4K6RA

Crystal structure of glmu in complex with atp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
469
structure length
469
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title GlmU (N-acetylglucosamine-1-phosphate uridyltransferase) bound to three magnesium ions and ATP at the active site
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 176
structure length 469
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4k6rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4k6rA01
1ZI3A 1I52A 4EEMA 2BO4A 3VBMA 3TQDA 2UX8A 4KT7A 3ZGGA 3O3PA 3DHOA 3I0HA 5ADXU 1WT3A 4CJBA 1R7UA 3BSSA 3OH1A 5DDTA 1W55A 3VBPA 2X5SA 3V91A 3POLA 1QQ0A 2IC7A 1VZXA 4HO9A 2Y4KA 4EEAA 3TIOA 1H4CA 4CJCA 3BFPA 5AJPA 4MZUA 1GWVA 2VS3A 1MP5A 3E25A 4JISA 1FXOA 1S80A 4J18A 1LL2A 1OQMB 4EQYA 4KC2A 1V82A 2P73A 3P1BA 4FRLA 3BSWA 4AA7A 2RJ9A 3BRKX 3HJJA 3SX7A 1QREA 4EA8A 1ZJ2A 1V83A 1H7HA 2RJ1A 3I0FA 4JD0A 4B42A 4FRDA 3I0JA 4FRAA 4HOCA 1WT1A 2Y7AA 4KPZA 1TDTA 5CQOA 4N27A 3OUPA 4HO4A 1G1LA 2FFVA 5JQQA 2O1FA 2RJ6A 2WGZA 2IU9A 1NHEB 2YQJA 3K8EA 5FV9A 1ZCUA 2QH5A 2AM3A 2WEEA 1H5TA 1G0RA 2RITA 1XZ6A 1INIA 3PKQA 5C1HA 3OKRA 1FO9A 1MC3A 2XMEA 2WE9A 3FTTA 1IINA 2RJ7A 4B4GA 1MP3A 2E8BA 3D5NA 3LW6A 3Q7UA 1HV9A 1KQAA 3I0IX 4KQLA 2YQCA 3U2TA 4IHGA 2ICXA 4ASYA 2X60A 4Y7FA 1INJA 1KK4A 4ZDQA 2YC5A 3TDTA 1H7FA 3ZF8A 1GQ9A 2JCJA 3HSQA 2BO6A 3R5BA 1ZDGA 2RJ0A 3TISA 1ZCYA 2O1HA 1WVCA 5AFUV 2FKOA 1PZTA 3FWWA 3KWDA 1VGWA 3NGWA 2ZU7A 1TZFA 1ZI4A 5EJ1A 1VZUA 4EE4A 2Z87A 3I0GA 3CKVA 4G3SA 1FO8A 4EAAA 2V0LA 5DG3A 4XWIA 4FREA 1S4PA 1EYRA 3EH0A 2Z86A 2PGVA 4HO6A 4MYBA 3BCVA 4FRHA 4KNXA 4E79A 1R7YA 1VH3A 4EEGA 3KWEA 3EE5A 3D98A 1H5TB 4HG6A 4R7PA 3U2UA 4HURA 2P6WA 4FROA 1FGXA 2VSIA 1ZI1A 3ZLLA 2NXVA 1KGQA 3SXDA 1ON6A 2WLDA 3V0LA 1LXAA 4E1KA 2JCOA 2AH9A 2WLEA 2X65A 1YP2A 2YESA 3JQYA 5C48A 1VH1A 2AECA 2D7RA 1OMZA 2W0VA 4EABA 4NAIA 2WLGA 1XHBA 3TZTA 1Z90A 2W0WA 2RIJA 3GVDA 1R82A 3U0YA 2FYCB 4Y7UA 5C47A 2QIVX 3SXAA 4IRPA 4M4KA 2JF3A 4HO5A 4K6RA 1ZHJA 3V0MA 1GX4A 5CMHA 1FG5N 3V0NA 2YQHA 3FOQA 1ZDFA 2RIXA 3VBLA 5C3DA 5L6SA 4BQHA 2PA4A 3I3XA 3U2VA 4MYOA 1R7VA 1OCXA 2Y4MA 2YC3A 5CMFX 1MR9A 3EEVA 1FRWA 1ZCTA 4B2WA 4M98A 4N6BA 5HS2A 4G3QA 3PMOA 2RJ8A 4HO8A 4YS8A 3SXEA 4D0ZA 3NZ2A 1VZTA 3SRTA 3SXCA 1QG8A 1H5SA 3IOHA 4NALA 1E5KA 4M2BA 2WVKA 3R3IA 3SXBA 3F1CA 2VHEA 5DDVA 5EIYA 1VGZA 5AJNA 1R7XA 1G97A 1WSZA 2OEFA 1R81A 2QKXA 3IOIA 1H5SC 2P2OA 2YQSA 4B4BA 5DEMA 2AQ9A 1TW5A 3I0KA 3PKPA 3TK8A 5C4DA 4ECMA 1LZIA 1KWSA 5E3PA 5C4BA 3R5AA 3OW5A 4HCQA 1H7EA 1NF5B 1TVYA 2Q4JA 3R2WA 3I3AA 2XWNA 2P72A 4HZDA 4HUSA 2XWLA 4N6AA 1W77A 3OC9A 1J2ZA 1G8OA 1MP4A 2VS4A 2OI5A 1LZJA 2WLFA 3Q4SA 2OI6A 4ISXA 4J09A 4LW6A 4Y7TA 4B5BA 5C4EA 2WVLA 4Y9XA 2QIAA 4B2XA 4N69A 1GWWA 1JVGA 4E75A 4Y7GA 3T7OA 2PGYA 3QVBA 1FR9A 1H5RA 1ZCVA 3T7NA 3TWDA 3R1WA 3ST8A 5AFUU 2A8UA 5CQMX 2I7BA 1XHDA 1GX0A 3VBKA 1ZJOA 1G93A 4ARWA 1H5SB 3T7MA 1QRGA 3OU9A 1VGUA 3CU0A 3IOJA 4M9CA 1ZJ0A 3OTZA 1QRLA 4FCEA 3R8YA 3F1XA 1XATA 2JCLA 2AGDA 3D8VA 2FYDB 5C49A 3PNNA 1WT2A 4IHHA 1H7LA 1S4NA 3OGZA 4C2SA 2YCMA 3OH2A 1S4OA 3JUJA 4AAWA 1LVWA 4D0TA 4EEOA 3BXYA 2AM4A 2RJ5A 1LL0A 1H4EA 1YROB 4DECA 3CJ8A 2WVMA 2X5ZA 5CMIA 2FYBA 1KHRA 5L6VA 3OH3A 4Y7VA 4E6TA 1MR7A 2AM5A 1OMXA 1V67A 4EA9A 1R80A 4NANA 2I5EA 4FRQA 4KC4A 4EE5A 3RMWA 3SPTA 1G3LA 1FWYA 2AE7A 3U0XA 2VXLA 4G3PA 5E3RA 4M28A 4BMAA 3N9WA 5I1FA 3V0PA 3MQGA 4B3UA 5FU8A 5DEPA 2DPWA 2XMHA 3Q1XA 3I0DA 1KK6A 5FU0A 3U2WA 5F42A 4ASJA 3SX3A 5IDTA 2NPOA 1JV1A 1NMMB 3SX5A 1V3WA 5C4FA 2VD4A 2ZU8A 3K8DA 2V0HA 5EJZA 1W57A 1H5RB 1V84A 3OH0A 4NAKA 1G2VA 3CGXA 1MRLA 4HO2A 3CKJA 4MNDA 4P00A 1JYKA 2V0IA 3USRA 3V8ZA 3MQHA 4M2AA 3IXCA 2ZU9A 1QGSA 3V90A 1R7TA 3CKOA 3FSCA 2JCKA 3CKNA 4H7OA 5FTSA 2FY7A 2IUAA 3ZGFA 3FSXA 4D11A 5CQPA 2V0KA 1KK5A 1ON8A 3R3RA 1O7OA 3KIAA 1H5SD 4HO3A 1VICA 3GUEA 1YP3A 2ICYA 2V0JA 1SSMA 3JUKA 1IIMA 2APCA 5C1LA 3FS8A 4D11C 3ECTA 4CJ8A 2RIZA 5AJOA 1ZJ3A 4Y63A 5C4CA 3V0OA 4M99A 3SX8A 3FSYA 4AYLA 3C8VA 5ADXV 3E26A 1FOAA 4DDZA 4KPXA 1LL3A 5CMJA 3SXGA 5IFYA 4EVWA 2WLCA 2O1GA 5FTVA 5FYEA 4KNRA 1ZIZA 2BO7A 4D48A 4FRPA 4HZCA 3OTMA 4DE7A 1VM8A 5FUHA 4Y64A 1HJJA 4GBPA 3DUVA 1ZJPA 2Y6PA 1O23B 3VBJA 3U2XA 2Y4JA 2E3DA 1SS9A 1KRUA 2BO8A 4R36A 1FR8A 1WT0A 4EE3A 2QGIA 4LW3A 3OAMA 4DCLA 1H3MA 3IGJA 1YP4A 2RIYA 2WAWA 1QRFA 1QGQA 2A8WA 5C36A 2D7IA 1NKHB 3HL3A 5E3QA 4L41C 4G87A 3VBNA 1SSQA 3R0SA 1O7QA 3Q80A 4FCUA 1KGTA 2GGQA 3V0QA 4AYJA 1LZ0A 1LZ7A 1H7QA 4R37A 2JF2A 4Y62A 1G95A 3BSYA 5C1GA 5C38A 1JYLA 4UEGA 5C3BA 3VBIA 3RMVA 2MZBA 4FRBA 2I5KA 1G9RA 1GQCA 5J49A 1VGTA 2XWMA 1SSTA 1ZI5A 4IHFA 1G23A 3FSBA 4B4MA 1EZIA 1NWGB 3I0EA 3P47A 3I0CA 1H7TA 2FFUA 1NQIB 1QRMA 1TW1A 4EA7A 3DK5A 2RJ4A 1FGGA 4KXOA 4IRQA 3KWCA 1GA8A 2OI7A 3CKQA 2VFZA 2VS5A 5CQLX 3RSBA 1H4DA 2FYAA 4P02A 3R5DA 3EG4A 4E6UA 4FQWA 1T3DA 2TDTA 2D0JA 2XATA 5C3AA 3ZLKA 1THJA 1K4VA 1O0RA 2Y4LA 1KRRA 1KRVA 4AC3A 2OEGA 3DJ4A 1VPAA 1HJLA 1JV3A 1FZWA 1PZYB 1ZJ1A 2CU2A 2VXMA 3MC4A 3V8YA 4FRMA 1HM0A 2IU8A 3I0LA 1QWJA 4KC1A 5C8RA 4EGGA 4CVHA 5IDSA 3V4EA 4HO0A 3TV0A 1H7GA 4MFGA 3USQA 5BXCA 2PX7A 1HM9A 3F1YA 2VSHA 4KRVA 1FXJA 3OH4A 4Y6UA 4Y6NA 5CQNX 3GOSA 5CMGX 2GGOA 3VNPA 1JVDA 5U2KA 1HM8A 3R5CA 2AESA 3T57A 3JTJA
