4K6RA

Crystal structure of glmu in complex with atp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
469
structure length
469
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title GlmU (N-acetylglucosamine-1-phosphate uridyltransferase) bound to three magnesium ions and ATP at the active site
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 176
structure length 469
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4k6rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4k6rA01
4KQLA 3P47A 1H5TB 3CKOA 5C48A 1OMXA 2X5ZA 4M2AA 4EEGA 5CQOA 3VBIA 5C38A 1WSZA 3DJ4A 1V67A 3OTMA 1SSQA 5C3BA 1LL3A 2I7BA 3I0GA 4H7OA 4HURA 3P1BA 2FFVA 4E79A 1T3DA 2ZU8A 4FQWA 2RIYA 2Y4JA 4KRVA 4Y64A 1G97A 2GGOA 2AE7A 1QRLA 4MZUA 3CKJA 1HM0A 2PA4A 2RJ9A 3USQA 1KQAA 2V0LA 3FSYA 3VBJA 1SS9A 1NKHB 1HJLA 3E26A 3U2VA 3BSWA 1G93A 2BO7A 2PGYA 2X5SA 2A8UA 3OU9A 4FRDA 1FO9A 3TIOA 2YC3A 2D7RA 3KWDA 4KNRA 1O7QA 1VICA 3IOIA 4G3SA 1MRLA 3O3PA 3KWEA 4N6BA 4Y7VA 3V0LA 5CMJA 1QRFA 2RJ6A 2P6WA 4L41C 4EEAA 3CKNA 1GWVA 3TZTA 2WEEA 1KGQA 3OGZA 3SXEA 2XWNA 5CMFX 3USRA 1EZIA 4IHFA 1GQCA 3U2WA 4M98A 4Y63A 3OH4A 2QGIA 3V0NA 3KWCA 4NAKA 3R5CA 1VGTA 4IRQA 5C4CA 4E1KA 4KC4A 3U0YA 1VZTA 4Y62A 3I0CA 4D0ZA 1NQIB 1YROB 1G2VA 4EA7A 1WT3A 4JD0A 3BXYA 1H4DA 1NWGB 4MYBA 5C4DA 2QIAA 1R7YA 3SX3A 1R82A 3SXBA 2WLGA 3PKPA 5C4EA 4EQYA 5FUHA 2FYDB 1FR8A 2E8BA 2AGDA 3VBKA 1LVWA 3PMOA 2RJ8A 1FRWA 3D5NA 1ZDGA 4ASJA 4HO0A 4EA8A 4K6RA 1MC3A 3RMVA 2NPOA 3V0OA 5AJPA 4MNDA 1KK4A 1MP4A 1QRGA 2Y7AA 2Y4KA 1QQ0A 4GBPA 4FCUA 3V0MA 1WT0A 1KRVA 2AECA 3LW6A 1H5RA 4P00A 3HL3A 2ZU9A 2QKXA 1K4VA 3ZGGA 4AA7A 1ZJPA 2IU9A 3F1YA 1R7TA 2FYBA 4ASYA 4KT7A 2TDTA 1Z90A 4KNXA 5FTSA 1ZCYA 2AM4A 3JUJA 2RIZA 1FGXA 3EH0A 1ZI5A 3BFPA 2YCMA 3K8EA 4NAIA 5C47A 3VBPA 1KRRA 1YP3A 4R36A 1S4OA 1H5RB 1R80A 1TW1A 2Y6PA 3CU0A 4FREA 5AFUU 1INJA 2AM5A 3R1WA 3EE5A 1LZ0A 3SPTA 4N27A 4B4GA 2P72A 1JV1A 4XWIA 2W0WA 1H7EA 2A8WA 3ECTA 5C4BA 5AJOA 3ZLLA 4G3PA 4B4BA 2OI6A 5CMIA 4D11C 1INIA 2RITA 1S4NA 2JCKA 3FOQA 1GQ9A 3DUVA 2JCLA 5AFUV 1OMZA 1FZWA 4IHHA 1KK6A 3OH1A 5I1FA 1W57A 3I0FA 4AYLA 1JVGA 1E5KA 5DDTA 2RJ1A 3R8YA 3VBMA 4HZCA 1H7LA 4LW6A 1XHBA 5CQPA 3TV0A 1FGGA 4B5BA 2XMHA 4B2XA 1XATA 2YQHA 4Y9XA 1IIMA 5C8RA 1H5SC 1ZJ0A 1EYRA 1ZIZA 4DDZA 2VS4A 3POLA 3SX8A 1ZCTA 2QH5A 3R3RA 3PNNA 1V84A 1ZI4A 3Q1XA 2WVMA 2IUAA 4FRQA 1LL2A 3V0QA 2RIXA 3KIAA 1HM9A 4FRHA 3D8VA 3OH0A 5L6SA 1ON6A 2OEFA 1MR9A 3OAMA 1FWYA 3ZGFA 2WVLA 2X65A 4YS8A 1VH1A 1H4CA 1O0RA 3DK5A 1XHDA 2BO6A 2VS5A 5IDTA 1QRMA 1GWWA 3CGXA 2AH9A 4ARWA 4FRBA 3SXDA 2BO8A 2WGZA 2YC5A 3T7NA 2V0HA 4J18A 4M99A 3FWWA 1V83A 3R0SA 2XWLA 4B3UA 2P73A 4CJCA 1ZJOA 4N6AA 1R7XA 1J2ZA 4BQHA 1FR9A 3I0LA 2OEGA 3OH3A 2YQJA 3QVBA 5FTVA 5CMHA 4M28A 3R5DA 1IINA 1S80A 4LW3A 1W77A 3TK8A 3VBNA 3I3AA 1MR7A 3IGJA 3TDTA 2JCJA 5DEMA 1H5SD 1ZDFA 3BSYA 1H7GA 1ZJ3A 4KC1A 2WLDA 1SSMA 2JF2A 3I0JA 1HV9A 2RIJA 1KHRA 4DECA 1XZ6A 1ZCVA 3I3XA 1VM8A 1G9RA 2IU8A 4AC3A 2WE9A 1OQMB 1R81A 2RJ5A 3HSQA 4EGGA 1VZUA 2VSIA 4Y6UA 2FYCB 1H3MA 2X60A 1VH3A 2FY7A 4IRPA 3GVDA 2IC7A 1GX0A 4FRPA 3SXCA 4EVWA 4M4KA 2RJ7A 2Y4LA 3TISA 3FS8A 1GA8A 4HO9A 3MQHA 3OUPA 1JYLA 1FO8A 1YP2A 1MP5A 4UEGA 5C4FA 1FOAA 1ZI1A 2XWMA 3CKQA 3CKVA 4NANA 4HOCA 1SSTA 2APCA 4Y7FA 3V91A 5EIYA 1O7OA 2CU2A 1H7HA 4HO5A 3V8ZA 3OTZA 3RMWA 2V0KA 4DE7A 3F1XA 1ZCUA 4KXOA 4CVHA 4M9CA 3U2UA 4MYOA 3T7MA 3R5AA 4EE4A 3N9WA 2Z86A 3T57A 3SRTA 2DPWA 4FRAA 2GGQA 3I0EA 4ZDQA 4DCLA 4G87A 2WVKA 4EE5A 4Y7UA 2FKOA 2O1FA 1VZXA 2UX8A 3ST8A 4AAWA 2QIVX 4KPXA 1H7TA 4HO3A 3MQGA 4KC2A 1G23A 3SX5A 1ZJ1A 1S4PA 3V90A 2O1HA 1G95A 4HUSA 3T7OA 3U2TA 1R7VA 1H7QA 5IFYA 2OI7A 1WT1A 1LXAA 3OC9A 5J49A 1ON8A 2NXVA 4E6TA 5U2KA 2MZBA 2JF3A 1KGTA 4M2BA 5BXCA 5IDSA 1VGZA 1KWSA 1G1LA 3BSSA 4KPZA 1FG5N 2D0JA 2Z87A 3I0DA 1G3LA 1VPAA 1QG8A 5E3RA 4Y7GA 3IXCA 3ZF8A 3E25A 4D48A 1FXOA 5DEPA 3V8YA 5C1HA 2Y4MA 4E75A 1G0RA 1I52A 1LL0A 3IOJA 4HO2A 2AM3A 4B4MA 4CJBA 1OCXA 2XMEA 4EAAA 5DG3A 1R7UA 3Q4SA 4P02A 1ZI3A 3SXGA 3FTTA 3JQYA 4ECMA 3VBLA 5C3DA 3FSCA 2RJ0A 5CQLX 1QREA 2ICXA 3NZ2A 4HO4A 1PZYB 1LZIA 2Q4JA 1THJA 3Q80A 3HJJA 3GUEA 1V3WA 1WT2A 3V4EA 2O1GA 5CMGX 5FU8A 3JTJA 1NF5B 3BCVA 2P2OA 1JYKA 4D0TA 5FU0A 3OKRA 3SX7A 1TDTA 2WLEA 3FSXA 5L6VA 4FCEA 2YQCA 5EJ1A 3OH2A 2E3DA 3D98A 4EA9A 1H7FA 1O23B 4NALA 3R5BA 4CJ8A 4IHGA 1H4EA 3RSBA 3OW5A 5C36A 5DDVA 2AQ9A 3TWDA 3I0IX 2WLFA 5C1LA 1HJJA 1TW5A 4D11A 3IOHA 4AYJA 2AESA 4FRLA 1QWJA 3BRKX 3EG4A 4HZDA 1LZ7A 3EEVA 4BMAA 4HO8A 1VGWA 3CJ8A 3NGWA 4J09A 4JISA 2YQSA 1MP3A 3K8DA 3JUKA 1JVDA 2D7IA 5HS2A 4MFGA 1GX4A 2XATA 1TZFA 4B2WA 2YESA 1LZJA 2OI5A 5E3PA 3PKQA 5C3AA 5C1GA 4EEOA 3I0HA 4C2SA 4R37A 2VSHA 3DHOA 1VGUA 3MC4A 5CQMX 1YP4A 4FROA 4EEMA 5ADXU 2I5KA 3GOSA 4G3QA 4HCQA 1H5SA 2WLCA 3C8VA 4HG6A 1QGQA 2VHEA 1JV3A 1TVYA 2ZU7A 4B42A 2I5EA 3V0PA 2BO4A 3FSBA 1QGSA 2VS3A 3R2WA 1V82A 4EABA 1HM8A 1KK5A 2V0JA 2FFUA 2FYAA 1ZJ2A 3R3IA 3Q7UA 1FXJA 1W55A 5FYEA 4R7PA 3SXAA 1NHEB 1PZTA 1H5TA 5F42A 2VFZA 2ICYA 3VNPA 4HO6A 5ADXV 2VXMA 5AJNA 3U2XA 4ISXA 5CQNX 1H5SB 4Y6NA 5FV9A 5JQQA 4E6UA 2PGVA 1G8OA 2VXLA 2PX7A 3I0KA 2V0IA 4FRMA 2WAWA 5C49A 1WVCA 5EJZA 3TQDA 1ZHJA 3F1CA 1NMMB 2JCOA 5E3QA 4N69A 4EE3A 4Y7TA 1KRUA 2RJ4A 2VD4A 3ZLKA 3U0XA 2W0VA
