E75A 1QREA 3I3AA 3P47A 3Q1XA 5DG3A 3CJ8A 4R37A 2P2OA 3OW5A 2IU9A 3FSBA 3BXYA 2I5KA 3EG4A 2V0KA 4R7PA 4H7OA 4K6RA 3R8YA 3KWEA 3HJJA 1KGQA 1YP4A 3KWCA 3R3IA 4EAAA 3D98A 3EEVA 5L6VA 3DK5A 3FWWA 1QRGA
chains in the Genus database with same CATH superfamily
3D8VA 3OU9A 3IXCA 4EA7A 3BRKX 2ICYA 4KPXA 4EA9A 3OH1A 2WLDA 4ISXA 3EH0A 1MR9A 4M99A 3VBPA 1OCXA 3R1WA 2QKXA 4G87A 4IHFA 2IC7A 1XATA 3TK8A 3FS8A 1QRFA 3R5BA 4AC3A 4MFGA 1HV9A 4E79A 3V4EA 2QIAA 5AFUV 1EWWA 3PMOA 2JF2A 3MC4A 4J18A 1V67A 3OH2A 1KK6A 3GQ9A 3VBLA 2NPOA 3GQ8A 1HM8A 3FSCA 5E3RA 1KRRA 4AAWA 2V0JA 2VHEA 2W0WA 3VBKA 1V3WA 1SSQA 3R2WA 2XATA 1G95A 2AQ9A 2IU8A 1KRVA 3VBMA 1SSTA 4KNRA 2OI5A 5ADXU 3FSXA 1S80A 1KK5A 2FKOA 4M2BA 4N6AA 1KRUA 4EGGA 1HM0A 3DHOA 2JF3A 4M98A 4N6BA 3GOSA 3FSYA 5E3PA 5E3QA 4E1KA 1KQAA 3OUPA 4IHGA 2V0HA 1YP2A 4E6TA 5U2KA 3TV0A 4EABA 3FOQA 1N4IA 4IHHA 2ICXA 1T3DA 4N27A 3BSYA 3TWDA 1LXAA 3SPTA 4HUSA 4J09A 5DEMA 3T57A 3TDTA 1KGTA 5AFUU 4HZDA 1HM9A 1L0SA 4M2AA 4G3SA 3GQAA 3MQGA 3BFPA 3F1XA 4R36A 3ST8A 3OGZA 3R0SA 3R5CA 1FWYA 3VBNA 3OTZA 4AA7A 4KPZA 2OEFA 5L6SA 2V0IA 1G97A 2WLCA 2GGQA 3P1BA 3VBIA 3TIOA 3R3RA 2OI6A 4M9CA 2GGOA 1YP3A 3HSQA 1KHRA 4N69A 2VD4A 3JQYA 1XHDA 2Q4JA 1TDTA 3SRTA 4MYOA 3KWDA 1FXJA 4G3QA 3C8VA 3GVDA 4G3PA 3BSWA 4HCQA 3MQHA 2IUAA 4KQLA 3R5DA 2OI7A 1MR7A 4EQYA 2V0LA 4KNXA 3IGJA 3NZ2A 4E6UA 2QIVX 3OH0A 3FTTA 2OEGA 4HURA 3R5AA 3OTMA 1QRMA 3OH3A 4M28A 1J2ZA 3BSSA 2WLFA 1SSMA 1Z90A 2W0VA 5DEPA 5ADXV 3GUEA 1M8NA 1THJA 2TDTA 1KK4A 1MRLA 5F42A 3I3XA 3VBJA 3ECTA 2RIJA 3DJ4A 4FCEA 1Z2FA 1QRLA 3SUCA 3VNPA 4HZCA 2WLEA 4MZUA 4EA8A 1QQ0A 2WLGA 3TISA 4DCLA 4E75A 1QREA 3I3AA 3OH4A 3P47A 3Q1XA 5DG3A 3GQ7A 3CJ8A 4R37A 2P2OA 3OW5A 2IU9A 3FSBA 3BXYA 2I5KA 3EG4A 2V0KA 4R7PA 4H7OA 4K6RA 3R8YA 3KWEA 3HJJA 1KGQA 1YP4A 3KWCA 3R3IA 4EAAA 3D98A 3EEVA 5L6VA 3DK5A 3FWWA 1QRGA
chains in the Genus database with same CATH topology