chains in the Genus database with same CATH superfamily
1ZI3A 1I52A 4EEMA 2BO4A 3VBMA 3TQDA 2UX8A 4KT7A 3ZGGA 3O3PA 3DHOA 3I0HA 5ADXU 1WT3A 4CJBA 1R7UA 3BSSA 3OH1A 5DDTA 1W55A 3VBPA 2X5SA 3V91A 3POLA 1QQ0A 2IC7A 1VZXA 4HO9A 2Y4KA 4EEAA 3TIOA 1H4CA 4CJCA 3BFPA 5AJPA 4MZUA 1GWVA 2VS3A 1MP5A 3E25A 4JISA 1FXOA 1S80A 4J18A 1LL2A 1OQMB 4EQYA 4KC2A 1V82A 2P73A 3P1BA 4FRLA 3BSWA 4AA7A 2RJ9A 3BRKX 3HJJA 3SX7A 1QREA 4EA8A 1ZJ2A 1V83A 1H7HA 2RJ1A 3I0FA 4JD0A 4B42A 4FRDA 3I0JA 4FRAA 3GQ7A 1WT1A 2Y7AA 4HOCA 4KPZA 1TDTA 5CQOA 4N27A 3OUPA 4HO4A 1G1LA 2FFVA 5JQQA 2O1FA 2RJ6A 2WGZA 2IU9A 1NHEB 2YQJA 3K8EA 5FV9A 1ZCUA 2QH5A 2AM3A 2WEEA 1H5TA 1G0RA 2RITA 1XZ6A 4O6NA 1INIA 3PKQA 5C1HA 3OKRA 1FO9A 1MC3A 2XMEA 2WE9A 3FTTA 1IINA 2RJ7A 4B4GA 1MP3A 2E8BA 3D5NA 3LW6A 3Q7UA 1HV9A 4FIYA 1KQAA 3I0IX 4KQLA 2YQCA 3U2TA 4IHGA 2ICXA 4ASYA 2X60A 4Y7FA 1INJA 1KK4A 4ZDQA 2YC5A 3TDTA 1H7FA 3ZF8A 1GQ9A 2JCJA 3HSQA 2BO6A 3R5BA 1ZDGA 2RJ0A 3TISA 1ZCYA 2O1HA 1WVCA 5AFUV 2FKOA 1L0SA 1PZTA 3FWWA 3KWDA 1VGWA 3NGWA 2ZU7A 1TZFA 1ZI4A 5EJ1A 1VZUA 4EE4A 2Z87A 3I0GA 3CKVA 4G3SA 1FO8A 4EAAA 2V0LA 5DG3A 4XWIA 4FREA 1S4PA 1EYRA 3EH0A 2Z86A 2PGVA 4HO6A 4MYBA 3BCVA 4FRHA 4KNXA 4E79A 1R7YA 1VH3A 4EEGA 3KWEA 3EE5A 3D98A 1H5TB 4HG6A 4R7PA 3U2UA 4HURA 2P6WA 4FROA 1FGXA 2VSIA 1ZI1A 3ZLLA 2NXVA 1KGQA 3SXDA 1ON6A 2WLDA 3V0LA 1LXAA 4E1KA 2JCOA 2AH9A 2WLEA 2X65A 1YP2A 2YESA 3JQYA 5C48A 1VH1A 2AECA 2D7RA 1OMZA 2W0VA 4EABA 4NAIA 2WLGA 1XHBA 3TZTA 1Z90A 2W0WA 2RIJA 4MIXA 3GVDA 1R82A 3U0YA 2FYCB 4Y7UA 5C47A 2QIVX 3SXAA 4IRPA 4M4KA 2JF3A 4HO5A 4K6RA 1ZHJA 3V0MA 1GX4A 5CMHA 1Z2FA 1FG5N 3V0NA 2YQHA 3FOQA 1ZDFA 2RIXA 3VBLA 5C3DA 5L6SA 4BQHA 2PA4A 3I3XA 3U2VA 4MYOA 1R7VA 1OCXA 2Y4MA 2YC3A 5CMFX 1MR9A 5D92A 3EEVA 1FRWA 1ZCTA 4B2WA 1N4IA 4M98A 4N6BA 5HS2A 1EWWA 4G3QA 3PMOA 2RJ8A 4HO8A 4YS8A 3SXEA 4D0ZA 3NZ2A 1VZTA 3SRTA 3SXCA 1QG8A 1H5SA 3IOHA 4NALA 1E5KA 4M2BA 2WVKA 3R3IA 3SXBA 3F1CA 3SUCA 2VHEA 5DDVA 5EIYA 2VK9A 1VGZA 5AJNA 1R7XA 4FIXA 1G97A 1WSZA 2OEFA 1R81A 2QKXA 3IOIA 1H5SC 2P2OA 2YQSA 4B4BA 5DEMA 2AQ9A 1TW5A 3I0KA 3PKPA 3TK8A 5C4DA 4ECMA 1LZIA 1KWSA 5E3PA 5C4BA 3R5AA 3OW5A 4HCQA 1H7EA 1NF5B 1TVYA 2Q4JA 3R2WA 3I3AA 2XWNA 2P72A 4HZDA 4HUSA 2XWLA 4N6AA 1W77A 3OC9A 1J2ZA 1G8OA 1MP4A 2VS4A 2OI5A 1LZJA 2J0AA 2WLFA 3Q4SA 2OI6A 4ISXA 3GQAA 4J09A 4LW6A 4Y7TA 4B5BA 5C4EA 2WVLA 4Y9XA 2QIAA 5D91A 4B2XA 4N69A 1GWWA 1JVGA 4E75A 4Y7GA 3T7OA 2PGYA 3QVBA 1FR9A 1H5RA 1ZCVA 3T7NA 3TWDA 3R1WA 3ST8A 5AFUU 2A8UA 5CQMX 2I7BA 1XHDA 1GX0A 3VBKA 1ZJOA 1G93A 4ARWA 1H5SB 3T7MA 1QRGA 3OU9A 1VGUA 3CU0A 3IOJA 4M9CA 1ZJ0A 3OTZA 1QRLA 4FCEA 3R8YA 3F1XA 1XATA 2JCLA 2AGDA 3D8VA 2FYDB 5C49A 3PNNA 1WT2A 2C0NA 4IHHA 1H7LA 1S4NA 3OGZA 4C2SA 2YCMA 3OH2A 1S4OA 3JUJA 4AAWA 1LVWA 4D0TA 4EEOA 3BXYA 2AM4A 2RJ5A 1LL0A 1H4EA 1YROB 4DECA 3CJ8A 2WVMA 2X5ZA 5CMIA 2FYBA 1KHRA 3OH3A 5L6VA 4Y7VA 4E6TA 1MR7A 2AM5A 1OMXA 1V67A 4EA9A 1R80A 4NANA 2I5EA 4FRQA 4KC4A 4EE5A 3RMWA 3SPTA 1G3LA 1FWYA 2AE7A 3U0XA 2VXLA 4G3PA 5E3RA 4M28A 4BMAA 3N9WA 5I1FA 3V0PA 3MQGA 4B3UA 5FU8A 5DEPA 2DPWA 2XMHA 3Q1XA 3I0DA 1KK6A 5FU0A 3U2WA 5F42A 4ASJA 3SX3A 5IDTA 2NPOA 1JV1A 1NMMB 3SX5A 1V3WA 4Q7CA 2VD4A 5C4FA 2ZU8A 3K8DA 2V0HA 5EJZA 1W57A 1H5RB 1V84A 3OH0A 4NAKA 1G2VA 3CGXA 1MRLA 4HO2A 3CKJA 4MNDA 4P00A 1JYKA 2V0IA 3USRA 3V8ZA 3MQHA 4M2AA 3IXCA 2ZU9A 1QGSA 3V90A 1R7TA 3CKOA 3FSCA 2JCKA 3CKNA 4H7OA 5FTSA 2FY7A 2IUAA 3ZGFA 3FSXA 4D11A 5CQPA 2V0KA 1KK5A 1ON8A 3R3RA 1O7OA 3KIAA 1H5SD 4HO3A 1VICA 3GUEA 1YP3A 2ICYA 2V0JA 1SSMA 3JUKA 1IIMA 2APCA 5C1LA 3FS8A 4D11C 3ECTA 4CJ8A 2RIZA 5AJOA 1ZJ3A 4Y63A 5C4CA 3V0OA 4M99A 3SX8A 3FSYA 4AYLA 3C8VA 5ADXV 3E26A 1FOAA 4DDZA 4KPXA 1LL3A 5CMJA 3SXGA 5IFYA 4EVWA 2WLCA 2O1GA 5FTVA 5FYEA 4KNRA 1ZIZA 2BO7A 4D48A 4FRPA 4HZCA 3OTMA 4DE7A 1VM8A 5FUHA 4Y64A 1HJJA 4GBPA 3DUVA 1ZJPA 2Y6PA 1O23B 3VBJA 3U2XA 2Y4JA 2E3DA 1SS9A 1KRUA 2BO8A 4R36A 1FR8A 1WT0A 4EE3A 2QGIA 4LW3A 3OAMA 4DCLA 1H3MA 