chains in the Genus database with same CATH superfamily
4KQLA 3P47A 1H5TB 3CKOA 5C48A 1OMXA 2X5ZA 4M2AA 4EEGA 5CQOA 3VBIA 5C38A 1WSZA 3DJ4A 1V67A 3OTMA 1SSQA 5C3BA 1LL3A 2I7BA 3I0GA 4H7OA 4HURA 3P1BA 2FFVA 4E79A 1T3DA 2ZU8A 4FQWA 2RIYA 2Y4JA 4KRVA 4Y64A 1G97A 2GGOA 2AE7A 1QRLA 4MZUA 3CKJA 1HM0A 2PA4A 4MIXA 2RJ9A 3USQA 1KQAA 2V0LA 3FSYA 3VBJA 1SS9A 1NKHB 1HJLA 1Z2FA 3E26A 1L0SA 3U2VA 3BSWA 1G93A 2BO7A 2PGYA 2X5SA 2A8UA 3OU9A 4FRDA 4O6MA 1FO9A 3TIOA 2YC3A 2D7RA 3KWDA 4KNRA 1O7QA 1VICA 3IOIA 4G3SA 1MRLA 3O3PA 3KWEA 4N6BA 4Y7VA 3V0LA 5CMJA 1QRFA 2RJ6A 2P6WA 3SUCA 4L41C 4EEAA 3CKNA 1GWVA 3TZTA 2WEEA 3GQ9A 1KGQA 3OGZA 3SXEA 2XWNA 5CMFX 3USRA 1EZIA 4IHFA 1GQCA 3U2WA 4M98A 4Y63A 3OH4A 2QGIA 3V0NA 3KWCA 4NAKA 3R5CA 1VGTA 4IRQA 5C4CA 4E1KA 4KC4A 3U0YA 1VZTA 4Y62A 3I0CA 3GQ7A 4D0ZA 1NQIB 1YROB 1G2VA 4EA7A 1WT3A 4JD0A 3BXYA 1H4DA 1NWGB 4MYBA 5C4DA 2QIAA 1R7YA 3SX3A 1R82A 3SXBA 2WLGA 3PKPA 5C4EA 4EQYA 5FUHA 2FYDB 1FR8A 2E8BA 2AGDA 3VBKA 1LVWA 3PMOA 2RJ8A 1FRWA 3D5NA 1ZDGA 4ASJA 4HO0A 4EA8A 4K6RA 4FIYA 1MC3A 3RMVA 2NPOA 3V0OA 5AJPA 4MNDA 1KK4A 1MP4A 1QRGA 2Y7AA 2Y4KA 1QQ0A 4GBPA 4FCUA 3V0MA 1WT0A 1KRVA 2AECA 3LW6A 1H5RA 4P00A 3HL3A 2ZU9A 2QKXA 1K4VA 3ZGGA 4AA7A 1ZJPA 2IU9A 3F1YA 1R7TA 2FYBA 4ASYA 4KT7A 2TDTA 1Z90A 4KNXA 5FTSA 1ZCYA 2AM4A 3JUJA 2RIZA 1FGXA 3EH0A 1ZI5A 3BFPA 2YCMA 3K8EA 4NAIA 5C47A 3VBPA 1KRRA 1YP3A 4R36A 1S4OA 1H5RB 1R80A 1TW1A 2Y6PA 3CU0A 4FREA 5AFUU 1INJA 2AM5A 3R1WA 3EE5A 1LZ0A 3SPTA 4N27A 4B4GA 2P72A 1JV1A 4XWIA 2W0WA 1H7EA 2A8WA 3ECTA 5C4BA 5AJOA 3ZLLA 4G3PA 4B4BA 2OI6A 5CMIA 4D11C 1INIA 2RITA 1S4NA 2JCKA 3FOQA 1GQ9A 3DUVA 2JCLA 5AFUV 1OMZA 1FZWA 4IHHA 1KK6A 3OH1A 5I1FA 1W57A 3I0FA 4AYLA 1JVGA 1E5KA 5DDTA 2RJ1A 3R8YA 3VBMA 4HZCA 1H7LA 4LW6A 1XHBA 5CQPA 3TV0A 1FGGA 4B5BA 2XMHA 4B2XA 1XATA 2YQHA 4Y9XA 1IIMA 5C8RA 1H5SC 1ZJ0A 1EYRA 1ZIZA 4DDZA 2VS4A 3POLA 3SX8A 1ZCTA 2QH5A 3R3RA 3PNNA 1V84A 1ZI4A 3Q1XA 2WVMA 2IUAA 4FRQA 1LL2A 5D91A 3V0QA 2RIXA 3KIAA 1HM9A 4FRHA 3D8VA 3OH0A 5L6SA 1ON6A 2OEFA 1MR9A 3OAMA 1FWYA 3ZGFA 2WVLA 2X65A 4YS8A 1VH1A 1H4CA 1O0RA 3DK5A 1XHDA 2BO6A 2VS5A 5IDTA 1QRMA 1GWWA 3CGXA 2AH9A 4ARWA 4FRBA 3SXDA 2BO8A 2WGZA 2YC5A 3T7NA 2V0HA 4J18A 4M99A 3FWWA 1V83A 3R0SA 2XWLA 4B3UA 2P73A 2VK9A 1ZJOA 4N6AA 1R7XA 1J2ZA 4CJCA 4BQHA 1FR9A 3I0LA 2OEGA 3OH3A 2YQJA 3QVBA 5FTVA 5CMHA 4M28A 3R5DA 1IINA 1S80A 4LW3A 1W77A 3TK8A 3VBNA 3I3AA 1MR7A 3IGJA 3TDTA 2JCJA 5DEMA 1H5SD 1ZDFA 3BSYA 1H7GA 1ZJ3A 4KC1A 2WLDA 1SSMA 2JF2A 3I0JA 1HV9A 2RIJA 1KHRA 4DECA 1XZ6A 1ZCVA 3I3XA 1VM8A 1G9RA 2IU8A 4AC3A 2WE9A 1OQMB 1R81A 2RJ5A 3HSQA 4EGGA 1VZUA 2VSIA 4FIXA 4Y6UA 2FYCB 1H3MA 2X60A 1VH3A 2FY7A 4IRPA 3GVDA 2IC7A 1GX0A 4FRPA 3SXCA 4EVWA 4M4KA 2RJ7A 2Y4LA 3TISA 3FS8A 1GA8A 2J0BA 4HO9A 3MQHA 3OUPA 1JYLA 1FO8A 1YP2A 1MP5A 4UEGA 5C4FA 1M8NA 1FOAA 1ZI1A 2XWMA 3CKQA 3CKVA 4NANA 4HOCA 1SSTA 2APCA 4Y7FA 3V91A 5EIYA 1O7OA 2CU2A 1H7HA 4HO5A 3V8ZA 3OTZA 3RMWA 2V0KA 4DE7A 3F1XA 1ZCUA 4KXOA 4CVHA 4M9CA 3U2UA 4MYOA 3T7MA 3R5AA 4EE4A 3N9WA 2Z86A 3T57A 4O6NA 3SRTA 2DPWA 4FRAA 2GGQA 3I0EA 5D92A 4DCLA 4G87A 2WVKA 4ZDQA 4Y7UA 4EE5A 2FKOA 2O1FA 1VZXA 2UX8A 3ST8A 4AAWA 2QIVX 4KPXA 1H7TA 4HO3A 3MQGA 4KC2A 1G23A 3SX5A 1ZJ1A 1S4PA 3V90A 2O1HA 1G95A 3GQAA 4HUSA 3T7OA 3U2TA 1R7VA 1H7QA 5IFYA 2OI7A 1WT1A 1LXAA 3OC9A 5J49A 1ON8A 2NXVA 4E6TA 5U2KA 2MZBA 2JF3A 1KGTA 4M2BA 5BXCA 5IDSA 1VGZA 1KWSA 1G1LA 3BSSA 4KPZA 1FG5N 2D0JA 2Z87A 3I0DA 1G3LA 1VPAA 1QG8A 5E3RA 4Y7GA 3IXCA 3ZF8A 3E25A 4D48A 1FXOA 5DEPA 3V8YA 5C1HA 2Y4MA 2C0NA 4E75A 1G0RA 1I52A 1LL0A 3IOJA 4HO2A 2AM3A 4B4MA 4CJBA 1OCXA 2XMEA 4EAAA 5DG3A 1R7UA 3Q4SA 4P02A 1ZI3A 3SXGA 3FTTA 3JQYA 4ECMA 3VBLA 5C3DA 3FSCA 2RJ0A 5CQLX 1QREA 2ICXA 3NZ2A 4HO4A 1PZYB 1LZIA 2Q4JA 1THJA 3Q80A 3HJJA 3GUEA 1V3WA 1WT2A 3V4EA 2O1GA 5CMGX 5FU8A 3JTJA 1NF5B 3BCVA 2P2OA 1JYKA 4D0TA 5FU0A 3OKRA 3SX7A 1TDTA 2WLEA 3FSXA 5L6VA 4FCEA 2YQCA 5EJ1A 3OH2A 2E3DA 3D98A 4EA9A 1H7FA 1O23B 