4K6RA

Crystal structure of glmu in complex with atp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
469
structure length
469
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GlmU (N-acetylglucosamine-1-phosphate uridyltransferase) bound to three magnesium ions and ATP at the active site
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Bifunctional protein GlmU
total genus 176
structure length 469
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4k6rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4k6rA01
1O7QA 4HOCA 1GWVA 1HV9A 2V0LA 1H5TA 5EIYA 1KGQA 1ZCTA 3TK8A 2WGZA 1FOAA 1QGSA 3OH1A 2A8WA 4J09A 4M98A 1KK6A 1SSQA 3HJJA 5ADXV 1ZJ1A 3QVBA 3SXEA 2RIXA 5C4FA 5AJNA 2OEFA 2E3DA 4UEGA 2WLGA 1MC3A 3SXDA 3IXCA 3V8ZA 2RJ9A 4HO2A 1MP4A 5DDVA 2WLDA 2WLEA 1H5SA 2PX7A 2VSIA 3FSCA 5FTVA 1GWWA 4HO0A 5C8RA 4FRPA 4Y6NA 4Y7GA 4B2WA 2NPOA 5C49A 5L6SA 4CVHA 4E79A 2VS4A 3PKQA 2Y6PA 5EJ1A 3OKRA 5C1LA 4M99A 1LZIA 3K8DA 2XWLA 4LW6A 3VBIA 2V0KA 3U2UA 2WLFA 1G3LA 5U2KA 4FRBA 4AYLA 3R2WA 4DDZA 2YQHA 3V4EA 3ECTA 2D7RA 1FR8A 1KK4A 5AJOA 1ZJ2A 4IHFA 1INIA 1O23B 2OEGA 2QGIA 1VM8A 4AC3A 1FXOA 3BCVA 3EEVA 2X5ZA 1WT0A 4EEAA 3T7MA 5ADXU 1FGXA 3E25A 2YC3A 4M4KA 4Y7UA 1ZJ3A 4B3UA 1H5RB 3N9WA 4P02A 4AYJA 2WVLA 3CJ8A 1IINA 4EE3A 4B4BA 4NAKA 5C4EA 1V67A 1HM0A 4FRAA 2RIZA 5CMGX 1ZI4A 2GGQA 4FREA 1WT3A 4L41C 1S80A 2ICYA 3OH3A 2QIAA 3SX5A 3JUKA 5C1GA 3SPTA 4Y9XA 3R5CA 4B5BA 4BQHA 4IHHA 1H7LA 3C8VA 5AJPA 1VGWA 1VICA 2Y4KA 2ZU8A 3I3AA 1WT2A 1KQAA 3U0XA 3FS8A 2IU9A 1G23A 1NHEB 4KPZA 4Y7TA 2AH9A 2ZU7A 4ARWA 2UX8A 1FGGA 1H4DA 1FG5N 3V0PA 4B2XA 3PMOA 4M2BA 2AESA 4E1KA 2BO6A 3BSWA 3OH2A 4EA9A 4DCLA 1QGQA 1MP3A 1QRLA 2NXVA 3HSQA 4B4GA 2VSHA 3POLA 2WAWA 3OAMA 3LW6A 1LZ0A 3GVDA 2Q4JA 1WSZA 4AA7A 1S4PA 3V0NA 3SXGA 1KRRA 1FO9A 4M28A 3P1BA 1H5SC 3BSYA 1LL0A 1ZI3A 4ZDQA 3I0LA 4EABA 3CKQA 5FYEA 3U2XA 1KHRA 1QREA 1ZHJA 1ZIZA 4EE4A 1R81A 4FRDA 4R36A 4N69A 