3IGJA 1YP4A 2RIYA 1M8NA 2WAWA 1QRFA 1QGQA 2A8WA 5C36A 2D7IA 1NKHB 3HL3A 4O6MA 5E3QA 4L41C 4G87A 3VBNA 1SSQA 3R0SA 1O7QA 3Q80A 4FCUA 1KGTA 2GGQA 3V0QA 4AYJA 1LZ0A 1LZ7A 1H7QA 4R37A 2JF2A 4Y62A 1G95A 3BSYA 5C1GA 5C38A 1JYLA 4UEGA 3GQ9A 5C3BA 3VBIA 3RMVA 2MZBA 4FRBA 2I5KA 1G9RA 1GQCA 5J49A 1VGTA 2XWMA 1SSTA 1ZI5A 4IHFA 1G23A 3FSBA 4B4MA 1EZIA 1NWGB 3I0EA 3P47A 3I0CA 1H7TA 2FFUA 1NQIB 1QRMA 1TW1A 4EA7A 3DK5A 2RJ4A 1FGGA 4KXOA 4IRQA 3KWCA 1GA8A 2OI7A 3CKQA 2VFZA 2VS5A 5CQLX 3RSBA 1H4DA 2FYAA 4P02A 3R5DA 3EG4A 4E6UA 4FQWA 1T3DA 2TDTA 2D0JA 2XATA 5C3AA 3ZLKA 1THJA 1K4VA 1O0RA 2Y4LA 1KRRA 1KRVA 4AC3A 2OEGA 3DJ4A 1VPAA 1HJLA 1JV3A 1FZWA 2J0BA 1PZYB 1ZJ1A 2CU2A 2VXMA 3MC4A 3V8YA 4FRMA 1HM0A 2IU8A 3I0LA 1QWJA 4KC1A 5C8RA 4EGGA 4CVHA 5IDSA 3V4EA 4HO0A 3TV0A 1H7GA 4MFGA 3USQA 5BXCA 2PX7A 1HM9A 3F1YA 2VSHA 4KRVA 1FXJA 3OH4A 4Y6UA 4Y6NA 5CQNX 3GOSA 5CMGX 2GGOA 3VNPA 1JVDA 3GQ8A 5U2KA 1HM8A 3R5CA 2AESA 3T57A 3JTJA
chains in the Genus database with same CATH topology
1ZI3A 1I52A 4EEMA 2BO4A 3VBMA 3TQDA 2UX8A 4KT7A 3ZGGA 3O3PA 3DHOA 3I0HA 5ADXU 1WT3A 4CJBA 1R7UA 3BSSA 3OH1A 5DDTA 1W55A 3VBPA 2X5SA 3V91A 3POLA 1QQ0A 2IC7A 1VZXA 4HO9A 2Y4KA 4EEAA 3TIOA 1H4CA 4CJCA 3BFPA 5AJPA 4MZUA 1GWVA 2VS3A 1MP5A 3E25A 4JISA 1FXOA 1S80A 4J18A 1LL2A 1OQMB 4EQYA 4KC2A 1V82A 2P73A 3P1BA 4FRLA 3BSWA 4AA7A 2RJ9A 3BRKX 3HJJA 3SX7A 1QREA 4EA8A 1ZJ2A 1V83A 1H7HA 2RJ1A 3I0FA 4JD0A 4B42A 4FRDA 3I0JA 4FRAA 4HOCA 1WT1A 2Y7AA 4KPZA 1TDTA 5CQOA 4N27A 3OUPA 4HO4A 1G1LA 2FFVA 5JQQA 2O1FA 2RJ6A 2WGZA 2IU9A 1NHEB 2YQJA 3K8EA 5FV9A 1ZCUA 2QH5A 2AM3A 2WEEA 1H5TA 1G0RA 2RITA 1XZ6A 4O6NA 1INIA 3PKQA 5C1HA 3OKRA 1FO9A 1MC3A 2XMEA 2WE9A 3FTTA 1IINA 2RJ7A 4B4GA 1MP3A 2E8BA 3D5NA 3LW6A 3Q7UA 1HV9A 4FIYA 1KQAA 3I0IX 4KQLA 2YQCA 3U2TA 4IHGA 2ICXA 4ASYA 2X60A 4Y7FA 1INJA 1KK4A 4ZDQA 2YC5A 3TDTA 1H7FA 3ZF8A 1GQ9A 2JCJA 3HSQA 2BO6A 3R5BA 1ZDGA 2RJ0A 3TISA 1ZCYA 2O1HA 1WVCA 5AFUV 2FKOA 1PZTA 3FWWA 3KWDA 1VGWA 3NGWA 2ZU7A 1TZFA 1ZI4A 5EJ1A 1VZUA 4EE4A 2Z87A 3I0GA 3CKVA 4G3SA 1FO8A 4EAAA 2V0LA 5DG3A 4XWIA 4FREA 1S4PA 1EYRA 3EH0A 2Z86A 2PGVA 4HO6A 4MYBA 3BCVA 4FRHA 4KNXA 4E79A 1R7YA 1VH3A 4EEGA 3KWEA 3EE5A 3D98A 1H5TB 4HG6A 4R7PA 3U2UA 4HURA 2P6WA 4FROA 1FGXA 2VSIA 1ZI1A 3ZLLA 2NXVA 1KGQA 3SXDA 1ON6A 2WLDA 3V0LA 1LXAA 4E1KA 2JCOA 2AH9A 2WLEA 2X65A 1YP2A 2YESA 3JQYA 5C48A 1VH1A 2AECA 2D7RA 1OMZA 2W0VA 4EABA 4NAIA 2WLGA 1XHBA 3TZTA 1Z90A 2W0WA 2RIJA 4MIXA 3GVDA 1R82A 3U0YA 2FYCB 4Y7UA 5C47A 2QIVX 3SXAA 4IRPA 4M4KA 2JF3A 4HO5A 4K6RA 1ZHJA 3V0MA 1GX4A 5CMHA 1FG5N 3V0NA 2YQHA 3FOQA 1ZDFA 2RIXA 3VBLA 5C3DA 5L6SA 4BQHA 2PA4A 3I3XA 3U2VA 4MYOA 1R7VA 1OCXA 2Y4MA 2YC3A 5CMFX 1MR9A 5D92A 3EEVA 1FRWA 1ZCTA 4B2WA 4M98A 4N6BA 5HS2A 4G3QA 3PMOA 2RJ8A 4HO8A 4YS8A 3SXEA 4D0ZA 3NZ2A 1VZTA 3SRTA 3SXCA 1QG8A 1H5SA 3IOHA 4NALA 1E5KA 4M2BA 2WVKA 3R3IA 3SXBA 3F1CA 2VHEA 5DDVA 5EIYA 2VK9A 1VGZA 5AJNA 1R7XA 4FIXA 1G97A 1WSZA 2OEFA 1R81A 2QKXA 3IOIA 1H5SC 2P2OA 2YQSA 4B4BA 5DEMA 2AQ9A 1TW5A 3I0KA 3PKPA 3TK8A 5C4DA 4ECMA 1LZIA 1KWSA 5E3PA 5C4BA 3R5AA 3OW5A 4HCQA 1H7EA 1NF5B 1TVYA 2Q4JA 3R2WA 3I3AA 2XWNA 2P72A 4HZDA 4HUSA 2XWLA 4N6AA 1W77A 3OC9A 1J2ZA 1G8OA 1MP4A 2VS4A 2OI5A 1LZJA 2J0AA 2WLFA 3Q4SA 2OI6A 4ISXA 4J09A 4LW6A 4Y7TA 4B5BA 5C4EA 2WVLA 4Y9XA 2QIAA 5D91A 4B2XA 4N69A 1GWWA 1JVGA 4E75A 4Y7GA 3T7OA 2PGYA 3QVBA 1FR9A 1H5RA 1ZCVA 3T7NA 3TWDA 3R1WA 3ST8A 5AFUU 2A8UA 5CQMX 2I7BA 1XHDA 1GX0A 3VBKA 1ZJOA 1G93A 4ARWA 1H5SB 3T7MA 1QRGA 3OU9A 1VGUA 3CU0A 3IOJA 4M9CA 1ZJ0A 3OTZA 1QRLA 4FCEA 3R8YA 3F1XA 1XATA 2JCLA 2AGDA 3D8VA 2FYDB 5C49A 3PNNA 1WT2A 2C0NA 4IHHA 1H7LA 1S4NA 3OGZA 4C2SA 2YCMA 3OH2A 1S4OA 3JUJA 4AAWA 1LVWA 4D0TA 4EEOA 3BXYA 2AM4A 2RJ5A 1LL0A 1H4EA 1YROB 4DECA 3CJ8A 2WVMA 2X5ZA 5CMIA 2FYBA 1KHRA 5L6VA 3OH3A 4Y7VA 4E6TA 1MR7A 2AM5A 1OMXA 1V67A 4EA9A 1R80A 4NANA 2I5EA 4FRQA 4KC4A 4EE5A 3RMWA 3SPTA 1G3LA 1FWYA 2AE7A 3U0XA 2VXLA 4G3PA 5E3RA 4M28A 4BMAA 3N9WA 5I1FA 3V0PA 3MQGA 4B3UA 5FU8A 5DEPA 2DPWA 2XMHA 3Q1XA 3I0DA 1KK6A 5FU0A 3U2WA 5F42A 4ASJA 3SX3A 5IDTA 2NPOA 1JV1A 1NMMB 3SX5A 1V3WA 4Q7CA 2VD4A 5C4FA 2ZU8A 3K8DA 2V0HA 5EJZA 1W57A 1H5RB 1V84A 3OH0A 4NAKA 1G2VA 3CGXA 1MRLA 4HO2A 3CKJA 4MNDA 4P00A 1JYKA 2V0IA 3USRA 3V8ZA 3MQHA 4M2AA 3IXCA 2ZU9A 1QGSA 3V90A 1R7TA 3CKOA 3FSCA 2JCKA 3CKNA 4H7OA 5FTSA 2FY7A 2IUAA 3ZGFA 3FSXA 4D11A 5CQPA 2V0KA 1KK5A 1ON8A 3R3RA 1O7OA 3KIAA 1H5SD 4HO3A 1VICA 3GUEA 1YP3A 2ICYA 2V0JA 1SSMA 3JUKA 1IIMA 2APCA 5C1LA 3FS8A 4D11C 3ECTA 4CJ8A 2RIZA 5AJOA 1ZJ3A 4Y63A 5C4CA 3V0OA 4M99A 3SX8A 3FSYA 4AYLA 3C8VA 5ADXV 3E26A 1FOAA 4DDZA 