4NALA 3R5BA 4CJ8A 4IHGA 1H4EA 3RSBA 3OW5A 2J0AA 5C36A 5DDVA 2AQ9A 3TWDA 3I0IX 2WLFA 5C1LA 1HJJA 1TW5A 4D11A 3IOHA 4AYJA 2AESA 4FRLA 1QWJA 3BRKX 3EG4A 4HZDA 1LZ7A 3EEVA 4BMAA 4HO8A 1VGWA 3CJ8A 3NGWA 4J09A 4JISA 2YQSA 1MP3A 3K8DA 3JUKA 1JVDA 2D7IA 5HS2A 4MFGA 1GX4A 2XATA 1TZFA 4B2WA 2YESA 1LZJA 2OI5A 5E3PA 3PKQA 5C3AA 5C1GA 4EEOA 1N4IA 3I0HA 4C2SA 4R37A 2VSHA 3DHOA 1VGUA 3MC4A 5CQMX 1YP4A 4FROA 4EEMA 5ADXU 2I5KA 3GOSA 4G3QA 4HCQA 1H5SA 2WLCA 3C8VA 4Q7CA 4HG6A 1QGQA 2VHEA 1JV3A 1TVYA 2ZU7A 4B42A 2I5EA 3V0PA 2BO4A 3FSBA 1QGSA 2VS3A 3R2WA 1V82A 4EABA 1HM8A 1KK5A 2V0JA 2FFUA 2FYAA 1ZJ2A 3R3IA 3Q7UA 1FXJA 1W55A 5FYEA 4R7PA 1EWWA 3SXAA 1NHEB 1PZTA 1H5TA 5F42A 2VFZA 2ICYA 3VNPA 4HO6A 5ADXV 2VXMA 5AJNA 3U2XA 4ISXA 5CQNX 1H5SB 4Y6NA 5FV9A 5JQQA 4E6UA 2PGVA 1G8OA 2VXLA 2PX7A 3I0KA 2V0IA 4FRMA 2WAWA 5C49A 1WVCA 5EJZA 3TQDA 1ZHJA 3F1CA 1NMMB 2JCOA 5E3QA 4N69A 4EE3A 3GQ8A 4Y7TA 1KRUA 2RJ4A 2VD4A 3ZLKA 3U0XA 2W0VA
chains in the Genus database with same CATH topology
4KQLA 3P47A 1H5TB 3CKOA 5C48A 1OMXA 2X5ZA 4M2AA 4EEGA 5CQOA 3VBIA 5C38A 1WSZA 3DJ4A 1V67A 3OTMA 1SSQA 5C3BA 1LL3A 2I7BA 3I0GA 4H7OA 4HURA 3P1BA 2FFVA 4E79A 1T3DA 2ZU8A 4FQWA 2RIYA 2Y4JA 4KRVA 4Y64A 1G97A 2GGOA 2AE7A 1QRLA 4MZUA 3CKJA 1HM0A 2PA4A 4MIXA 2RJ9A 3USQA 1KQAA 2V0LA 3FSYA 3VBJA 1SS9A 1NKHB 1HJLA 3E26A 3U2VA 3BSWA 1G93A 2BO7A 2PGYA 2X5SA 2A8UA 3OU9A 4FRDA 4O6MA 1FO9A 3TIOA 2YC3A 2D7RA 3KWDA 4KNRA 1O7QA 1VICA 3IOIA 4G3SA 1MRLA 3O3PA 3KWEA 4N6BA 4Y7VA 3V0LA 5CMJA 1QRFA 2RJ6A 2P6WA 4L41C 4EEAA 3CKNA 1GWVA 3TZTA 2WEEA 1KGQA 3OGZA 3SXEA 2XWNA 5CMFX 3USRA 1EZIA 4IHFA 1GQCA 3U2WA 4M98A 4Y63A 3OH4A 2QGIA 3V0NA 3KWCA 4NAKA 3R5CA 1VGTA 4IRQA 5C4CA 4E1KA 4KC4A 3U0YA 1VZTA 4Y62A 3I0CA 4D0ZA 1NQIB 1YROB 1G2VA 4EA7A 1WT3A 4JD0A 3BXYA 1H4DA 1NWGB 4MYBA 5C4DA 2QIAA 1R7YA 3SX3A 1R82A 3SXBA 2WLGA 3PKPA 5C4EA 4EQYA 5FUHA 2FYDB 1FR8A 2E8BA 2AGDA 3VBKA 1LVWA 3PMOA 2RJ8A 1FRWA 3D5NA 1ZDGA 4ASJA 4HO0A 4EA8A 4K6RA 4FIYA 1MC3A 3RMVA 2NPOA 3V0OA 5AJPA 4MNDA 1KK4A 1MP4A 1QRGA 2Y7AA 2Y4KA 1QQ0A 4GBPA 4FCUA 3V0MA 1WT0A 1KRVA 2AECA 3LW6A 1H5RA 4P00A 3HL3A 2ZU9A 2QKXA 1K4VA 3ZGGA 4AA7A 1ZJPA 2IU9A 3F1YA 1R7TA 2FYBA 4ASYA 4KT7A 2TDTA 1Z90A 4KNXA 5FTSA 1ZCYA 2AM4A 3JUJA 2RIZA 1FGXA 3EH0A 1ZI5A 3BFPA 2YCMA 3K8EA 4NAIA 5C47A 3VBPA 1KRRA 1YP3A 4R36A 1S4OA 1H5RB 1R80A 1TW1A 2Y6PA 3CU0A 4FREA 5AFUU 1INJA 2AM5A 3R1WA 3EE5A 1LZ0A 3SPTA 4N27A 4B4GA 2P72A 1JV1A 4XWIA 2W0WA 1H7EA 2A8WA 3ECTA 5C4BA 5AJOA 3ZLLA 4G3PA 4B4BA 2OI6A 5CMIA 4D11C 1INIA 2RITA 1S4NA 2JCKA 3FOQA 1GQ9A 3DUVA 2JCLA 5AFUV 1OMZA 1FZWA 4IHHA 1KK6A 3OH1A 5I1FA 1W57A 3I0FA 4AYLA 1JVGA 1E5KA 5DDTA 2RJ1A 3R8YA 3VBMA 4HZCA 1H7LA 4LW6A 1XHBA 5CQPA 3TV0A 1FGGA 4B5BA 2XMHA 4B2XA 1XATA 2YQHA 4Y9XA 1IIMA 5C8RA 1H5SC 1ZJ0A 1EYRA 1ZIZA 4DDZA 2VS4A 3POLA 3SX8A 1ZCTA 2QH5A 3R3RA 3PNNA 1V84A 1ZI4A 3Q1XA 2WVMA 2IUAA 4FRQA 1LL2A 5D91A 3V0QA 2RIXA 3KIAA 1HM9A 4FRHA 3D8VA 3OH0A 5L6SA 1ON6A 2OEFA 1MR9A 3OAMA 1FWYA 3ZGFA 2WVLA 2X65A 4YS8A 1VH1A 1H4CA 1O0RA 3DK5A 1XHDA 2BO6A 2VS5A 5IDTA 1QRMA 1GWWA 3CGXA 2AH9A 4ARWA 4FRBA 3SXDA 2BO8A 2WGZA 2YC5A 3T7NA 2V0HA 4J18A 4M99A 3FWWA 1V83A 3R0SA 2XWLA 4B3UA 2P73A 2VK9A 1ZJOA 4N6AA 1R7XA 1J2ZA 4CJCA 4BQHA 1FR9A 3I0LA 2OEGA 3OH3A 2YQJA 3QVBA 5FTVA 5CMHA 4M28A 3R5DA 1IINA 1S80A 4LW3A 1W77A 3TK8A 3VBNA 3I3AA 1MR7A 3IGJA 3TDTA 2JCJA 5DEMA 1H5SD 1ZDFA 3BSYA 1H7GA 1ZJ3A 4KC1A 2WLDA 1SSMA 2JF2A 3I0JA 1HV9A 2RIJA 1KHRA 4DECA 1XZ6A 1ZCVA 3I3XA 1VM8A 1G9RA 2IU8A 4AC3A 2WE9A 1OQMB 1R81A 2RJ5A 3HSQA 4EGGA 1VZUA 2VSIA 4FIXA 4Y6UA 2FYCB 1H3MA 2X60A 1VH3A 2FY7A 4IRPA 3GVDA 2IC7A 1GX0A 4FRPA 3SXCA 4EVWA 4M4KA 2RJ7A 2Y4LA 3TISA 3FS8A 1GA8A 2J0BA 4HO9A 3MQHA 3OUPA 1JYLA 1FO8A 1YP2A 1MP5A 4UEGA 5C4FA 1FOAA 1ZI1A 2XWMA 3CKQA 3CKVA 4NANA 4HOCA 1SSTA 2APCA 4Y7FA 3V91A 5EIYA 1O7OA 2CU2A 1H7HA 4HO5A 3V8ZA 3OTZA 3RMWA 2V0KA 4DE7A 3F1XA 1ZCUA 4KXOA 4CVHA 4M9CA 3U2UA 4MYOA 3T7MA 3R5AA 4EE4A 3N9WA 2Z86A 3T57A 4O6NA 3SRTA 2DPWA 4FRAA 2GGQA 3I0EA 5D92A 4DCLA 4G87A 2WVKA 4ZDQA 4Y7UA 4EE5A 2FKOA 2O1FA 1VZXA 2UX8A 3ST8A 4AAWA 2QIVX 4KPXA 1H7TA 4HO3A 3MQGA 4KC2A 1G23A 3SX5A 1ZJ1A 1S4PA 3V90A 2O1HA 1G95A 4HUSA 3T7OA 3U2TA 1R7VA 1H7QA 5IFYA 2OI7A 1WT1A 1LXAA 3OC9A 5J49A 1ON8A 2NXVA 4E6TA 5U2KA 2MZBA 2JF3A 1KGTA 4M2BA 5BXCA 5IDSA 1VGZA 1KWSA 1G1LA 3BSSA 4KPZA 1FG5N 2D0JA 2Z87A 3I0DA 1G3LA 1VPAA 1QG8A 5E3RA 4Y7GA 3IXCA 3ZF8A 3E25A 4D48A 1FXOA 5DEPA 3V8YA 5C1HA 2Y4MA 2C0NA 4E75A 1G0RA 1I52A 1LL0A 3IOJA 4HO2A 2AM3A 4B4MA 4CJBA 1OCXA 2XMEA 4EAAA 5DG3A 1R7UA 3Q4SA 4P02A 1ZI3A 3SXGA 3FTTA 3JQYA 4ECMA 3VBLA 