3D8VA 3OU9A 3IXCA 4EA7A 3BRKX 2ICYA 4KPXA 4EA9A 2WLDA 4ISXA 3EH0A 1MR9A 4M99A 3VBPA 1OCXA 3R1WA 2QKXA 4G87A 4IHFA 2IC7A 1XATA 3TK8A 3FS8A 1QRFA 3R5BA 4AC3A 4MFGA 1HV9A 4E79A 3V4EA 2QIAA 5AFUV 3PMOA 2JF2A 3MC4A 4J18A 1V67A 3VBLA 1KK6A 2NPOA 1HM8A 3FSCA 5E3RA 1KRRA 4AAWA 2V0JA 2VHEA 2W0WA 3VBKA 1V3WA 1SSQA 3R2WA 2XATA 1G95A 2AQ9A 2IU8A 1KRVA 3VBMA 1SSTA 4KNRA 2OI5A 5ADXU 3FSXA 1S80A 1KK5A 2FKOA 4M2BA 4N6AA 1KRUA 4EGGA 1HM0A 3DHOA 2JF3A 4M98A 4N6BA 3GOSA 3FSYA 5E3PA 5E3QA 4E1KA 1KQAA 3OUPA 4IHGA 2V0HA 1YP2A 4E6TA 5U2KA 3TV0A 4EABA 3FOQA 4IHHA 2ICXA 1T3DA 4N27A 3BSYA 3TWDA 1LXAA 3SPTA 4HUSA 4J09A 5DEMA 3T57A 3TDTA 1KGTA 5AFUU 4HZDA 1HM9A 4M2AA 3ST8A 4G3SA 3MQGA 3BFPA 3F1XA 4R36A 3VBNA 3R0SA 3R5CA 1FWYA 4AA7A 3OTZA 4KPZA 2OEFA 5L6SA 2V0IA 1G97A 2WLCA 2GGQA 3P1BA 3VBIA 3TIOA 3R3RA 2OI6A 4M9CA 2GGOA 1YP3A 3HSQA 1KHRA 4N69A 2VD4A 3JQYA 1XHDA 2Q4JA 1TDTA 3SRTA 4MYOA 3KWDA 1FXJA 4G3QA 3C8VA 3GVDA 4G3PA 3BSWA 4HCQA 3MQHA 2IUAA 4KQLA 3R5DA 2OI7A 1MR7A 4EQYA 2V0LA 4KNXA 3IGJA 3NZ2A 4E6UA 2QIVX 3FTTA 2OEGA 4HURA 3R5AA 3OTMA 1QRMA 4M28A 1J2ZA 3BSSA 2WLFA 1SSMA 1Z90A 2W0VA 5DEPA 5ADXV 3GUEA 1THJA 2TDTA 1KK4A 1MRLA 5F42A 3I3XA 3VBJA 3ECTA 2RIJA 3DJ4A 4FCEA 1QRLA 3VNPA 4HZCA 2WLEA 4MZUA 4EA8A 1QQ0A 2WLGA 3TISA 4DCLA 4E75A 1QREA 3I3AA 3P47A 3Q1XA 5DG3A 3CJ8A 4R37A 2P2OA 3OW5A 2IU9A 3FSBA 3BXYA 2I5KA 3EG4A 2V0KA 4R7PA 4H7OA 4K6RA 3R8YA 3KWEA 3HJJA 1KGQA 1YP4A 3KWCA 3R3IA 4EAAA 3D98A 3EEVA 5L6VA 3DK5A 3FWWA 1QRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8V A;  3OU9 A;  3IXC A;  4EA7 A;  3BRK X;  2ICY A;  4KPX A;  4EA9 A;  2WLD A;  4ISX A;  3EH0 A;  1MR9 A;  4M99 A;  3VBP A;  1OCX A;  3R1W A;  2QKX A;  4G87 A;  4IHF A;  2IC7 A;  1XAT A;  3TK8 A;  3FS8 A;  1QRF A;  3R5B A;  4AC3 A;  4MFG A;  1HV9 A;  4E79 A;  3V4E A;  2QIA A;  5AFU V;  3PMO A;  2JF2 A;  3MC4 A;  4J18 A;  1V67 A;  3VBL A;  1KK6 A;  2NPO A;  1HM8 A;  3FSC A;  5E3R A;  1KRR A;  4AAW A;  2V0J A;  2VHE A;  2W0W A;  3VBK A;  1V3W A;  1SSQ A;  3R2W A;  2XAT A;  1G95 A;  2AQ9 A;  2IU8 A;  1KRV A;  3VBM A;  1SST A;  4KNR A;  2OI5 A;  5ADX U;  3FSX A;  1S80 A;  1KK5 A;  2FKO A;  4M2B A;  4N6A A;  1KRU A;  4EGG A;  1HM0 A;  3DHO A;  2JF3 A;  4M98 A;  4N6B A;  3GOS A;  3FSY A;  5E3P A;  