4KPXA 1LL3A 5CMJA 3SXGA 5IFYA 4EVWA 2WLCA 2O1GA 5FTVA 5FYEA 4KNRA 1ZIZA 2BO7A 4D48A 4FRPA 4HZCA 3OTMA 4DE7A 1VM8A 5FUHA 4Y64A 1HJJA 4GBPA 3DUVA 1ZJPA 2Y6PA 1O23B 3VBJA 3U2XA 2Y4JA 2E3DA 1SS9A 1KRUA 2BO8A 4R36A 1FR8A 1WT0A 4EE3A 2QGIA 4LW3A 3OAMA 4DCLA 1H3MA 3IGJA 1YP4A 2RIYA 2WAWA 1QRFA 1QGQA 2A8WA 5C36A 2D7IA 1NKHB 3HL3A 4O6MA 5E3QA 4L41C 4G87A 3VBNA 1SSQA 3R0SA 1O7QA 3Q80A 4FCUA 1KGTA 2GGQA 3V0QA 4AYJA 1LZ0A 1LZ7A 1H7QA 4R37A 2JF2A 4Y62A 1G95A 3BSYA 5C1GA 5C38A 1JYLA 4UEGA 5C3BA 3VBIA 3RMVA 2MZBA 4FRBA 2I5KA 1G9RA 1GQCA 5J49A 1VGTA 2XWMA 1SSTA 1ZI5A 4IHFA 1G23A 3FSBA 4B4MA 1EZIA 1NWGB 3I0EA 3P47A 3I0CA 1H7TA 2FFUA 1NQIB 1QRMA 1TW1A 4EA7A 3DK5A 2RJ4A 1FGGA 4KXOA 4IRQA 3KWCA 1GA8A 2OI7A 3CKQA 2VFZA 2VS5A 5CQLX 3RSBA 1H4DA 2FYAA 4P02A 3R5DA 3EG4A 4E6UA 4FQWA 1T3DA 2TDTA 2D0JA 2XATA 5C3AA 3ZLKA 1THJA 1K4VA 1O0RA 2Y4LA 1KRRA 1KRVA 4AC3A 2OEGA 3DJ4A 1VPAA 1HJLA 1JV3A 1FZWA 2J0BA 1PZYB 1ZJ1A 2CU2A 2VXMA 3MC4A 3V8YA 4FRMA 1HM0A 2IU8A 3I0LA 1QWJA 4KC1A 5C8RA 4EGGA 4CVHA 5IDSA 3V4EA 4HO0A 3TV0A 1H7GA 4MFGA 3USQA 5BXCA 2PX7A 1HM9A 3F1YA 2VSHA 4KRVA 1FXJA 3OH4A 4Y6UA 4Y6NA 5CQNX 3GOSA 5CMGX 2GGOA 3VNPA 1JVDA 5U2KA 1HM8A 3R5CA 2AESA 3T57A 3JTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZI3 A;  1I52 A;  4EEM A;  2BO4 A;  3VBM A;  3TQD A;  2UX8 A;  4KT7 A;  3ZGG A;  3O3P A;  3DHO A;  3I0H A;  5ADX U;  1WT3 A;  4CJB A;  1R7U A;  3BSS A;  3OH1 A;  5DDT A;  1W55 A;  3VBP A;  2X5S A;  3V91 A;  3POL A;  1QQ0 A;  2IC7 A;  1VZX A;  4HO9 A;  2Y4K A;  4EEA A;  3TIO A;  1H4C A;  4CJC A;  3BFP A;  5AJP A;  4MZU A;  1GWV A;  2VS3 A;  1MP5 A;  3E25 A;  4JIS A;  1FXO A;  1S80 A;  4J18 A;  1LL2 A;  1OQM B;  4EQY A;  4KC2 A;  1V82 A;  2P73 A;  3P1B A;  4FRL A;  3BSW A;  4AA7 A;  2RJ9 A;  3BRK X;  3HJJ A;  3SX7 A;  1QRE A;  4EA8 A;  1ZJ2 A;  1V83 A;  1H7H A;  2RJ1 A;  3I0F A;  4JD0 A;  4B42 A;  4FRD A;  3I0J A;  4FRA A;  4HOC A;  1WT1 A;  2Y7A A;  4KPZ A;  1TDT A;  5CQO A;  4N27 A;  3OUP A;  4HO4 A;  1G1L A;  2FFV A;  5JQQ A;  2O1F A;  2RJ6 A;  2WGZ A;  2IU9 A;  1NHE B;  2YQJ A;  3K8E A;  5FV9 A;  1ZCU A;  2QH5 A;  2AM3 A;  2WEE A;  1H5T A;  1G0R A;  2RIT A;  1XZ6 A;  1INI A;  3PKQ A;  5C1H A;  3OKR A;  1FO9 A;  1MC3 A;  2XME A;  2WE9 A;  3FTT A;  1IIN A;  2RJ7 A;  4B4G A;  1MP3 A;  2E8B A;  3D5N A;  3LW6 A;  3Q7U A;  1HV9 A;  1KQA A;  3I0I X;  4KQL A;  2YQC A;  3U2T A;  4IHG A;  2ICX A;  4ASY A;  2X60 A;  4Y7F A;  1INJ A;  1KK4 A;  4ZDQ A;  2YC5 A;  3TDT A;  1H7F A;  3ZF8 A;  1GQ9 A;  2JCJ A;  3HSQ A;  2BO6 A;  3R5B A;  1ZDG A;  2RJ0 A;  3TIS A;  1ZCY A;  2O1H A;  1WVC A;  5AFU V;  2FKO A;  1PZT A;  3FWW A;  3KWD A;  1VGW A;  3NGW A;  2ZU7 A;  1TZF A;  1ZI4 A;  5EJ1 A;  1VZU A;  4EE4 A;  2Z87 A;  3I0G A;  3CKV A;  4G3S A;  1FO8 A;  4EAA A;  2V0L A;  5DG3 A;  4XWI A;  4FRE A;  1S4P A;  1EYR A;  3EH0 A;  2Z86 A;  2PGV A;  4HO6 A;  4MYB A;  3BCV A;  4FRH A;  4KNX A;  4E79 A;  1R7Y A;  1VH3 A;  4EEG A;  3KWE A;  3EE5 A;  3D98 A;  1H5T B;  4HG6 A;  4R7P A;  3U2U A;  4HUR A;  2P6W A;  4FRO A;  1FGX A;  2VSI A;  1ZI1 A;  3ZLL A;  2NXV A;  1KGQ A;  3SXD A;  1ON6 A;  2WLD A;  3V0L A;  1LXA A;  4E1K A;  2JCO A;  2AH9 A;  2WLE A;  2X65 A;  1YP2 A;  2YES A;  3JQY A;  5C48 A;  1VH1 A;  2AEC A;  2D7R A;  1OMZ A;  2W0V A;  4EAB A;  4NAI A;  2WLG A;  1XHB A;  3TZT A;  1Z90 A;  2W0W A;  2RIJ A;  3GVD A;  1R82 A;  3U0Y A;  2FYC B;  4Y7U A;  5C47 A;  2QIV X;  3SXA A;  4IRP A;  4M4K A;  2JF3 A;  4HO5 A;  4K6R A;  1ZHJ A;  3V0M A;  1GX4 A;  5CMH A;  1FG5 N;  3V0N A;  2YQH A;  3FOQ A;  1ZDF A;  2RIX A;  3VBL A;  5C3D A;  5L6S A;  4BQH A;  2PA4 A;  3I3X A;  3U2V A;  4MYO A;  1R7V A;  1OCX A;  2Y4M A;  2YC3 A;  5CMF X;  1MR9 A;  3EEV A;  1FRW A;  1ZCT A;  4B2W A;  4M98 A;  4N6B A;  5HS2 A;  4G3Q A;  3PMO A;  2RJ8 A;  4HO8 A;  4YS8 A;  3SXE A;  4D0Z A;  3NZ2 A;  1VZT A;  3SRT A;  3SXC A;  1QG8 A;  1H5S A;  3IOH A;  4NAL A;  1E5K A;  4M2B A;  2WVK A;  3R3I A;  3SXB A;  3F1C A;  2VHE A;  5DDV A;  5EIY A;  1VGZ A;  5AJN A;  1R7X A;  1G97 A;  1WSZ A;  2OEF A;  1R81 A;  2QKX A;  3IOI A;  1H5S C;  2P2O A;  2YQS A;  4B4B A;  5DEM A;  2AQ9 A;  1TW5 A;  3I0K A;  3PKP A;  3TK8 A;  5C4D A;  4ECM A;  1LZI A;  1KWS A;  5E3P A;  5C4B A;  3R5A A;  3OW5 A;  4HCQ A;  1H7E A;  1NF5 B;  1TVY A;  2Q4J A;  3R2W A;  3I3A A;  2XWN A;  2P72 A;  4HZD A;  4HUS A;  2XWL A;  4N6A A;  1W77 A;  3OC9 A;  1J2Z A;  1G8O A;  1MP4 A;  2VS4 A;  2OI5 A;  1LZJ A;  2WLF A;  3Q4S A;  2OI6 A;  4ISX A;  4J09 A;  4LW6 A;  4Y7T A;  4B5B A;  5C4E A;  2WVL