2JCJA 2O1HA 3EE5A 1HJLA 2PGYA 4G3QA 1V83A 1NKHB 1NWGB 1WVCA 5CQMX 4KXOA 4HO6A 3OUPA 3MQGA 5EJZA 1G0RA 3KIAA 4KPXA 3JTJA 2APCA 1H7TA 3EH0A 1J2ZA 5JQQA 1O0RA 3DK5A 1JYLA 1V82A 2JCOA 2Y4LA 2P2OA 1KWSA 4HG6A 3F1XA 4GBPA 1QRFA 1QG8A 1ZDFA 3V0OA 4E6UA 2FFUA 5C3BA 3V91A 1ZJOA 2VD4A 4G3SA 4MYBA 1KRVA 2RJ5A 3USQA 2VS5A 1GQ9A 3IGJA 1PZYB 5C3AA 2RJ1A 3FSBA 2FYBA 3GUEA 2A8UA 1G95A 2VHEA 3TV0A 4D48A 5C47A 4Y64A 2IC7A 4EE5A 3I3XA 4FRLA 3R3RA 5C1HA 1VH3A 2RIJA 5BXCA 4N6BA 3TDTA 2RJ6A 2VS3A 5CQLX 2JF3A 3USRA 4Y7FA 5CQOA 2Y4MA 4Y62A 3CGXA 3SXAA 1JVDA 1VGZA 3NZ2A 4EAAA 1TW1A 1TZFA 1ON8A 1VPAA 2Z87A 4HO9A 1V3WA 1OMXA 4ASJA 3TIOA 1QRGA 2RJ7A 1R7VA 2D0JA 3CKVA 3DJ4A 1Z90A 2I5EA 3RMWA 4HO8A 3BRKX 2JCLA 5C4BA 1ON6A 3FWWA 3D98A 2ZU9A 2W0VA 3TWDA 4CJCA 3T57A 2XMHA 3U2VA 1ZJ0A 1HJJA 3T7OA 5HS2A 2WE9A 4IRQA 4EA7A 2RITA 3R3IA 2YQSA 4EGGA 2IU8A 1MRLA 3MQHA 3PNNA 3FOQA 1JVGA 3PKPA 4Y7VA 3P47A 1JYKA 1R82A 3I0KA 4NANA 4KC1A 2BO4A 3KWCA 1W57A 1KGTA 1FWYA 2DPWA 5CMIA 3R0SA 3SX7A 5IDTA 4FRMA 5L6VA 1G1LA 3I0HA 1NQIB 4JISA 1PZTA 3V0MA 3F1CA 2FYCB 5C4DA 2RJ4A 2RIYA 2XWMA 1VGTA 1G97A 3I0JA 3U0YA 3V8YA 2O1FA 4B42A 5J49A 4G87A 4KT7A 3Q1XA 1QQ0A 1QWJA 2WEEA 4FROA 3DHOA 4EQYA 1O7OA 5E3RA 4D0ZA 3ZGFA 2YQJA 1ZI5A 1THJA 2X60A 2BO8A 2TDTA 1IIMA 1YROB 2YC5A 2OI5A 3I0CA 5FU8A 2FYDB 1HM9A 3F1YA 1T3DA 2QKXA 1EYRA 5E3QA 1QRMA 5C36A 3BXYA 1SSTA 2RJ0A 3OTZA 3FTTA 4DECA 3I0EA 2AGDA 2AM4A 1TVYA 2P72A 4KNXA 1VZUA 1OQMB 5F42A 2P73A 1ZCUA 3CKOA 4D11C 4MYOA 2FYAA 1XZ6A 2AE7A 3SX8A 4EA8A 3FSYA 2GGOA 1YP2A 1R7UA 2XMEA 4AAWA 3TZTA 3U2TA 4EEGA 3TQDA 5E3PA 1NMMB 1SS9A 1H7EA 3IOIA 2PA4A 3IOJA 1H5SD 3D5NA 4Y6UA 3ZLLA 2CU2A 3R5AA 1GX0A 1K4VA 5CMJA 3R8YA 2WLCA 2MZBA 2YQCA 3HL3A 3OTMA 1EZIA 3SXCA 2O1GA 4R37A 4Y63A 1I52A 1G2VA 3OH0A 4FRHA 1H7HA 1LVWA 5FU0A 4KNRA 4R7PA 2AM5A 1YP3A 2BO7A 3VBPA 4NALA 2E8BA 3R1WA 3I0IX 4HZDA 2AM3A 2AQ9A 1LZJA 3Q80A 3DUVA 4D0TA 4M2AA 5CQPA 2RJ8A 2VFZA 3K8EA 4JD0A 