5E3Q A;  4E1K A;  1KQA A;  3OUP A;  4IHG A;  2V0H A;  1YP2 A;  4E6T A;  5U2K A;  3TV0 A;  4EAB A;  3FOQ A;  4IHH A;  2ICX A;  1T3D A;  4N27 A;  3BSY A;  3TWD A;  1LXA A;  3SPT A;  4HUS A;  4J09 A;  5DEM A;  3T57 A;  3TDT A;  1KGT A;  5AFU U;  4HZD A;  1HM9 A;  4M2A A;  3ST8 A;  4G3S A;  3MQG A;  3BFP A;  3F1X A;  4R36 A;  3VBN A;  3R0S A;  3R5C A;  1FWY A;  4AA7 A;  3OTZ A;  4KPZ A;  2OEF A;  5L6S A;  2V0I A;  1G97 A;  2WLC A;  2GGQ A;  3P1B A;  3VBI A;  3TIO A;  3R3R A;  2OI6 A;  4M9C A;  2GGO A;  1YP3 A;  3HSQ A;  1KHR A;  4N69 A;  2VD4 A;  3JQY A;  1XHD A;  2Q4J A;  1TDT A;  3SRT A;  4MYO A;  3KWD A;  1FXJ A;  4G3Q A;  3C8V A;  3GVD A;  4G3P A;  3BSW A;  4HCQ A;  3MQH A;  2IUA A;  4KQL A;  3R5D A;  2OI7 A;  1MR7 A;  4EQY A;  2V0L A;  4KNX A;  3IGJ A;  3NZ2 A;  4E6U A;  2QIV X;  3FTT A;  2OEG A;  4HUR A;  3R5A A;  3OTM A;  1QRM A;  4M28 A;  1J2Z A;  3BSS A;  2WLF A;  1SSM A;  1Z90 A;  2W0V A;  5DEP A;  5ADX V;  3GUE A;  1THJ A;  2TDT A;  1KK4 A;  1MRL A;  5F42 A;  3I3X A;  3VBJ A;  3ECT A;  2RIJ A;  3DJ4 A;  4FCE A;  1QRL A;  3VNP A;  4HZC A;  2WLE A;  4MZU A;  4EA8 A;  1QQ0 A;  2WLG A;  3TIS A;  4DCL A;  4E75 A;  1QRE A;  3I3A A;  3P47 A;  3Q1X A;  5DG3 A;  3CJ8 A;  4R37 A;  2P2O A;  3OW5 A;  2IU9 A;  3FSB A;  3BXY A;  2I5K A;  3EG4 A;  2V0K A;  4R7P A;  4H7O A;  4K6R A;  3R8Y A;  3KWE A;  3HJJ A;  1KGQ A;  1YP4 A;  3KWC A;  3R3I A;  4EAA A;  3D98 A;  3EEV A;  5L6V A;  3DK5 A;  3FWW A;  1QRG A; 
#chains in the Genus database with same CATH topology
 3D8V A;  3OU9 A;  3IXC A;  4EA7 A;  3BRK X;  2ICY A;  4KPX A;  4EA9 A;  3OH1 A;  2WLD A;  4ISX A;  3EH0 A;  1MR9 A;  4M99 A;  3VBP A;  1OCX A;  3R1W A;  2QKX A;  4G87 A;  4IHF A;  2IC7 A;  1XAT A;  3TK8 A;  3FS8 A;  1QRF A;  3R5B A;  4AC3 A;  4MFG A;  1HV9 A;  4E79 A;  3V4E A;  2QIA A;  5AFU V;  1EWW A;  3PMO A;  2JF2 A;  3MC4 A;  4J18 A;  1V67 A;  3OH2 A;  1KK6 A;  3GQ9 A;  3VBL A;  2NPO A;  3GQ8 A;  1HM8 A;  3FSC A;  5E3R A;  1KRR A;  4AAW A;  2V0J A;  2VHE A;  2W0W A;  3VBK A;  1V3W A;  1SSQ A;  3R2W A;  