A;  4Y9X A;  2QIA A;  4B2X A;  4N69 A;  1GWW A;  1JVG A;  4E75 A;  4Y7G A;  3T7O A;  2PGY A;  3QVB A;  1FR9 A;  1H5R A;  1ZCV A;  3T7N A;  3TWD A;  3R1W A;  3ST8 A;  5AFU U;  2A8U A;  5CQM X;  2I7B A;  1XHD A;  1GX0 A;  3VBK A;  1ZJO A;  1G93 A;  4ARW A;  1H5S B;  3T7M A;  1QRG A;  3OU9 A;  1VGU A;  3CU0 A;  3IOJ A;  4M9C A;  1ZJ0 A;  3OTZ A;  1QRL A;  4FCE A;  3R8Y A;  3F1X A;  1XAT A;  2JCL A;  2AGD A;  3D8V A;  2FYD B;  5C49 A;  3PNN A;  1WT2 A;  4IHH A;  1H7L A;  1S4N A;  3OGZ A;  4C2S A;  2YCM A;  3OH2 A;  1S4O A;  3JUJ A;  4AAW A;  1LVW A;  4D0T A;  4EEO A;  3BXY A;  2AM4 A;  2RJ5 A;  1LL0 A;  1H4E A;  1YRO B;  4DEC A;  3CJ8 A;  2WVM A;  2X5Z A;  5CMI A;  2FYB A;  1KHR A;  5L6V A;  3OH3 A;  4Y7V A;  4E6T A;  1MR7 A;  2AM5 A;  1OMX A;  1V67 A;  4EA9 A;  1R80 A;  4NAN A;  2I5E A;  4FRQ A;  4KC4 A;  4EE5 A;  3RMW A;  3SPT A;  1G3L A;  1FWY A;  2AE7 A;  3U0X A;  2VXL A;  4G3P A;  5E3R A;  4M28 A;  4BMA A;  3N9W A;  5I1F A;  3V0P A;  3MQG A;  4B3U A;  5FU8 A;  5DEP A;  2DPW A;  2XMH A;  3Q1X A;  3I0D A;  1KK6 A;  5FU0 A;  3U2W A;  5F42 A;  4ASJ A;  3SX3 A;  5IDT A;  2NPO A;  1JV1 A;  1NMM B;  3SX5 A;  1V3W A;  5C4F A;  2VD4 A;  2ZU8 A;  3K8D A;  2V0H A;  5EJZ A;  1W57 A;  1H5R B;  1V84 A;  3OH0 A;  4NAK A;  1G2V A;  3CGX A;  1MRL A;  4HO2 A;  3CKJ A;  4MND A;  4P00 A;  1JYK A;  2V0I A;  3USR A;  3V8Z A;  3MQH A;  4M2A A;  3IXC A;  2ZU9 A;  1QGS A;  3V90 A;  1R7T A;  3CKO A;  3FSC A;  2JCK A;  3CKN A;  4H7O A;  5FTS A;  2FY7 A;  2IUA A;  3ZGF A;  3FSX A;  4D11 A;  5CQP A;  2V0K A;  1KK5 A;  1ON8 A;  3R3R A;  1O7O A;  3KIA A;  1H5S D;  4HO3 A;  1VIC A;  3GUE A;  1YP3 A;  2ICY A;  2V0J A;  1SSM A;  3JUK A;  1IIM A;  2APC A;  5C1L A;  3FS8 A;  4D11 C;  3ECT A;  4CJ8 A;  2RIZ A;  5AJO A;  1ZJ3 A;  4Y63 A;  5C4C A;  3V0O A;  4M99 A;  3SX8 A;  3FSY A;  4AYL A;  3C8V A;  5ADX V;  3E26 A;  1FOA A;  4DDZ A;  4KPX A;  1LL3 A;  5CMJ A;  3SXG A;  5IFY A;  4EVW A;  2WLC A;  2O1G A;  5FTV A;  5FYE A;  4KNR A;  1ZIZ A;  2BO7 A;  4D48 A;  4FRP A;  4HZC A;  3OTM A;  4DE7 A;  1VM8 A;  5FUH A;  4Y64 A;  1HJJ A;  4GBP A;  3DUV A;  1ZJP A;  2Y6P A;  1O23 B;  3VBJ A;  3U2X A;  2Y4J A;  2E3D A;  1SS9 A;  1KRU A;  2BO8 A;  4R36 A;  1FR8 A;  1WT0 A;  4EE3 A;  2QGI A;  4LW3 A;  3OAM A;  4DCL A;  1H3M A;  3IGJ A;  1YP4 A;  2RIY A;  2WAW A;  1QRF A;  1QGQ A;  2A8W A;  5C36 A;  2D7I A;  1NKH B;  3HL3 A;  5E3Q A;  4L41 C;  4G87 A;  3VBN A;  1SSQ A;  3R0S A;  1O7Q A;  3Q80 A;  4FCU A;  1KGT A;  2GGQ A;  3V0Q A;  4AYJ A;  1LZ0 A;  1LZ7 A;  1H7Q A;  4R37 A;  2JF2 A;  4Y62 A;  1G95 A;  3BSY A;  5C1G A;  5C38 A;  1JYL A;  4UEG A;  5C3B A;  3VBI A;  3RMV A;  2MZB A;  4FRB A;  2I5K A;  1G9R A;  1GQC A;  5J49 A;  1VGT A;  2XWM A;  1SST A;  1ZI5 A;  4IHF A;  1G23 A;  3FSB A;  4B4M A;  1EZI A;  1NWG B;  3I0E A;  3P47 A;  3I0C A;  1H7T A;  2FFU A;  1NQI B;  1QRM A;  1TW1 A;  4EA7 A;  3DK5 A;  2RJ4 A;  1FGG A;  4KXO A;  4IRQ A;  3KWC A;  1GA8 A;  2OI7 A;  3CKQ A;  2VFZ A;  2VS5 A;  5CQL X;  3RSB A;  1H4D A;  2FYA A;  4P02 A;  3R5D A;  3EG4 A;  4E6U A;  4FQW A;  1T3D A;  2TDT A;  2D0J A;  2XAT A;  5C3A A;  3ZLK A;  1THJ A;  1K4V A;  1O0R A;  2Y4L A;  1KRR A;  1KRV A;  4AC3 A;  2OEG A;  3DJ4 A;  1VPA A;  1HJL A;  1JV3 A;  1FZW A;  1PZY B;  1ZJ1 A;  2CU2 A;  2VXM A;  3MC4 A;  3V8Y A;  4FRM A;  1HM0 A;  2IU8 A;  3I0L A;  1QWJ A;  4KC1 A;  5C8R A;  4EGG A;  4CVH A;  5IDS A;  3V4E A;  4HO0 A;  3TV0 A;  1H7G A;  4MFG A;  3USQ A;  5BXC A;  2PX7 A;  1HM9 A;  3F1Y A;  2VSH A;  4KRV A;  1FXJ A;  3OH4 A;  4Y6U A;  4Y6N A;  5CQN X;  3GOS A;  5CMG X;  2GGO A;  3VNP A;  1JVD A;  5U2K A;  1HM8 A;  3R5C A;  2AES A;  3T57 A;  3JTJ A; 
#chains in the Genus database with same CATH topology
 1ZI3 A;  1I52 A;  4EEM A;  2BO4 A;  3VBM A;  3TQD A;  2UX8 A;  4KT7 A;  3ZGG A;  3O3P A;  3DHO A;  3I0H A;  5ADX U;  1WT3 A;  4CJB A;  1R7U A;  3BSS A;  3OH1 A;  5DDT A;  1W55 A;  3VBP A;  2X5S A;  3V91 A;  3POL A;  1QQ0 A;  2IC7 A;  1VZX A;  4HO9 A;  2Y4K A;  4EEA A;  3TIO A;  1H4C A;  4CJC A;  3BFP A;  5AJP A;  4MZU A;  1GWV A;  2VS3 A;  1MP5 A;  3E25 A;  4JIS A;  1FXO A;  1S80 A;  4J18 A;  1LL2 A;  1OQM B;  4EQY A;  4KC2 A;  1V82 A;  2P73 A;  3P1B A;  4FRL A;  3BSW A;  4AA7 A;  2RJ9 A;  3BRK X;  3HJJ A;  3SX7 A;  1QRE A;  4EA8 A;  1ZJ2 A;  1V83 A;  1H7H A;  2RJ1 A;  3I0F A;  4JD0 A;  4B42 A;  4FRD A;  3I0J A;  4FRA A;  3GQ7 A;  1WT1 A;  2Y7A A;  4HOC A;  4KPZ A;  1TDT A;  5CQO A;  4N27 A;  3OUP A;  4HO4 A;  1G1L A;  2FFV A;  5JQQ A;  