3V0QA 2QH5A 3R5BA 3CKJA 1ZCVA 1XHDA 1R7YA 4LW3A 3OC9A 3ZGGA 4C2SA 5DEMA 5CQNX 1FR9A 5DDTA 5FV9A 5FUHA 1HM8A 1H4CA 1MR7A 1H5SB 1R7TA 2ICXA 4HO4A 4FCEA 3RMVA 4M9CA 5C4CA 1SSMA 3ZLKA 1LXAA 4E6TA 4ISXA 3KWEA 2Y4JA 1WT1A 4K6RA 3V0LA 1S4NA 1ZI1A 4CJ8A 3CKNA 1MP5A 2PGVA 2Y7AA 1LZ7A 3OGZA 4HCQA 1GA8A 1JV3A 4EVWA 3R5DA 2JF2A 2FY7A 2X65A 2V0IA 2OI6A 4EEOA 5DG3A 4B4MA 1OCXA 3O3PA 4HUSA 1H5RA 1TW5A 5CMFX 4IRPA 3KWDA 1R7XA 1INJA 1W55A 4KQLA 1G8OA 2I5KA 1H7QA 4HZCA 2OI7A 1ZCYA 4ASYA 2Z86A 4H7OA 1H4EA 4FCUA 2YCMA 1R80A 3OH4A 3EG4A 4J18A 2V0JA 1GX4A 1MR9A 1G93A 3I0DA 1YP4A 4FRQA 1VZTA 3D8VA 5CMHA 2I7BA 3SRTA 3VBLA 1VZXA 5DEPA 3NGWA 3ST8A 1LL2A 3BSSA 1H5TB 4MNDA 3V90A 3E26A 4D11A 3SXBA 1VGUA 4XWIA 4YS8A 4N27A 4CJBA 2JCKA 4MZUA 3IOHA 4KC2A 2QIVX 1H7FA 4IHGA 2VXMA 5C38A 4KC4A 4BMAA 5IDSA 1ZJPA 3VBJA 5C3DA 2P6WA 1E5KA 1V84A 5C48A 2AECA 3RSBA 1KRUA 2IUAA 2XWNA 3T7NA 3VNPA 4KRVA 3SX3A 3U2WA 1GQCA 3I0FA 1H7GA 3I0GA 1FXJA 3FSXA 4P00A 1LL3A 1KK5A 1H3MA 2WVMA 4DE7A 5IFYA 1JV1A 1XHBA 3CU0A 3OW5A 3BFPA 1XATA 4MFGA 2FKOA 2VXLA 4HURA 3ZF8A 1FZWA 3VBKA 2V0HA 4G3PA 1NF5B 3JUJA 2D7IA 3Q4SA 3MC4A 3Q7UA 4HO3A 4EEMA 3GOSA 5AFUU 2WVKA 4FQWA 4HO5A 3VBMA 1ZDGA 1VH1A 2X5SA 1TDTA 2XATA 3JQYA 2FFVA 4NAIA 2YESA 3OU9A 4ECMA 5I1FA 1FO8A 1FRWA 3TISA 3VBNA 4N6AA 1W77A 4E75A 1S4OA 2W0WA 5FTSA 1G9RA 5AFUV 1OMZA
chains in the Genus database with same CATH superfamily
1O7QA 4HOCA 1GWVA 1HV9A 2V0LA 1H5TA 5EIYA 1KGQA 1ZCTA 3TK8A 2WGZA 1FOAA 1QGSA 3OH1A 2A8WA 4J09A 4M98A 1KK6A 1SSQA 3HJJA 5ADXV 1ZJ1A 3QVBA 3SXEA 2RIXA 5C4FA 5AJNA 2OEFA 2E3DA 4UEGA 2WLGA 1MC3A 3SXDA 3IXCA 3V8ZA 2RJ9A 4HO2A 1MP4A 5DDVA 2WLDA 2WLEA 1H5SA 2PX7A 2VSIA 3FSCA 5FTVA 3GQ9A 1GWWA 4HO0A 5C8RA 4FRPA 4Y6NA 4Y7GA 4B2WA 2NPOA 5C49A 5L6SA 4CVHA 4E79A 2VS4A 3PKQA 2Y6PA 5EJ1A 3OKRA 2J0AA 5C1LA 4M99A 1LZIA 3K8DA 2XWLA 4LW6A 3VBIA 2V0KA 3U2UA 2WLFA 1G3LA 5U2KA 4FRBA 4AYLA 3R2WA 4DDZA 2YQHA 3V4EA 3ECTA 2D7RA 