5C3DA 3FSCA 2RJ0A 5CQLX 1QREA 2ICXA 3NZ2A 4HO4A 1PZYB 1LZIA 2Q4JA 1THJA 3Q80A 3HJJA 3GUEA 1V3WA 1WT2A 3V4EA 2O1GA 5CMGX 5FU8A 3JTJA 1NF5B 3BCVA 2P2OA 1JYKA 4D0TA 5FU0A 3OKRA 3SX7A 1TDTA 2WLEA 3FSXA 5L6VA 4FCEA 2YQCA 5EJ1A 3OH2A 2E3DA 3D98A 4EA9A 1H7FA 1O23B 4NALA 3R5BA 4CJ8A 4IHGA 1H4EA 3RSBA 3OW5A 2J0AA 5C36A 5DDVA 2AQ9A 3TWDA 3I0IX 2WLFA 5C1LA 1HJJA 1TW5A 4D11A 3IOHA 4AYJA 2AESA 4FRLA 1QWJA 3BRKX 3EG4A 4HZDA 1LZ7A 3EEVA 4BMAA 4HO8A 1VGWA 3CJ8A 3NGWA 4J09A 4JISA 2YQSA 1MP3A 3K8DA 3JUKA 1JVDA 2D7IA 5HS2A 4MFGA 1GX4A 2XATA 1TZFA 4B2WA 2YESA 1LZJA 2OI5A 5E3PA 3PKQA 5C3AA 5C1GA 4EEOA 3I0HA 4C2SA 4R37A 2VSHA 3DHOA 1VGUA 3MC4A 5CQMX 1YP4A 4FROA 4EEMA 5ADXU 2I5KA 3GOSA 4G3QA 4HCQA 1H5SA 2WLCA 3C8VA 4Q7CA 4HG6A 1QGQA 2VHEA 1JV3A 1TVYA 2ZU7A 4B42A 2I5EA 3V0PA 2BO4A 3FSBA 1QGSA 2VS3A 3R2WA 1V82A 4EABA 1HM8A 1KK5A 2V0JA 2FFUA 2FYAA 1ZJ2A 3R3IA 3Q7UA 1FXJA 1W55A 5FYEA 4R7PA 3SXAA 1NHEB 1PZTA 1H5TA 5F42A 2VFZA 2ICYA 3VNPA 4HO6A 5ADXV 2VXMA 5AJNA 3U2XA 4ISXA 5CQNX 1H5SB 4Y6NA 5FV9A 5JQQA 4E6UA 2PGVA 1G8OA 2VXLA 2PX7A 3I0KA 2V0IA 4FRMA 2WAWA 5C49A 1WVCA 5EJZA 3TQDA 1ZHJA 3F1CA 1NMMB 2JCOA 5E3QA 4N69A 4EE3A 4Y7TA 1KRUA 2RJ4A 2VD4A 3ZLKA 3U0XA 2W0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQL A;  3P47 A;  1H5T B;  3CKO A;  5C48 A;  1OMX A;  2X5Z A;  4M2A A;  4EEG A;  5CQO A;  3VBI A;  5C38 A;  1WSZ A;  3DJ4 A;  1V67 A;  3OTM A;  1SSQ A;  5C3B A;  1LL3 A;  2I7B A;  3I0G A;  4H7O A;  4HUR A;  3P1B A;  2FFV A;  4E79 A;  1T3D A;  2ZU8 A;  4FQW A;  2RIY A;  2Y4J A;  4KRV A;  4Y64 A;  1G97 A;  2GGO A;  2AE7 A;  1QRL A;  4MZU A;  3CKJ A;  1HM0 A;  2PA4 A;  2RJ9 A;  3USQ A;  1KQA A;  2V0L A;  3FSY A;  3VBJ A;  1SS9 A;  1NKH B;  1HJL A;  3E26 A;  3U2V A;  3BSW A;  1G93 A;  2BO7 A;  2PGY A;  2X5S A;  2A8U A;  3OU9 A;  4FRD A;  1FO9 A;  3TIO A;  2YC3 A;  2D7R A;  3KWD A;  4KNR A;  1O7Q A;  1VIC A;  3IOI A;  4G3S A;  1MRL A;  3O3P A;  3KWE A;  4N6B A;  4Y7V A;  3V0L A;  5CMJ A;  1QRF A;  2RJ6 A;  2P6W A;  4L41 C;  4EEA A;  3CKN A;  1GWV A;  3TZT A;  2WEE A;  1KGQ A;  3OGZ A;  3SXE A;  2XWN A;  5CMF X;  3USR A;  1EZI A;  4IHF A;  1GQC A;  3U2W A;  4M98 A;  4Y63 A;  3OH4 A;  2QGI A;  3V0N A;  3KWC A;  4NAK A;  3R5C A;  1VGT A;  4IRQ A;  5C4C A;  4E1K A;  4KC4 A;  3U0Y A;  1VZT A;  4Y62 A;  3I0C A;  4D0Z A;  1NQI B;  1YRO B;  1G2V A;  4EA7 A;  1WT3 A;  4JD0 A;  3BXY A;  1H4D A;  1NWG B;  4MYB A;  5C4D A;  2QIA A;  1R7Y A;  3SX3 A;  1R82 A;  3SXB A;  2WLG A;  3PKP A;  5C4E A;  4EQY A;  5FUH A;  2FYD B;  1FR8 A;  2E8B A;  2AGD A;  3VBK A;  1LVW A;  3PMO A;  2RJ8 A;  1FRW A;  3D5N A;  1ZDG A;  4ASJ A;  4HO0 A;  4EA8 A;  4K6R A;  1MC3 A;  3RMV A;  2NPO A;  3V0O A;  5AJP A;  4MND A;  1KK4 A;  1MP4 A;  1QRG A;  2Y7A A;  2Y4K A;  1QQ0 A;  4GBP A;  4FCU A;  3V0M A;  1WT0 A;  1KRV A;  2AEC A;  3LW6 A;  1H5R A;  4P00 A;  3HL3 A;  2ZU9 A;  2QKX A;  1K4V A;  3ZGG A;  4AA7 A;  1ZJP A;  2IU9 A;  3F1Y A;  1R7T A;  2FYB A;  4ASY A;  4KT7 A;  2TDT A;  1Z90 A;  4KNX A;  5FTS A;  1ZCY A;  2AM4 A;  3JUJ A;  2RIZ A;  1FGX A;  3EH0 A;  1ZI5 A;  3BFP A;  2YCM A;  3K8E A;  4NAI A;  5C47 A;  3VBP A;  1KRR A;  1YP3 A;  4R36 A;  1S4O A;  1H5R B;  1R80 A;  1TW1 A;  2Y6P A;  3CU0 A;  4FRE A;  5AFU U;  1INJ A;  2AM5 A;  3R1W A;  3EE5 A;  1LZ0 A;  3SPT A;  4N27 A;  4B4G A;  2P72 A;  1JV1 A;  4XWI A;  2W0W A;  1H7E A;  2A8W A;  3ECT A;  5C4B A;  5AJO A;  3ZLL A;  4G3P A;  4B4B A;  2OI6 A;  5CMI A;  4D11 C;  1INI A;  2RIT A;  1S4N A;  2JCK A;  3FOQ A;  1GQ9 A;  3DUV A;  2JCL A;  5AFU V;  1OMZ A;  1FZW A;  4IHH A;  1KK6 A;  3OH1 A;  5I1F A;  1W57 A;  3I0F A;  4AYL A;  1JVG A;  1E5K A;  5DDT A;  2RJ1 A;  3R8Y A;  3VBM A;  4HZC A;  1H7L A;  4LW6 A;  1XHB A;  5CQP A;  3TV0 A;  1FGG A;  4B5B A;  2XMH A;  4B2X A;  1XAT A;  2YQH A;  4Y9X A;  1IIM A;  5C8R A;  1H5S C;  1ZJ0 A;  1EYR A;  1ZIZ A;  4DDZ A;  2VS4 A;  3POL A;  3SX8 A;  1ZCT A;  2QH5 A;  3R3R A;  3PNN A;  1V84 A;  1ZI4 A;  3Q1X A;  2WVM A;  2IUA A;  4FRQ A;  1LL2 A;  3V0Q A;  2RIX A;  3KIA A;  1HM9 A;  4FRH A;  3D8V A;  3OH0 A;  5L6S A;  1ON6 A;  2OEF A;  1MR9 A;  3OAM A;  1FWY A;  3ZGF A;  2WVL A;  2X65 A;  4YS8 A;  1VH1 A;  1H4C A;  1O0R A;  3DK5 A;  1XHD A;  2BO6 A;  2VS5 A;  5IDT A;  1QRM A;  1GWW A;  3CGX A;  2AH9 A;  4ARW A;  4FRB A;  3SXD A;  2BO8 A;  2WGZ A;  2YC5 A;  3T7N A;  2V0H A;  4J18 A;  4M99 A;  3FWW A;  1V83 A;  3R0S A;  2XWL A;  4B3U A;  2P73 A;  4CJC A;  1ZJO A;  4N6A A;  1R7X A;  1J2Z A;  4BQH A;  1FR9 A;  3I0L A;  2OEG A;  3OH3 A;  2YQJ A;  3QVB