2O1F A;  2RJ6 A;  2WGZ A;  2IU9 A;  1NHE B;  2YQJ A;  3K8E A;  5FV9 A;  1ZCU A;  2QH5 A;  2AM3 A;  2WEE A;  1H5T A;  1G0R A;  2RIT A;  1XZ6 A;  4O6N A;  1INI A;  3PKQ A;  5C1H A;  3OKR A;  1FO9 A;  1MC3 A;  2XME A;  2WE9 A;  3FTT A;  1IIN A;  2RJ7 A;  4B4G A;  1MP3 A;  2E8B A;  3D5N A;  3LW6 A;  3Q7U A;  1HV9 A;  4FIY A;  1KQA A;  3I0I X;  4KQL A;  2YQC A;  3U2T A;  4IHG A;  2ICX A;  4ASY A;  2X60 A;  4Y7F A;  1INJ A;  1KK4 A;  4ZDQ A;  2YC5 A;  3TDT A;  1H7F A;  3ZF8 A;  1GQ9 A;  2JCJ A;  3HSQ A;  2BO6 A;  3R5B A;  1ZDG A;  2RJ0 A;  3TIS A;  1ZCY A;  2O1H A;  1WVC A;  5AFU V;  2FKO A;  1L0S A;  1PZT A;  3FWW A;  3KWD A;  1VGW A;  3NGW A;  2ZU7 A;  1TZF A;  1ZI4 A;  5EJ1 A;  1VZU A;  4EE4 A;  2Z87 A;  3I0G A;  3CKV A;  4G3S A;  1FO8 A;  4EAA A;  2V0L A;  5DG3 A;  4XWI A;  4FRE A;  1S4P A;  1EYR A;  3EH0 A;  2Z86 A;  2PGV A;  4HO6 A;  4MYB A;  3BCV A;  4FRH A;  4KNX A;  4E79 A;  1R7Y A;  1VH3 A;  4EEG A;  3KWE A;  3EE5 A;  3D98 A;  1H5T B;  4HG6 A;  4R7P A;  3U2U A;  4HUR A;  2P6W A;  4FRO A;  1FGX A;  2VSI A;  1ZI1 A;  3ZLL A;  2NXV A;  1KGQ A;  3SXD A;  1ON6 A;  2WLD A;  3V0L A;  1LXA A;  4E1K A;  2JCO A;  2AH9 A;  2WLE A;  2X65 A;  1YP2 A;  2YES A;  3JQY A;  5C48 A;  1VH1 A;  2AEC A;  2D7R A;  1OMZ A;  2W0V A;  4EAB A;  4NAI A;  2WLG A;  1XHB A;  3TZT A;  1Z90 A;  2W0W A;  2RIJ A;  4MIX A;  3GVD A;  1R82 A;  3U0Y A;  2FYC B;  4Y7U A;  5C47 A;  2QIV X;  3SXA A;  4IRP A;  4M4K A;  2JF3 A;  4HO5 A;  4K6R A;  1ZHJ A;  3V0M A;  1GX4 A;  5CMH A;  1Z2F A;  1FG5 N;  3V0N A;  2YQH A;  3FOQ A;  1ZDF A;  2RIX A;  3VBL A;  5C3D A;  5L6S A;  4BQH A;  2PA4 A;  3I3X A;  3U2V A;  4MYO A;  1R7V A;  1OCX A;  2Y4M A;  2YC3 A;  5CMF X;  1MR9 A;  5D92 A;  3EEV A;  1FRW A;  1ZCT A;  4B2W A;  1N4I A;  4M98 A;  4N6B A;  5HS2 A;  1EWW A;  4G3Q A;  3PMO A;  2RJ8 A;  4HO8 A;  4YS8 A;  3SXE A;  4D0Z A;  3NZ2 A;  1VZT A;  3SRT A;  3SXC A;  1QG8 A;  1H5S A;  3IOH A;  4NAL A;  1E5K A;  4M2B A;  2WVK A;  3R3I A;  3SXB A;  3F1C A;  3SUC A;  2VHE A;  5DDV A;  5EIY A;  2VK9 A;  1VGZ A;  5AJN A;  1R7X A;  4FIX A;  1G97 A;  1WSZ A;  2OEF A;  1R81 A;  2QKX A;  3IOI A;  1H5S C;  2P2O A;  2YQS A;  4B4B A;  5DEM A;  2AQ9 A;  1TW5 A;  3I0K A;  3PKP A;  3TK8 A;  5C4D A;  4ECM A;  1LZI A;  1KWS A;  5E3P A;  5C4B A;  3R5A A;  3OW5 A;  4HCQ A;  1H7E A;  1NF5 B;  1TVY A;  2Q4J A;  3R2W A;  3I3A A;  2XWN A;  2P72 A;  4HZD A;  4HUS A;  2XWL A;  4N6A A;  1W77 A;  3OC9 A;  1J2Z A;  1G8O A;  1MP4 A;  2VS4 A;  2OI5 A;  1LZJ A;  2J0A A;  2WLF A;  3Q4S A;  2OI6 A;  4ISX A;  3GQA A;  4J09 A;  4LW6 A;  4Y7T A;  4B5B A;  5C4E A;  2WVL A;  4Y9X A;  2QIA A;  5D91 A;  4B2X A;  4N69 A;  1GWW A;  1JVG A;  4E75 A;  4Y7G A;  3T7O A;  2PGY A;  3QVB A;  1FR9 A;  1H5R A;  1ZCV A;  3T7N A;  3TWD A;  3R1W A;  3ST8 A;  5AFU U;  2A8U A;  5CQM X;  2I7B A;  1XHD A;  1GX0 A;  3VBK A;  1ZJO A;  1G93 A;  4ARW A;  1H5S B;  3T7M A;  1QRG A;  3OU9 A;  1VGU A;  3CU0 A;  3IOJ A;  4M9C A;  1ZJ0 A;  3OTZ A;  1QRL A;  4FCE A;  3R8Y A;  3F1X A;  1XAT A;  2JCL A;  2AGD A;  3D8V A;  2FYD B;  5C49 A;  3PNN A;  1WT2 A;  2C0N A;  4IHH A;  1H7L A;  1S4N A;  3OGZ A;  4C2S A;  2YCM A;  3OH2 A;  1S4O A;  3JUJ A;  4AAW A;  1LVW A;  4D0T A;  4EEO A;  3BXY A;  2AM4 A;  2RJ5 A;  1LL0 A;  1H4E A;  1YRO B;  4DEC A;  3CJ8 A;  2WVM A;  2X5Z A;  5CMI A;  2FYB A;  1KHR A;  3OH3 A;  5L6V A;  4Y7V A;  4E6T A;  1MR7 A;  2AM5 A;  1OMX A;  1V67 A;  4EA9 A;  1R80 A;  4NAN A;  2I5E A;  4FRQ A;  4KC4 A;  4EE5 A;  3RMW A;  3SPT A;  1G3L A;  1FWY A;  2AE7 A;  3U0X A;  2VXL A;  4G3P A;  5E3R A;  4M28 A;  4BMA A;  3N9W A;  5I1F A;  3V0P A;  3MQG A;  4B3U A;  5FU8 A;  5DEP A;  2DPW A;  2XMH A;  3Q1X A;  3I0D A;  1KK6 A;  5FU0 A;  3U2W A;  5F42 A;  4ASJ A;  3SX3 A;  5IDT A;  2NPO A;  1JV1 A;  1NMM B;  3SX5 A;  1V3W A;  4Q7C A;  2VD4 A;  5C4F A;  2ZU8 A;  3K8D A;  2V0H A;  5EJZ A;  1W57 A;  1H5R B;  1V84 A;  3OH0 A;  4NAK A;  1G2V A;  3CGX A;  1MRL A;  4HO2 A;  3CKJ A;  4MND A;  4P00 A;  1JYK A;  2V0I A;  3USR A;  3V8Z A;  3MQH A;  4M2A A;  3IXC A;  2ZU9 A;  1QGS A;  3V90 A;  1R7T A;  3CKO A;  3FSC A;  2JCK A;  3CKN A;  4H7O A;  5FTS A;  2FY7 A;  2IUA A;  3ZGF A;  3FSX A;  4D11 A;  5CQP A;  2V0K A;  1KK5 A;  1ON8 A;  3R3R A;  1O7O A;  3KIA A;  1H5S D;  4HO3 A;  1VIC A;  3GUE A;  1YP3 A;  2ICY A;  2V0J A;  1SSM A;  3JUK A;  1IIM A;  2APC A;  5C1L A;  3FS8 A;  4D11 C;  3ECT A;  4CJ8 A;  2RIZ A;  5AJO A;  1ZJ3 A;  4Y63 A;  5C4C A;  3V0O A;  4M99 A;  3SX8 A;  3FSY A;  4AYL A;  3C8V A;  