1FR8A 1KK4A 2C0NA 1ZJ2A 5AJOA 4IHFA 1INIA 1O23B 2OEGA 2QGIA 1VM8A 4AC3A 1FXOA 3BCVA 3EEVA 2X5ZA 1L0SA 1WT0A 3T7MA 4EEAA 5ADXU 1FGXA 3E25A 2YC3A 4M4KA 3GQ7A 4Y7UA 1ZJ3A 4B3UA 1H5RB 3N9WA 4P02A 4AYJA 2WVLA 3CJ8A 1IINA 4EE3A 4B4BA 4NAKA 5C4EA 1V67A 1HM0A 4FRAA 2RIZA 5CMGX 1ZI4A 2GGQA 4FREA 1WT3A 4L41C 1S80A 2ICYA 3OH3A 2QIAA 3SX5A 3JUKA 5C1GA 3SPTA 4Y9XA 3R5CA 4B5BA 4BQHA 4IHHA 1N4IA 1H7LA 3C8VA 5AJPA 1VGWA 1VICA 2Y4KA 2ZU8A 3I3AA 1WT2A 1KQAA 3U0XA 3FS8A 2IU9A 1G23A 1NHEB 4KPZA 4Y7TA 2AH9A 2ZU7A 4ARWA 2UX8A 1FGGA 1H4DA 1FG5N 3V0PA 4B2XA 3OH2A 3PMOA 4M2BA 4E1KA 2AESA 3BSWA 2BO6A 4EA9A 4DCLA 5D92A 1QGQA 1MP3A 1QRLA 2NXVA 5D91A 3HSQA 4B4GA 2VSHA 3POLA 2WAWA 3OAMA 3LW6A 1LZ0A 3GVDA 2Q4JA 2J0BA 1WSZA 4AA7A 1S4PA 3V0NA 4MIXA 3SXGA 1KRRA 4Q7CA 1FO9A 4M28A 3P1BA 1H5SC 3BSYA 1LL0A 1ZI3A 4ZDQA 3I0LA 4EABA 3CKQA 5FYEA 3U2XA 1KHRA 1QREA 1ZHJA 1ZIZA 4EE4A 1R81A 3SUCA 4FRDA 4R36A 4N69A 2JCJA 2O1HA 3EE5A 1HJLA 2PGYA 4G3QA 1V83A 1NKHB 1NWGB 1WVCA 5CQMX 4KXOA 4HO6A 3OUPA 3MQGA 5EJZA 1G0RA 3KIAA 4KPXA 3JTJA 2APCA 1H7TA 3EH0A 1J2ZA 5JQQA 1O0RA 3DK5A 1JYLA 1V82A 2JCOA 2Y4LA 1EWWA 2P2OA 1KWSA 4HG6A 3F1XA 4GBPA 1QRFA 1QG8A 1ZDFA 3V0OA 4E6UA 2FFUA 5C3BA 3V91A 1ZJOA 2VD4A 4G3SA 4MYBA 1KRVA 2RJ5A 3USQA 2VS5A 1GQ9A 3IGJA 1PZYB 5C3AA 2RJ1A 3FSBA 2FYBA 3GUEA 2A8UA 1G95A 2VHEA 3TV0A 4D48A 5C47A 4Y64A 2IC7A 4EE5A 3I3XA 4FRLA 3R3RA 5C1HA 1VH3A 2RIJA 5BXCA 4N6BA 3TDTA 2RJ6A 2VS3A 5CQLX 2JF3A 3USRA 4Y7FA 5CQOA 2Y4MA 4Y62A 3CGXA 3SXAA 1JVDA 1VGZA 3NZ2A 4EAAA 1TW1A 1TZFA 1ON8A 1VPAA 2Z87A 4HO9A 1V3WA 1OMXA 4ASJA 3TIOA 1QRGA 2RJ7A 1R7VA 2D0JA 3CKVA 3DJ4A 1Z90A 2I5EA 3RMWA 4HO8A 3BRKX 2JCLA 5C4BA 1ON6A 3FWWA 3D98A 2ZU9A 2W0VA 3TWDA 4CJCA 3T57A 2XMHA 3U2VA 1ZJ0A 1HJJA 3T7OA 5HS2A 2WE9A 4IRQA 4EA7A 2RITA 3R3IA 2YQSA 4EGGA 2IU8A 1MRLA 3MQHA 3PNNA 3FOQA 1JVGA 3PKPA 4Y7VA 3P47A 1JYKA 1R82A 3I0KA 4NANA 4KC1A 2BO4A 3KWCA 1W57A 1KGTA 1FWYA 2DPWA 5CMIA 3R0SA 3SX7A 5IDTA 