A;  5FTV A;  5CMH A;  4M28 A;  3R5D A;  1IIN A;  1S80 A;  4LW3 A;  1W77 A;  3TK8 A;  3VBN A;  3I3A A;  1MR7 A;  3IGJ A;  3TDT A;  2JCJ A;  5DEM A;  1H5S D;  1ZDF A;  3BSY A;  1H7G A;  1ZJ3 A;  4KC1 A;  2WLD A;  1SSM A;  2JF2 A;  3I0J A;  1HV9 A;  2RIJ A;  1KHR A;  4DEC A;  1XZ6 A;  1ZCV A;  3I3X A;  1VM8 A;  1G9R A;  2IU8 A;  4AC3 A;  2WE9 A;  1OQM B;  1R81 A;  2RJ5 A;  3HSQ A;  4EGG A;  1VZU A;  2VSI A;  4Y6U A;  2FYC B;  1H3M A;  2X60 A;  1VH3 A;  2FY7 A;  4IRP A;  3GVD A;  2IC7 A;  1GX0 A;  4FRP A;  3SXC A;  4EVW A;  4M4K A;  2RJ7 A;  2Y4L A;  3TIS A;  3FS8 A;  1GA8 A;  4HO9 A;  3MQH A;  3OUP A;  1JYL A;  1FO8 A;  1YP2 A;  1MP5 A;  4UEG A;  5C4F A;  1FOA A;  1ZI1 A;  2XWM A;  3CKQ A;  3CKV A;  4NAN A;  4HOC A;  1SST A;  2APC A;  4Y7F A;  3V91 A;  5EIY A;  1O7O A;  2CU2 A;  1H7H A;  4HO5 A;  3V8Z A;  3OTZ A;  3RMW A;  2V0K A;  4DE7 A;  3F1X A;  1ZCU A;  4KXO A;  4CVH A;  4M9C A;  3U2U A;  4MYO A;  3T7M A;  3R5A A;  4EE4 A;  3N9W A;  2Z86 A;  3T57 A;  3SRT A;  2DPW A;  4FRA A;  2GGQ A;  3I0E A;  4ZDQ A;  4DCL A;  4G87 A;  2WVK A;  4EE5 A;  4Y7U A;  2FKO A;  2O1F A;  1VZX A;  2UX8 A;  3ST8 A;  4AAW A;  2QIV X;  4KPX A;  1H7T A;  4HO3 A;  3MQG A;  4KC2 A;  1G23 A;  3SX5 A;  1ZJ1 A;  1S4P A;  3V90 A;  2O1H A;  1G95 A;  4HUS A;  3T7O A;  3U2T A;  1R7V A;  1H7Q A;  5IFY A;  2OI7 A;  1WT1 A;  1LXA A;  3OC9 A;  5J49 A;  1ON8 A;  2NXV A;  4E6T A;  5U2K A;  2MZB A;  2JF3 A;  1KGT A;  4M2B A;  5BXC A;  5IDS A;  1VGZ A;  1KWS A;  1G1L A;  3BSS A;  4KPZ A;  1FG5 N;  2D0J A;  2Z87 A;  3I0D A;  1G3L A;  1VPA A;  1QG8 A;  5E3R A;  4Y7G A;  3IXC A;  3ZF8 A;  3E25 A;  4D48 A;  1FXO A;  5DEP A;  3V8Y A;  5C1H A;  2Y4M A;  4E75 A;  1G0R A;  1I52 A;  1LL0 A;  3IOJ A;  4HO2 A;  2AM3 A;  4B4M A;  4CJB A;  1OCX A;  2XME A;  4EAA A;  5DG3 A;  1R7U A;  3Q4S A;  4P02 A;  1ZI3 A;  3SXG A;  3FTT A;  3JQY A;  4ECM A;  3VBL A;  5C3D A;  3FSC A;  2RJ0 A;  5CQL X;  1QRE A;  2ICX A;  3NZ2 A;  4HO4 A;  1PZY B;  1LZI A;  2Q4J A;  1THJ A;  3Q80 A;  3HJJ A;  3GUE A;  1V3W A;  1WT2 A;  3V4E A;  2O1G A;  5CMG X;  5FU8 A;  3JTJ A;  1NF5 B;  3BCV A;  2P2O A;  1JYK A;  4D0T A;  5FU0 A;  3OKR A;  3SX7 A;  1TDT A;  2WLE A;  3FSX A;  5L6V A;  4FCE A;  2YQC A;  5EJ1 A;  3OH2 A;  2E3D A;  3D98 A;  4EA9 A;  1H7F A;  1O23 B;  4NAL A;  3R5B A;  4CJ8 A;  4IHG A;  1H4E A;  3RSB A;  3OW5 A;  5C36 A;  5DDV A;  2AQ9 A;  3TWD A;  3I0I X;  2WLF A;  5C1L A;  1HJJ A;  1TW5 A;  4D11 A;  3IOH A;  4AYJ A;  2AES A;  4FRL A;  1QWJ A;  3BRK X;  3EG4 A;  4HZD A;  1LZ7 A;  3EEV A;  4BMA A;  4HO8 A;  1VGW A;  3CJ8 A;  3NGW A;  4J09 A;  4JIS A;  2YQS A;  1MP3 A;  3K8D A;  3JUK A;  1JVD A;  2D7I A;  5HS2 A;  4MFG A;  1GX4 A;  2XAT A;  1TZF A;  4B2W A;  2YES A;  1LZJ A;  2OI5 A;  5E3P A;  3PKQ A;  5C3A A;  5C1G A;  4EEO A;  3I0H A;  4C2S A;  4R37 A;  2VSH A;  3DHO A;  1VGU A;  3MC4 A;  5CQM X;  1YP4 A;  4FRO A;  4EEM A;  5ADX U;  2I5K A;  3GOS A;  4G3Q A;  4HCQ A;  1H5S A;  2WLC A;  3C8V A;  4HG6 A;  1QGQ A;  2VHE A;  1JV3 A;  1TVY A;  2ZU7 A;  4B42 A;  2I5E A;  3V0P A;  2BO4 A;  3FSB A;  1QGS A;  2VS3 A;  3R2W A;  1V82 A;  4EAB A;  1HM8 A;  1KK5 A;  2V0J A;  2FFU A;  2FYA A;  1ZJ2 A;  3R3I A;  3Q7U A;  1FXJ A;  1W55 A;  5FYE A;  4R7P A;  3SXA A;  1NHE B;  1PZT A;  1H5T A;  5F42 A;  2VFZ A;  2ICY A;  3VNP A;  4HO6 A;  5ADX V;  2VXM A;  5AJN A;  3U2X A;  4ISX A;  5CQN X;  1H5S B;  4Y6N A;  5FV9 A;  5JQQ A;  4E6U A;  2PGV A;  1G8O A;  2VXL A;  2PX7 A;  3I0K A;  2V0I A;  4FRM A;  2WAW A;  5C49 A;  1WVC A;  5EJZ A;  3TQD A;  1ZHJ A;  3F1C A;  1NMM B;  2JCO A;  5E3Q A;  4N69 A;  4EE3 A;  4Y7T A;  1KRU A;  2RJ4 A;  2VD4 A;  3ZLK A;  3U0X A;  2W0V A; 
#chains in the Genus database with same CATH topology
 4KQL A;  3P47 A;  1H5T B;  3CKO A;  5C48 A;  1OMX A;  2X5Z A;  4M2A A;  4EEG A;  5CQO A;  3VBI A;  5C38 A;  1WSZ A;  3DJ4 A;  1V67 A;  3OTM A;  1SSQ A;  5C3B A;  1LL3 A;  2I7B A;  3I0G A;  4H7O A;  4HUR A;  3P1B A;  2FFV A;  4E79 A;  1T3D A;  2ZU8 A;  4FQW A;  2RIY A;  2Y4J A;  4KRV A;  4Y64 A;  1G97 A;  2GGO A;  2AE7 A;  1QRL A;  4MZU A;  3CKJ A;  1HM0 A;  2PA4 A;  4MIX A;  2RJ9 A;  3USQ A;  1KQA A;  2V0L A;  3FSY A;  3VBJ A;  1SS9 A;  1NKH B;  1HJL A;  1Z2F A;  3E26 A;  1L0S A;  3U2V A;  3BSW A;  1G93 A;  2BO7 A;  2PGY A;  2X5S A;  2A8U A;  3OU9 A;  4FRD A;  4O6M A;  1FO9 A;  3TIO A;  2YC3 A;  2D7R A;  3KWD A;  4KNR A;  1O7Q A;  1VIC A;  3IOI A;  4G3S A;  1MRL A;  3O3P A;  3KWE A;  4N6B A;  4Y7V A;  3V0L A;  5CMJ A;  1QRF A;  2RJ6 A;  