5ADX V;  3E26 A;  1FOA A;  4DDZ A;  4KPX A;  1LL3 A;  5CMJ A;  3SXG A;  5IFY A;  4EVW A;  2WLC A;  2O1G A;  5FTV A;  5FYE A;  4KNR A;  1ZIZ A;  2BO7 A;  4D48 A;  4FRP A;  4HZC A;  3OTM A;  4DE7 A;  1VM8 A;  5FUH A;  4Y64 A;  1HJJ A;  4GBP A;  3DUV A;  1ZJP A;  2Y6P A;  1O23 B;  3VBJ A;  3U2X A;  2Y4J A;  2E3D A;  1SS9 A;  1KRU A;  2BO8 A;  4R36 A;  1FR8 A;  1WT0 A;  4EE3 A;  2QGI A;  4LW3 A;  3OAM A;  4DCL A;  1H3M A;  3IGJ A;  1YP4 A;  2RIY A;  1M8N A;  2WAW A;  1QRF A;  1QGQ A;  2A8W A;  5C36 A;  2D7I A;  1NKH B;  3HL3 A;  4O6M A;  5E3Q A;  4L41 C;  4G87 A;  3VBN A;  1SSQ A;  3R0S A;  1O7Q A;  3Q80 A;  4FCU A;  1KGT A;  2GGQ A;  3V0Q A;  4AYJ A;  1LZ0 A;  1LZ7 A;  1H7Q A;  4R37 A;  2JF2 A;  4Y62 A;  1G95 A;  3BSY A;  5C1G A;  5C38 A;  1JYL A;  4UEG A;  3GQ9 A;  5C3B A;  3VBI A;  3RMV A;  2MZB A;  4FRB A;  2I5K A;  1G9R A;  1GQC A;  5J49 A;  1VGT A;  2XWM A;  1SST A;  1ZI5 A;  4IHF A;  1G23 A;  3FSB A;  4B4M A;  1EZI A;  1NWG B;  3I0E A;  3P47 A;  3I0C A;  1H7T A;  2FFU A;  1NQI B;  1QRM A;  1TW1 A;  4EA7 A;  3DK5 A;  2RJ4 A;  1FGG A;  4KXO A;  4IRQ A;  3KWC A;  1GA8 A;  2OI7 A;  3CKQ A;  2VFZ A;  2VS5 A;  5CQL X;  3RSB A;  1H4D A;  2FYA A;  4P02 A;  3R5D A;  3EG4 A;  4E6U A;  4FQW A;  1T3D A;  2TDT A;  2D0J A;  2XAT A;  5C3A A;  3ZLK A;  1THJ A;  1K4V A;  1O0R A;  2Y4L A;  1KRR A;  1KRV A;  4AC3 A;  2OEG A;  3DJ4 A;  1VPA A;  1HJL A;  1JV3 A;  1FZW A;  2J0B A;  1PZY B;  1ZJ1 A;  2CU2 A;  2VXM A;  3MC4 A;  3V8Y A;  4FRM A;  1HM0 A;  2IU8 A;  3I0L A;  1QWJ A;  4KC1 A;  5C8R A;  4EGG A;  4CVH A;  5IDS A;  3V4E A;  4HO0 A;  3TV0 A;  1H7G A;  4MFG A;  3USQ A;  5BXC A;  2PX7 A;  1HM9 A;  3F1Y A;  2VSH A;  4KRV A;  1FXJ A;  3OH4 A;  4Y6U A;  4Y6N A;  5CQN X;  3GOS A;  5CMG X;  2GGO A;  3VNP A;  1JVD A;  3GQ8 A;  5U2K A;  1HM8 A;  3R5C A;  2AES A;  3T57 A;  3JTJ A; 
#chains in the Genus database with same CATH homology
 1ZI3 A;  1I52 A;  4EEM A;  2BO4 A;  3VBM A;  3TQD A;  2UX8 A;  4KT7 A;  3ZGG A;  3O3P A;  3DHO A;  3I0H A;  5ADX U;  1WT3 A;  4CJB A;  1R7U A;  3BSS A;  3OH1 A;  5DDT A;  1W55 A;  3VBP A;  2X5S A;  3V91 A;  3POL A;  1QQ0 A;  2IC7 A;  1VZX A;  4HO9 A;  2Y4K A;  4EEA A;  3TIO A;  1H4C A;  4CJC A;  3BFP A;  5AJP A;  4MZU A;  1GWV A;  2VS3 A;  1MP5 A;  3E25 A;  4JIS A;  1FXO A;  1S80 A;  4J18 A;  1LL2 A;  1OQM B;  4EQY A;  4KC2 A;  1V82 A;  2P73 A;  3P1B A;  4FRL A;  3BSW A;  4AA7 A;  2RJ9 A;  3BRK X;  3HJJ A;  3SX7 A;  1QRE A;  4EA8 A;  1ZJ2 A;  1V83 A;  1H7H A;  2RJ1 A;  3I0F A;  4JD0 A;  4B42 A;  4FRD A;  3I0J A;  4FRA A;  4HOC A;  1WT1 A;  2Y7A A;  4KPZ A;  1TDT A;  5CQO A;  4N27 A;  3OUP A;  4HO4 A;  1G1L A;  2FFV A;  5JQQ A;  2O1F A;  2RJ6 A;  2WGZ A;  2IU9 A;  1NHE B;  2YQJ A;  3K8E A;  5FV9 A;  1ZCU A;  2QH5 A;  2AM3 A;  2WEE A;  1H5T A;  1G0R A;  2RIT A;  1XZ6 A;  4O6N A;  1INI A;  3PKQ A;  5C1H A;  3OKR A;  1FO9 A;  1MC3 A;  2XME A;  2WE9 A;  3FTT A;  1IIN A;  2RJ7 A;  4B4G A;  1MP3 A;  2E8B A;  3D5N A;  3LW6 A;  3Q7U A;  1HV9 A;  4FIY A;  1KQA A;  3I0I X;  4KQL A;  2YQC A;  3U2T A;  4IHG A;  2ICX A;  4ASY A;  2X60 A;  4Y7F A;  1INJ A;  1KK4 A;  4ZDQ A;  2YC5 A;  3TDT A;  1H7F A;  3ZF8 A;  1GQ9 A;  2JCJ A;  3HSQ A;  2BO6 A;  3R5B A;  1ZDG A;  2RJ0 A;  3TIS A;  1ZCY A;  2O1H A;  1WVC A;  5AFU V;  2FKO A;  1PZT A;  3FWW A;  3KWD A;  1VGW A;  3NGW A;  2ZU7 A;  1TZF A;  1ZI4 A;  5EJ1 A;  1VZU A;  4EE4 A;  2Z87 A;  3I0G A;  3CKV A;  4G3S A;  1FO8 A;  4EAA A;  2V0L A;  5DG3 A;  4XWI A;  4FRE A;  1S4P A;  1EYR A;  3EH0 A;  2Z86 A;  2PGV A;  4HO6 A;  4MYB A;  3BCV A;  4FRH A;  4KNX A;  4E79 A;  1R7Y A;  1VH3 A;  4EEG A;  3KWE A;  3EE5 A;  3D98 A;  1H5T B;  4HG6 A;  4R7P A;  3U2U A;  4HUR A;  2P6W A;  4FRO A;  1FGX A;  2VSI A;  1ZI1 A;  3ZLL A;  2NXV A;  1KGQ A;  3SXD A;  1ON6 A;  2WLD A;  3V0L A;  1LXA A;  4E1K A;  2JCO A;  2AH9 A;  2WLE A;  2X65 A;  1YP2 A;  2YES A;  3JQY A;  5C48 A;  1VH1 A;  2AEC A;  2D7R A;  1OMZ A;  2W0V A;  4EAB A;  4NAI A;  2WLG A;  1XHB A;  3TZT A;  1Z90 A;  2W0W A;  2RIJ A;  4MIX A;  3GVD A;  1R82 A;  3U0Y A;  2FYC B;  4Y7U A;  5C47 A;  2QIV X;  3SXA A;  4IRP A;  4M4K A;  2JF3 A;  4HO5 A;  4K6R A;  1ZHJ A;  3V0M A;  1GX4 A;  5CMH A;  1FG5 N;  3V0N A;  2YQH A;  3FOQ A;  1ZDF A;  2RIX A;  3VBL A;  5C3D A;  5L6S A;  4BQH A;  2PA4 A;  3I3X A;  3U2V A;  4MYO A;  1R7V A;  1OCX A;  2Y4M A;  2YC3 A;  5CMF X;  1MR9 A;  5D92 A;  3EEV A;  1FRW A;  1ZCT A;  4B2W A;  4M98 A;  4N6B A;  5HS2 A;  4G3Q A;  3PMO A;  2RJ8 A;  4HO8 A;  4YS8 A;  3SXE