2XAT A;  1G95 A;  2AQ9 A;  2IU8 A;  1KRV A;  3VBM A;  1SST A;  4KNR A;  2OI5 A;  5ADX U;  3FSX A;  1S80 A;  1KK5 A;  2FKO A;  4M2B A;  4N6A A;  1KRU A;  4EGG A;  1HM0 A;  3DHO A;  2JF3 A;  4M98 A;  4N6B A;  3GOS A;  3FSY A;  5E3P A;  5E3Q A;  4E1K A;  1KQA A;  3OUP A;  4IHG A;  2V0H A;  1YP2 A;  4E6T A;  5U2K A;  3TV0 A;  4EAB A;  3FOQ A;  1N4I A;  4IHH A;  2ICX A;  1T3D A;  4N27 A;  3BSY A;  3TWD A;  1LXA A;  3SPT A;  4HUS A;  4J09 A;  5DEM A;  3T57 A;  3TDT A;  1KGT A;  5AFU U;  4HZD A;  1HM9 A;  1L0S A;  4M2A A;  4G3S A;  3GQA A;  3MQG A;  3BFP A;  3F1X A;  4R36 A;  3ST8 A;  3OGZ A;  3R0S A;  3R5C A;  1FWY A;  3VBN A;  3OTZ A;  4AA7 A;  4KPZ A;  2OEF A;  5L6S A;  2V0I A;  1G97 A;  2WLC A;  2GGQ A;  3P1B A;  3VBI A;  3TIO A;  3R3R A;  2OI6 A;  4M9C A;  2GGO A;  1YP3 A;  3HSQ A;  1KHR A;  4N69 A;  2VD4 A;  3JQY A;  1XHD A;  2Q4J A;  1TDT A;  3SRT A;  4MYO A;  3KWD A;  1FXJ A;  4G3Q A;  3C8V A;  3GVD A;  4G3P A;  3BSW A;  4HCQ A;  3MQH A;  2IUA A;  4KQL A;  3R5D A;  2OI7 A;  1MR7 A;  4EQY A;  2V0L A;  4KNX A;  3IGJ A;  3NZ2 A;  4E6U A;  2QIV X;  3OH0 A;  3FTT A;  2OEG A;  4HUR A;  3R5A A;  3OTM A;  1QRM A;  3OH3 A;  4M28 A;  1J2Z A;  3BSS A;  2WLF A;  1SSM A;  1Z90 A;  2W0V A;  5DEP A;  5ADX V;  3GUE A;  1M8N A;  1THJ A;  2TDT A;  1KK4 A;  1MRL A;  5F42 A;  3I3X A;  3VBJ A;  3ECT A;  2RIJ A;  3DJ4 A;  4FCE A;  1Z2F A;  1QRL A;  3SUC A;  3VNP A;  4HZC A;  2WLE A;  4MZU A;  4EA8 A;  1QQ0 A;  2WLG A;  3TIS A;  4DCL A;  4E75 A;  1QRE A;  3I3A A;  3OH4 A;  3P47 A;  3Q1X A;  5DG3 A;  3GQ7 A;  3CJ8 A;  4R37 A;  2P2O A;  3OW5 A;  2IU9 A;  3FSB A;  3BXY A;  2I5K A;  3EG4 A;  2V0K A;  4R7P A;  4H7O A;  4K6R A;  3R8Y A;  3KWE A;  3HJJ A;  1KGQ A;  1YP4 A;  3KWC A;  3R3I A;  4EAA A;  3D98 A;  3EEV A;  5L6V A;  3DK5 A;  3FWW A;  1QRG A; 
#chains in the Genus database with same CATH homology