2P6W A;  3SUC A;  4L41 C;  4EEA A;  3CKN A;  1GWV A;  3TZT A;  2WEE A;  3GQ9 A;  1KGQ A;  3OGZ A;  3SXE A;  2XWN A;  5CMF X;  3USR A;  1EZI A;  4IHF A;  1GQC A;  3U2W A;  4M98 A;  4Y63 A;  3OH4 A;  2QGI A;  3V0N A;  3KWC A;  4NAK A;  3R5C A;  1VGT A;  4IRQ A;  5C4C A;  4E1K A;  4KC4 A;  3U0Y A;  1VZT A;  4Y62 A;  3I0C A;  3GQ7 A;  4D0Z A;  1NQI B;  1YRO B;  1G2V A;  4EA7 A;  1WT3 A;  4JD0 A;  3BXY A;  1H4D A;  1NWG B;  4MYB A;  5C4D A;  2QIA A;  1R7Y A;  3SX3 A;  1R82 A;  3SXB A;  2WLG A;  3PKP A;  5C4E A;  4EQY A;  5FUH A;  2FYD B;  1FR8 A;  2E8B A;  2AGD A;  3VBK A;  1LVW A;  3PMO A;  2RJ8 A;  1FRW A;  3D5N A;  1ZDG A;  4ASJ A;  4HO0 A;  4EA8 A;  4K6R A;  4FIY A;  1MC3 A;  3RMV A;  2NPO A;  3V0O A;  5AJP A;  4MND A;  1KK4 A;  1MP4 A;  1QRG A;  2Y7A A;  2Y4K A;  1QQ0 A;  4GBP A;  4FCU A;  3V0M A;  1WT0 A;  1KRV A;  2AEC A;  3LW6 A;  1H5R A;  4P00 A;  3HL3 A;  2ZU9 A;  2QKX A;  1K4V A;  3ZGG A;  4AA7 A;  1ZJP A;  2IU9 A;  3F1Y A;  1R7T A;  2FYB A;  4ASY A;  4KT7 A;  2TDT A;  1Z90 A;  4KNX A;  5FTS A;  1ZCY A;  2AM4 A;  3JUJ A;  2RIZ A;  1FGX A;  3EH0 A;  1ZI5 A;  3BFP A;  2YCM A;  3K8E A;  4NAI A;  5C47 A;  3VBP A;  1KRR A;  1YP3 A;  4R36 A;  1S4O A;  1H5R B;  1R80 A;  1TW1 A;  2Y6P A;  3CU0 A;  4FRE A;  5AFU U;  1INJ A;  2AM5 A;  3R1W A;  3EE5 A;  1LZ0 A;  3SPT A;  4N27 A;  4B4G A;  2P72 A;  1JV1 A;  4XWI A;  2W0W A;  1H7E A;  2A8W A;  3ECT A;  5C4B A;  5AJO A;  3ZLL A;  4G3P A;  4B4B A;  2OI6 A;  5CMI A;  4D11 C;  1INI A;  2RIT A;  1S4N A;  2JCK A;  3FOQ A;  1GQ9 A;  3DUV A;  2JCL A;  5AFU V;  1OMZ A;  1FZW A;  4IHH A;  1KK6 A;  3OH1 A;  5I1F A;  1W57 A;  3I0F A;  4AYL A;  1JVG A;  1E5K A;  5DDT A;  2RJ1 A;  3R8Y A;  3VBM A;  4HZC A;  1H7L A;  4LW6 A;  1XHB A;  5CQP A;  3TV0 A;  1FGG A;  4B5B A;  2XMH A;  4B2X A;  1XAT A;  2YQH A;  4Y9X A;  1IIM A;  5C8R A;  1H5S C;  1ZJ0 A;  1EYR A;  1ZIZ A;  4DDZ A;  2VS4 A;  3POL A;  3SX8 A;  1ZCT A;  2QH5 A;  3R3R A;  3PNN A;  1V84 A;  1ZI4 A;  3Q1X A;  2WVM A;  2IUA A;  4FRQ A;  1LL2 A;  5D91 A;  3V0Q A;  2RIX A;  3KIA A;  1HM9 A;  4FRH A;  3D8V A;  3OH0 A;  5L6S A;  1ON6 A;  2OEF A;  1MR9 A;  3OAM A;  1FWY A;  3ZGF A;  2WVL A;  2X65 A;  4YS8 A;  1VH1 A;  1H4C A;  1O0R A;  3DK5 A;  1XHD A;  2BO6 A;  2VS5 A;  5IDT A;  1QRM A;  1GWW A;  3CGX A;  2AH9 A;  4ARW A;  4FRB A;  3SXD A;  2BO8 A;  2WGZ A;  2YC5 A;  3T7N A;  2V0H A;  4J18 A;  4M99 A;  3FWW A;  1V83 A;  3R0S A;  2XWL A;  4B3U A;  2P73 A;  2VK9 A;  1ZJO A;  4N6A A;  1R7X A;  1J2Z A;  4CJC A;  4BQH A;  1FR9 A;  3I0L A;  2OEG A;  3OH3 A;  2YQJ A;  3QVB A;  5FTV A;  5CMH A;  4M28 A;  3R5D A;  1IIN A;  1S80 A;  4LW3 A;  1W77 A;  3TK8 A;  3VBN A;  3I3A A;  1MR7 A;  3IGJ A;  3TDT A;  2JCJ A;  5DEM A;  1H5S D;  1ZDF A;  3BSY A;  1H7G A;  1ZJ3 A;  4KC1 A;  2WLD A;  1SSM A;  2JF2 A;  3I0J A;  1HV9 A;  2RIJ A;  1KHR A;  4DEC A;  1XZ6 A;  1ZCV A;  3I3X A;  1VM8 A;  1G9R A;  2IU8 A;  4AC3 A;  2WE9 A;  1OQM B;  1R81 A;  2RJ5 A;  3HSQ A;  4EGG A;  1VZU A;  2VSI A;  4FIX A;  4Y6U A;  2FYC B;  1H3M A;  2X60 A;  1VH3 A;  2FY7 A;  4IRP A;  3GVD A;  2IC7 A;  1GX0 A;  4FRP A;  3SXC A;  4EVW A;  4M4K A;  2RJ7 A;  2Y4L A;  3TIS A;  3FS8 A;  1GA8 A;  2J0B A;  4HO9 A;  3MQH A;  3OUP A;  1JYL A;  1FO8 A;  1YP2 A;  1MP5 A;  4UEG A;  5C4F A;  1M8N A;  1FOA A;  1ZI1 A;  2XWM A;  3CKQ A;  3CKV A;  4NAN A;  4HOC A;  1SST A;  2APC A;  4Y7F A;  3V91 A;  5EIY A;  1O7O A;  2CU2 A;  1H7H A;  4HO5 A;  3V8Z A;  3OTZ A;  3RMW A;  2V0K A;  4DE7 A;  3F1X A;  1ZCU A;  4KXO A;  4CVH A;  4M9C A;  3U2U A;  4MYO A;  3T7M A;  3R5A A;  4EE4 A;  3N9W A;  2Z86 A;  3T57 A;  4O6N A;  3SRT A;  2DPW A;  4FRA A;  2GGQ A;  3I0E A;  5D92 A;  4DCL A;  4G87 A;  2WVK A;  4ZDQ A;  4Y7U A;  4EE5 A;  2FKO A;  2O1F A;  1VZX A;  2UX8 A;  3ST8 A;  4AAW A;  2QIV X;  4KPX A;  1H7T A;  4HO3 A;  3MQG A;  4KC2 A;  1G23 A;  3SX5 A;  1ZJ1 A;  1S4P A;  3V90 A;  2O1H A;  1G95 A;  3GQA A;  4HUS A;  3T7O A;  3U2T A;  1R7V A;  1H7Q A;  5IFY A;  2OI7 A;  1WT1 A;  1LXA A;  3OC9 A;  5J49 A;  1ON8 A;  2NXV A;  4E6T A;  5U2K A;  2MZB A;  2JF3 A;  1KGT A;  4M2B A;  5BXC A;  5IDS A;  1VGZ A;  1KWS A;  1G1L A;  3BSS A;  4KPZ A;  1FG5 N;  2D0J A;  2Z87 A;  3I0D A;  1G3L A;  1VPA A;  1QG8 A;  5E3R A;  4Y7G A;  3IXC A;  3ZF8 A;  3E25 A;  4D48 A;  1FXO A;  5DEP A;  3V8Y A;  5C1H A;  2Y4M A;  2C0N A;  4E75 A;  1G0R A;  1I52 A;  1LL0 A;  3IOJ A;  4HO2 A;  2AM3 A;  4B4M A;  4CJB A;  1OCX A;  2XME A;  4EAA A;  5DG3 A;  1R7U A;  3Q4S A;  4P02 A;  1ZI3 A;  3SXG A;  