A;  4D0Z A;  3NZ2 A;  1VZT A;  3SRT A;  3SXC A;  1QG8 A;  1H5S A;  3IOH A;  4NAL A;  1E5K A;  4M2B A;  2WVK A;  3R3I A;  3SXB A;  3F1C A;  2VHE A;  5DDV A;  5EIY A;  2VK9 A;  1VGZ A;  5AJN A;  1R7X A;  4FIX A;  1G97 A;  1WSZ A;  2OEF A;  1R81 A;  2QKX A;  3IOI A;  1H5S C;  2P2O A;  2YQS A;  4B4B A;  5DEM A;  2AQ9 A;  1TW5 A;  3I0K A;  3PKP A;  3TK8 A;  5C4D A;  4ECM A;  1LZI A;  1KWS A;  5E3P A;  5C4B A;  3R5A A;  3OW5 A;  4HCQ A;  1H7E A;  1NF5 B;  1TVY A;  2Q4J A;  3R2W A;  3I3A A;  2XWN A;  2P72 A;  4HZD A;  4HUS A;  2XWL A;  4N6A A;  1W77 A;  3OC9 A;  1J2Z A;  1G8O A;  1MP4 A;  2VS4 A;  2OI5 A;  1LZJ A;  2J0A A;  2WLF A;  3Q4S A;  2OI6 A;  4ISX A;  4J09 A;  4LW6 A;  4Y7T A;  4B5B A;  5C4E A;  2WVL A;  4Y9X A;  2QIA A;  5D91 A;  4B2X A;  4N69 A;  1GWW A;  1JVG A;  4E75 A;  4Y7G A;  3T7O A;  2PGY A;  3QVB A;  1FR9 A;  1H5R A;  1ZCV A;  3T7N A;  3TWD A;  3R1W A;  3ST8 A;  5AFU U;  2A8U A;  5CQM X;  2I7B A;  1XHD A;  1GX0 A;  3VBK A;  1ZJO A;  1G93 A;  4ARW A;  1H5S B;  3T7M A;  1QRG A;  3OU9 A;  1VGU A;  3CU0 A;  3IOJ A;  4M9C A;  1ZJ0 A;  3OTZ A;  1QRL A;  4FCE A;  3R8Y A;  3F1X A;  1XAT A;  2JCL A;  2AGD A;  3D8V A;  2FYD B;  5C49 A;  3PNN A;  1WT2 A;  2C0N A;  4IHH A;  1H7L A;  1S4N A;  3OGZ A;  4C2S A;  2YCM A;  3OH2 A;  1S4O A;  3JUJ A;  4AAW A;  1LVW A;  4D0T A;  4EEO A;  3BXY A;  2AM4 A;  2RJ5 A;  1LL0 A;  1H4E A;  1YRO B;  4DEC A;  3CJ8 A;  2WVM A;  2X5Z A;  5CMI A;  2FYB A;  1KHR A;  5L6V A;  3OH3 A;  4Y7V A;  4E6T A;  1MR7 A;  2AM5 A;  1OMX A;  1V67 A;  4EA9 A;  1R80 A;  4NAN A;  2I5E A;  4FRQ A;  4KC4 A;  4EE5 A;  3RMW A;  3SPT A;  1G3L A;  1FWY A;  2AE7 A;  3U0X A;  2VXL A;  4G3P A;  5E3R A;  4M28 A;  4BMA A;  3N9W A;  5I1F A;  3V0P A;  3MQG A;  4B3U A;  5FU8 A;  5DEP A;  2DPW A;  2XMH A;  3Q1X A;  3I0D A;  1KK6 A;  5FU0 A;  3U2W A;  5F42 A;  4ASJ A;  3SX3 A;  5IDT A;  2NPO A;  1JV1 A;  1NMM B;  3SX5 A;  1V3W A;  4Q7C A;  2VD4 A;  5C4F A;  2ZU8 A;  3K8D A;  2V0H A;  5EJZ A;  1W57 A;  1H5R B;  1V84 A;  3OH0 A;  4NAK A;  1G2V A;  3CGX A;  1MRL A;  4HO2 A;  3CKJ A;  4MND A;  4P00 A;  1JYK A;  2V0I A;  3USR A;  3V8Z A;  3MQH A;  4M2A A;  3IXC A;  2ZU9 A;  1QGS A;  3V90 A;  1R7T A;  3CKO A;  3FSC A;  2JCK A;  3CKN A;  4H7O A;  5FTS A;  2FY7 A;  2IUA A;  3ZGF A;  3FSX A;  4D11 A;  5CQP A;  2V0K A;  1KK5 A;  1ON8 A;  3R3R A;  1O7O A;  3KIA A;  1H5S D;  4HO3 A;  1VIC A;  3GUE A;  1YP3 A;  2ICY A;  2V0J A;  1SSM A;  3JUK A;  1IIM A;  2APC A;  5C1L A;  3FS8 A;  4D11 C;  3ECT A;  4CJ8 A;  2RIZ A;  5AJO A;  1ZJ3 A;  4Y63 A;  5C4C A;  3V0O A;  4M99 A;  3SX8 A;  3FSY A;  4AYL A;  3C8V A;  5ADX V;  3E26 A;  1FOA A;  4DDZ A;  4KPX A;  1LL3 A;  5CMJ A;  3SXG A;  5IFY A;  4EVW A;  2WLC A;  2O1G A;  5FTV A;  5FYE A;  4KNR A;  1ZIZ A;  2BO7 A;  4D48 A;  4FRP A;  4HZC A;  3OTM A;  4DE7 A;  1VM8 A;  5FUH A;  4Y64 A;  1HJJ A;  4GBP A;  3DUV A;  1ZJP A;  2Y6P A;  1O23 B;  3VBJ A;  3U2X A;  2Y4J A;  2E3D A;  1SS9 A;  1KRU A;  2BO8 A;  4R36 A;  1FR8 A;  1WT0 A;  4EE3 A;  2QGI A;  4LW3 A;  3OAM A;  4DCL A;  1H3M A;  3IGJ A;  1YP4 A;  2RIY A;  2WAW A;  1QRF A;  1QGQ A;  2A8W A;  5C36 A;  2D7I A;  1NKH B;  3HL3 A;  4O6M A;  5E3Q A;  4L41 C;  4G87 A;  3VBN A;  1SSQ A;  3R0S A;  1O7Q A;  3Q80 A;  4FCU A;  1KGT A;  2GGQ A;  3V0Q A;  4AYJ A;  1LZ0 A;  1LZ7 A;  1H7Q A;  4R37 A;  2JF2 A;  4Y62 A;  1G95 A;  3BSY A;  5C1G A;  5C38 A;  1JYL A;  4UEG A;  5C3B A;  3VBI A;  3RMV A;  2MZB A;  4FRB A;  2I5K A;  1G9R A;  1GQC A;  5J49 A;  1VGT A;  2XWM A;  1SST A;  1ZI5 A;  4IHF A;  1G23 A;  3FSB A;  4B4M A;  1EZI A;  1NWG B;  3I0E A;  3P47 A;  3I0C A;  1H7T A;  2FFU A;  1NQI B;  1QRM A;  1TW1 A;  4EA7 A;  3DK5 A;  2RJ4 A;  1FGG A;  4KXO A;  4IRQ A;  3KWC A;  1GA8 A;  2OI7 A;  3CKQ A;  2VFZ A;  2VS5 A;  5CQL X;  3RSB A;  1H4D A;  2FYA A;  4P02 A;  3R5D A;  3EG4 A;  4E6U A;  4FQW A;  1T3D A;  2TDT A;  2D0J A;  2XAT A;  5C3A A;  3ZLK A;  1THJ A;  1K4V A;  1O0R A;  2Y4L A;  1KRR A;  1KRV A;  4AC3 A;  2OEG A;  3DJ4 A;  1VPA A;  1HJL A;  1JV3 A;  1FZW A;  2J0B A;  1PZY B;  1ZJ1 A;  2CU2 A;  2VXM A;  3MC4 A;  3V8Y A;  4FRM A;  1HM0 A;  2IU8 A;  3I0L A;  1QWJ A;  4KC1 A;  5C8R A;  4EGG A;  4CVH A;  5IDS A;  3V4E A;  4HO0 A;  3TV0 A;  1H7G A;  4MFG A;  3USQ A;  5BXC A;  2PX7 A;  1HM9 A;  3F1Y A;  2VSH A;  4KRV A;  1FXJ A;  3OH4 A;  4Y6U A;  4Y6N A;  5CQN X;  3GOS A;  5CMG X;  2GGO A;  3VNP A;  1JVD A;  5U2K A;  1HM8 A;  3R5C A;  2AES A;  3T57 A;  3JTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...