 3D8V A;  3OU9 A;  3IXC A;  4EA7 A;  3BRK X;  2ICY A;  4KPX A;  4EA9 A;  2WLD A;  4ISX A;  3EH0 A;  1MR9 A;  4M99 A;  3VBP A;  1OCX A;  3R1W A;  2QKX A;  4G87 A;  4IHF A;  2IC7 A;  1XAT A;  3TK8 A;  3FS8 A;  1QRF A;  3R5B A;  4AC3 A;  4MFG A;  1HV9 A;  4E79 A;  3V4E A;  2QIA A;  5AFU V;  3PMO A;  2JF2 A;  3MC4 A;  4J18 A;  1V67 A;  3VBL A;  1KK6 A;  2NPO A;  1HM8 A;  3FSC A;  5E3R A;  1KRR A;  4AAW A;  2V0J A;  2VHE A;  2W0W A;  3VBK A;  1V3W A;  1SSQ A;  3R2W A;  2XAT A;  1G95 A;  2AQ9 A;  2IU8 A;  1KRV A;  3VBM A;  1SST A;  4KNR A;  2OI5 A;  5ADX U;  3FSX A;  1S80 A;  1KK5 A;  2FKO A;  4M2B A;  4N6A A;  1KRU A;  4EGG A;  1HM0 A;  3DHO A;  2JF3 A;  4M98 A;  4N6B A;  3GOS A;  3FSY A;  5E3P A;  5E3Q A;  4E1K A;  1KQA A;  3OUP A;  4IHG A;  2V0H A;  1YP2 A;  4E6T A;  5U2K A;  3TV0 A;  4EAB A;  3FOQ A;  4IHH A;  2ICX A;  1T3D A;  4N27 A;  3BSY A;  3TWD A;  1LXA A;  3SPT A;  4HUS A;  4J09 A;  5DEM A;  3T57 A;  3TDT A;  1KGT A;  5AFU U;  4HZD A;  1HM9 A;  4M2A A;  3ST8 A;  4G3S A;  3MQG A;  3BFP A;  3F1X A;  4R36 A;  3VBN A;  3R0S A;  3R5C A;  1FWY A;  4AA7 A;  3OTZ A;  4KPZ A;  2OEF A;  5L6S A;  2V0I A;  1G97 A;  2WLC A;  2GGQ A;  3P1B A;  3VBI A;  3TIO A;  3R3R A;  2OI6 A;  4M9C A;  2GGO A;  1YP3 A;  3HSQ A;  1KHR A;  4N69 A;  2VD4 A;  3JQY A;  1XHD A;  2Q4J A;  1TDT A;  3SRT A;  4MYO A;  3KWD A;  1FXJ A;  4G3Q A;  3C8V A;  3GVD A;  4G3P A;  3BSW A;  4HCQ A;  3MQH A;  2IUA A;  4KQL A;  3R5D A;  2OI7 A;  1MR7 A;  4EQY A;  2V0L A;  4KNX A;  3IGJ A;  3NZ2 A;  4E6U A;  2QIV X;  3FTT A;  2OEG A;  4HUR A;  3R5A A;  3OTM A;  1QRM A;  4M28 A;  1J2Z A;  3BSS A;  2WLF A;  1SSM A;  1Z90 A;  2W0V A;  5DEP A;  5ADX V;  3GUE A;  1THJ A;  2TDT A;  1KK4 A;  1MRL A;  5F42 A;  3I3X A;  3VBJ A;  3ECT A;  2RIJ A;  3DJ4 A;  4FCE A;  1QRL A;  3VNP A;  4HZC A;  2WLE A;  4MZU A;  4EA8 A;  1QQ0 A;  2WLG A;  3TIS A;  4DCL A;  4E75 A;  1QRE A;  3I3A A;  3P47 A;  3Q1X A;  5DG3 A;  3CJ8 A;  4R37 A;  2P2O A;  3OW5 A;  2IU9 A;  3FSB A;  3BXY A;  2I5K A;  3EG4 A;  2V0K A;  4R7P A;  4H7O A;  4K6R A;  3R8Y A;  3KWE A;  3HJJ A;  1KGQ A;  1YP4 A;  3KWC A;  3R3I A;  4EAA A;  3D98 A;  3EEV A;  5L6V A;  3DK5 A;  3FWW A;  1QRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...