3FTT A;  3JQY A;  4ECM A;  3VBL A;  5C3D A;  3FSC A;  2RJ0 A;  5CQL X;  1QRE A;  2ICX A;  3NZ2 A;  4HO4 A;  1PZY B;  1LZI A;  2Q4J A;  1THJ A;  3Q80 A;  3HJJ A;  3GUE A;  1V3W A;  1WT2 A;  3V4E A;  2O1G A;  5CMG X;  5FU8 A;  3JTJ A;  1NF5 B;  3BCV A;  2P2O A;  1JYK A;  4D0T A;  5FU0 A;  3OKR A;  3SX7 A;  1TDT A;  2WLE A;  3FSX A;  5L6V A;  4FCE A;  2YQC A;  5EJ1 A;  3OH2 A;  2E3D A;  3D98 A;  4EA9 A;  1H7F A;  1O23 B;  4NAL A;  3R5B A;  4CJ8 A;  4IHG A;  1H4E A;  3RSB A;  3OW5 A;  2J0A A;  5C36 A;  5DDV A;  2AQ9 A;  3TWD A;  3I0I X;  2WLF A;  5C1L A;  1HJJ A;  1TW5 A;  4D11 A;  3IOH A;  4AYJ A;  2AES A;  4FRL A;  1QWJ A;  3BRK X;  3EG4 A;  4HZD A;  1LZ7 A;  3EEV A;  4BMA A;  4HO8 A;  1VGW A;  3CJ8 A;  3NGW A;  4J09 A;  4JIS A;  2YQS A;  1MP3 A;  3K8D A;  3JUK A;  1JVD A;  2D7I A;  5HS2 A;  4MFG A;  1GX4 A;  2XAT A;  1TZF A;  4B2W A;  2YES A;  1LZJ A;  2OI5 A;  5E3P A;  3PKQ A;  5C3A A;  5C1G A;  4EEO A;  1N4I A;  3I0H A;  4C2S A;  4R37 A;  2VSH A;  3DHO A;  1VGU A;  3MC4 A;  5CQM X;  1YP4 A;  4FRO A;  4EEM A;  5ADX U;  2I5K A;  3GOS A;  4G3Q A;  4HCQ A;  1H5S A;  2WLC A;  3C8V A;  4Q7C A;  4HG6 A;  1QGQ A;  2VHE A;  1JV3 A;  1TVY A;  2ZU7 A;  4B42 A;  2I5E A;  3V0P A;  2BO4 A;  3FSB A;  1QGS A;  2VS3 A;  3R2W A;  1V82 A;  4EAB A;  1HM8 A;  1KK5 A;  2V0J A;  2FFU A;  2FYA A;  1ZJ2 A;  3R3I A;  3Q7U A;  1FXJ A;  1W55 A;  5FYE A;  4R7P A;  1EWW A;  3SXA A;  1NHE B;  1PZT A;  1H5T A;  5F42 A;  2VFZ A;  2ICY A;  3VNP A;  4HO6 A;  5ADX V;  2VXM A;  5AJN A;  3U2X A;  4ISX A;  5CQN X;  1H5S B;  4Y6N A;  5FV9 A;  5JQQ A;  4E6U A;  2PGV A;  1G8O A;  2VXL A;  2PX7 A;  3I0K A;  2V0I A;  4FRM A;  2WAW A;  5C49 A;  1WVC A;  5EJZ A;  3TQD A;  1ZHJ A;  3F1C A;  1NMM B;  2JCO A;  5E3Q A;  4N69 A;  4EE3 A;  3GQ8 A;  4Y7T A;  1KRU A;  2RJ4 A;  2VD4 A;  3ZLK A;  3U0X A;  2W0V A; 
#chains in the Genus database with same CATH homology
 4KQL A;  3P47 A;  1H5T B;  3CKO A;  5C48 A;  1OMX A;  2X5Z A;  4M2A A;  4EEG A;  5CQO A;  3VBI A;  5C38 A;  1WSZ A;  3DJ4 A;  1V67 A;  3OTM A;  1SSQ A;  5C3B A;  1LL3 A;  2I7B A;  3I0G A;  4H7O A;  4HUR A;  3P1B A;  2FFV A;  4E79 A;  1T3D A;  2ZU8 A;  4FQW A;  2RIY A;  2Y4J A;  4KRV A;  4Y64 A;  1G97 A;  2GGO A;  2AE7 A;  1QRL A;  4MZU A;  3CKJ A;  1HM0 A;  2PA4 A;  4MIX A;  2RJ9 A;  3USQ A;  1KQA A;  2V0L A;  3FSY A;  3VBJ A;  1SS9 A;  1NKH B;  1HJL A;  3E26 A;  3U2V A;  3BSW A;  1G93 A;  2BO7 A;  2PGY A;  2X5S A;  2A8U A;  3OU9 A;  4FRD A;  4O6M A;  1FO9 A;  3TIO A;  2YC3 A;  2D7R A;  3KWD A;  4KNR A;  1O7Q A;  1VIC A;  3IOI A;  4G3S A;  1MRL A;  3O3P A;  3KWE A;  4N6B A;  4Y7V A;  3V0L A;  5CMJ A;  1QRF A;  2RJ6 A;  2P6W A;  4L41 C;  4EEA A;  3CKN A;  1GWV A;  3TZT A;  2WEE A;  1KGQ A;  3OGZ A;  3SXE A;  2XWN A;  5CMF X;  3USR A;  1EZI A;  4IHF A;  1GQC A;  3U2W A;  4M98 A;  4Y63 A;  3OH4 A;  2QGI A;  3V0N A;  3KWC A;  4NAK A;  3R5C A;  1VGT A;  4IRQ A;  5C4C A;  4E1K A;  4KC4 A;  3U0Y A;  1VZT A;  4Y62 A;  3I0C A;  4D0Z A;  1NQI B;  1YRO B;  1G2V A;  4EA7 A;  1WT3 A;  4JD0 A;  3BXY A;  1H4D A;  1NWG B;  4MYB A;  5C4D A;  2QIA A;  1R7Y A;  3SX3 A;  1R82 A;  3SXB A;  2WLG A;  3PKP A;  5C4E A;  4EQY A;  5FUH A;  2FYD B;  1FR8 A;  2E8B A;  2AGD A;  3VBK A;  1LVW A;  3PMO A;  2RJ8 A;  1FRW A;  3D5N A;  1ZDG A;  4ASJ A;  4HO0 A;  4EA8 A;  4K6R A;  4FIY A;  1MC3 A;  3RMV A;  2NPO A;  3V0O A;  5AJP A;  4MND A;  1KK4 A;  1MP4 A;  1QRG A;  2Y7A A;  2Y4K A;  1QQ0 A;  4GBP A;  4FCU A;  3V0M A;  1WT0 A;  1KRV A;  2AEC A;  3LW6 A;  1H5R A;  4P00 A;  3HL3 A;  2ZU9 A;  2QKX A;  1K4V A;  3ZGG A;  4AA7 A;  1ZJP A;  2IU9 A;  3F1Y A;  1R7T A;  2FYB A;  4ASY A;  4KT7 A;  2TDT A;  1Z90 A;  4KNX A;  5FTS A;  1ZCY A;  2AM4 A;  3JUJ A;  2RIZ A;  1FGX A;  3EH0 A;  1ZI5 A;  3BFP A;  2YCM A;  3K8E A;  4NAI A;  5C47 A;  3VBP A;  1KRR A;  1YP3 A;  4R36 A;  1S4O A;  1H5R B;  1R80 A;  1TW1 A;  2Y6P A;  3CU0 A;  4FRE A;  5AFU U;  1INJ A;  2AM5 A;  3R1W A;  3EE5 A;  1LZ0 A;  3SPT A;  4N27 A;  4B4G A;  2P72 A;  1JV1 A;  4XWI A;  2W0W A;  1H7E A;  2A8W A;  3ECT A;  5C4B A;  5AJO A;  3ZLL A;  4G3P A;  4B4B A;  2OI6 A;  5CMI A;  4D11 C;  1INI A;  2RIT A;  1S4N A;  2JCK A;  3FOQ A;  1GQ9 A;  3DUV A;  2JCL A;  5AFU V;  1OMZ A;  1FZW A;  4IHH A;  1KK6 A;  3OH1 A;  5I1F A;  1W57 A;  3I0F A;  4AYL A;  1JVG A;  1E5K A;  5DDT A;  2RJ1 A;  3R8Y A;  3VBM A;  4HZC A;  1H7L A;  4LW6 A;  1XHB A;  5CQP A;  3TV0 A;  1FGG A;  4B5B A;  2XMH A;  4B2X A;  1XAT A;  2YQH A;  4Y9X A;  1IIM A;  5C8R A;  1H5S C;  1ZJ0 A;  1EYR A;  1ZIZ A;  4DDZ A;  2VS4 A;  3POL A;  3SX8 A;  1ZCT A;  2QH5 A;  3R3R A;  3PNN A;  1V84 A;  1ZI4 A;  3Q1X A;  2WVM A;  2IUA A;  4FRQ A;  1LL2 A;  5D91 A;  3V0Q A;  2RIX A;  3KIA A;  1HM9 A;  4FRH A;  3D8V A;  3OH0 A;  5L6S A;  1ON6 A;  2OEF A;  1MR9 A;  3OAM A;  1FWY A;  3ZGF A;  2WVL A;  2X65 A;  4YS8 A;  1VH1 A;  1H4C A;  1O0R A;  3DK5 A;  1XHD A;  2BO6 A;  2VS5 A;  5IDT A;  1QRM A;  1GWW A;  3CGX A;  2AH9 A;  4ARW A;  4FRB A;  3SXD A;  2BO8 A;  2WGZ A;  2YC5 A;  3T7N A;  2V0H A;  4J18 A;  4M99 A;  3FWW A;  1V83 A;  3R0S A;  2XWL A;  4B3U A;  2P73 A;  2VK9 A;  1ZJO A;  4N6A A;  1R7X A;  1J2Z A;  4CJC A;  4BQH A;  1FR9 A;  3I0L A;  2OEG A;  3OH3 A;  2YQJ A;  3QVB A;  5FTV A;  5CMH A;  4M28 A;  3R5D A;  1IIN A;  1S80 A;  4LW3 A;  1W77 A;  3TK8 A;  3VBN A;  3I3A A;  1MR7 A;  3IGJ A;  3TDT A;  2JCJ A;  5DEM A;  1H5S D;  1ZDF A;  3BSY A;  1H7G A;  1ZJ3 A;  4KC1 A;  2WLD A;  1SSM A;  2JF2 A;  3I0J A;  1HV9 A;  2RIJ A;  1KHR A;  4DEC A;  1XZ6 A;  1ZCV A;  3I3X A;  1VM8 A;  1G9R A;  2IU8 A;  4AC3 A;  2WE9 A;  1OQM B;  1R81 A;  2RJ5 A;  3HSQ A;  4EGG A;  1VZU A;  2VSI A;  4FIX A;  4Y6U A;  2FYC B;  1H3M A;  2X60 A;  1VH3 A;  2FY7 A;  4IRP A;  3GVD A;  2IC7 A;  1GX0 A;  4FRP A;  3SXC A;  4EVW A;  4M4K A;  2RJ7 A;  2Y4L A;  3TIS A;  3FS8 A;  1GA8 A;  2J0B A;  4HO9 A;  3MQH A;  3OUP A;  1JYL A;  1FO8 A;  1YP2 A;  1MP5 A;  4UEG A;  5C4F A;  1FOA A;  1ZI1 A;  2XWM A;  3CKQ A;  3CKV A;  4NAN A;  4HOC A;  1SST A;  2APC A;  4Y7F A;  3V91 A;  5EIY A;  1O7O A;  2CU2 A;  1H7H A;  4HO5 A;  3V8Z A;  3OTZ A;  3RMW A;  2V0K A;  4DE7 A;  3F1X A;  1ZCU A;  4KXO A;  4CVH A;  4M9C A;  3U2U A;  4MYO A;  3T7M A;  3R5A A;  4EE4 A;  3N9W A;  2Z86 A;  3T57 A;  4O6N A;  3SRT A;  2DPW A;  4FRA A;  2GGQ A;  3I0E A;  5D92 A;  4DCL A;  4G87 A;  2WVK A;  4ZDQ A;  4Y7U A;  4EE5 A;  2FKO A;  2O1F A;  1VZX A;  2UX8 A;  3ST8 A;  4AAW A;  2QIV X;  4KPX A;  1H7T A;  4HO3 A;  3MQG A;  4KC2 A;  1G23 A;  3SX5 A;  1ZJ1 A;  1S4P A;  3V90 A;  2O1H A;  1G95 A;  4HUS A;  3T7O A;  3U2T A;  1R7V A;  1H7Q A;  5IFY A;  2OI7 A;  1WT1 A;  1LXA A;  3OC9 A;  5J49 A;  1ON8 A;  2NXV A;  4E6T A;  5U2K A;  2MZB A;  2JF3 A;  1KGT A;  4M2B A;  5BXC A;  5IDS A;  1VGZ A;  1KWS A;  1G1L A;  3BSS A;  4KPZ A;  1FG5 N;  2D0J A;  2Z87 A;  3I0D A;  1G3L A;  1VPA A;  1QG8 A;  5E3R A;  4Y7G A;  3IXC A;  3ZF8 A;  3E25 A;  4D48 A;  1FXO A;  5DEP A;  3V8Y A;  5C1H A;  2Y4M A;  2C0N A;  4E75 A;  1G0R A;  1I52 A;  1LL0 A;  3IOJ A;  4HO2 A;  2AM3 A;  4B4M A;  4CJB A;  1OCX A;  2XME A;  4EAA A;  5DG3 A;  1R7U A;  3Q4S A;  4P02 A;  1ZI3 A;  3SXG A;  3FTT A;  3JQY A;  4ECM A;  3VBL A;  5C3D A;  3FSC A;  2RJ0 A;  5CQL X;  1QRE A;  2ICX A;  3NZ2 A;  4HO4 A;  1PZY B;  1LZI A;  2Q4J A;  1THJ A;  3Q80 A;  3HJJ A;  3GUE A;  1V3W A;  1WT2 A;  3V4E A;  2O1G A;  5CMG X;  5FU8 A;  3JTJ A;  1NF5 B;  3BCV A;  2P2O A;  1JYK A;  4D0T A;  5FU0 A;  3OKR A;  3SX7 A;  1TDT A;  2WLE A;  3FSX A;  5L6V A;  4FCE A;  2YQC A;  5EJ1 A;  3OH2 A;  2E3D A;  3D98 A;  4EA9 A;  1H7F A;  1O23 B;  4NAL A;  3R5B A;  4CJ8 A;  4IHG A;  1H4E A;  3RSB A;  3OW5 A;  2J0A A;  5C36 A;  5DDV A;  2AQ9 A;  3TWD A;  3I0I X;  2WLF A;  5C1L A;  1HJJ A;  1TW5 A;  4D11 A;  3IOH A;  4AYJ A;  2AES A;  4FRL A;  1QWJ A;  3BRK X;  3EG4 A;  4HZD A;  1LZ7 A;  3EEV A;  4BMA A;  4HO8 A;  1VGW A;  3CJ8 A;  3NGW A;  4J09 A;  4JIS A;  2YQS A;  1MP3 A;  3K8D A;  3JUK A;  1JVD A;  2D7I A;  5HS2 A;  4MFG A;  1GX4 A;  2XAT A;  1TZF A;  4B2W A;  2YES A;  1LZJ A;  2OI5 A;  5E3P A;  3PKQ A;  5C3A A;  5C1G A;  4EEO A;  3I0H A;  4C2S A;  4R37 A;  2VSH A;  3DHO A;  1VGU A;  3MC4 A;  5CQM X;  1YP4 A;  4FRO A;  4EEM A;  5ADX U;  2I5K A;  3GOS A;  4G3Q A;  4HCQ A;  1H5S A;  2WLC A;  3C8V A;  4Q7C A;  4HG6 A;  1QGQ A;  2VHE A;  1JV3 A;  1TVY A;  2ZU7 A;  4B42 A;  2I5E A;  3V0P A;  2BO4 A;  3FSB A;  1QGS A;  2VS3 A;  3R2W A;  1V82 A;  4EAB A;  1HM8 A;  1KK5 A;  2V0J A;  2FFU A;  2FYA A;  1ZJ2 A;  3R3I A;  3Q7U A;  1FXJ A;  1W55 A;  5FYE A;  4R7P A;  3SXA A;  1NHE B;  1PZT A;  1H5T A;  5F42 A;  2VFZ A;  2ICY A;  3VNP A;  4HO6 A;  5ADX V;  2VXM A;  5AJN A;  3U2X A;  4ISX A;  5CQN X;  1H5S B;  4Y6N A;  5FV9 A;  5JQQ A;  4E6U A;  2PGV A;  1G8O A;  2VXL A;  2PX7 A;  3I0K A;  2V0I A;  4FRM A;  2WAW A;  5C49 A;  1WVC A;  5EJZ A;  3TQD A;  1ZHJ A;  3F1C A;  1NMM B;  2JCO A;  5E3Q A;  4N69 A;  4EE3 A;  4Y7T A;  1KRU A;  2RJ4 A;  2VD4 A;  3ZLK A;  3U0X A;  2W0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...