4FRMA 5L6VA 1G1LA 3I0HA 1NQIB 4JISA 1PZTA 3V0MA 3F1CA 2FYCB 5C4DA 2RJ4A 2RIYA 2XWMA 1VGTA 1G97A 3I0JA 3U0YA 3V8YA 2O1FA 4B42A 5J49A 4G87A 4KT7A 3Q1XA 1QQ0A 1QWJA 2WEEA 4FROA 3DHOA 4EQYA 1O7OA 5E3RA 4D0ZA 3ZGFA 2YQJA 1ZI5A 4O6NA 1THJA 2X60A 2BO8A 2TDTA 1IIMA 1YROB 2YC5A 2OI5A 3I0CA 5FU8A 2FYDB 1HM9A 3F1YA 1T3DA 2QKXA 1EYRA 5E3QA 1QRMA 5C36A 3BXYA 1SSTA 2RJ0A 3OTZA 3FTTA 4DECA 3I0EA 2AGDA 1M8NA 2AM4A 1TVYA 4O6MA 2P72A 4KNXA 1VZUA 1OQMB 5F42A 2P73A 1ZCUA 3CKOA 4D11C 4MYOA 2FYAA 1XZ6A 2AE7A 3SX8A 4EA8A 3FSYA 2GGOA 1YP2A 3GQAA 1R7UA 4AAWA 2XMEA 3TZTA 3U2TA 4EEGA 3TQDA 5E3PA 1NMMB 1SS9A 1H7EA 3IOIA 2PA4A 3IOJA 1H5SD 3D5NA 4Y6UA 3ZLLA 2CU2A 3R5AA 1GX0A 1K4VA 5CMJA 3R8YA 2WLCA 2MZBA 2YQCA 3HL3A 3OTMA 1EZIA 3SXCA 2O1GA 4R37A 4Y63A 1I52A 1G2VA 3OH0A 4FRHA 1H7HA 1LVWA 5FU0A 4KNRA 4R7PA 2AM5A 1YP3A 2BO7A 3VBPA 4NALA 2E8BA 3R1WA 3I0IX 4HZDA 2AM3A 2AQ9A 3GQ8A 1LZJA 3Q80A 3DUVA 4D0TA 4M2AA 5CQPA 2RJ8A 2VFZA 3K8EA 4JD0A 3V0QA 2QH5A 3R5BA 3CKJA 1ZCVA 1XHDA 1R7YA 4FIXA 3OC9A 4LW3A 3ZGGA 4C2SA 5DEMA 5CQNX 1FR9A 5DDTA 5FV9A 5FUHA 1HM8A 1H4CA 1MR7A 1H5SB 1R7TA 2ICXA 4HO4A 4FCEA 3RMVA 4M9CA 5C4CA 1SSMA 3ZLKA 1LXAA 4E6TA 4ISXA 3KWEA 2Y4JA 1WT1A 4K6RA 3V0LA 1S4NA 1ZI1A 4CJ8A 3CKNA 1MP5A 2PGVA 2Y7AA 1LZ7A 3OGZA 4HCQA 1GA8A 1JV3A 4EVWA 3R5DA 2JF2A 2FY7A 2X65A 2V0IA 2OI6A 4EEOA 5DG3A 4B4MA 1OCXA 3O3PA 4HUSA 1H5RA 1TW5A 5CMFX 2VK9A 4IRPA 3KWDA 1R7XA 1INJA 1W55A 4KQLA 1G8OA 2I5KA 1H7QA 4HZCA 2OI7A 1ZCYA 4ASYA 2Z86A 4H7OA 1H4EA 4FCUA 2YCMA 1R80A 3OH4A 3EG4A 4J18A 2V0JA 1GX4A 1MR9A 1G93A 3I0DA 1YP4A 4FRQA 1VZTA 3D8VA 5CMHA 2I7BA 3SRTA 3VBLA 1VZXA 5DEPA 3NGWA 3ST8A 1LL2A 3BSSA 1H5TB 4MNDA 3V90A 3E26A 4D11A 3SXBA 1VGUA 4XWIA 4YS8A 4N27A 4CJBA 2JCKA 4MZUA 3IOHA 4KC2A 2QIVX 1H7FA 4IHGA 2VXMA 5C38A 4KC4A 4BMAA 5IDSA 1ZJPA 3VBJA 5C3DA 2P6WA 1E5KA 1V84A 5C48A 2AECA 3RSBA 1KRUA 2IUAA 2XWNA 3T7NA 3VNPA 4KRVA 3SX3A 3U2WA 1GQCA 3I0FA 1H7GA 3I0GA 1FXJA 3FSXA 4P00A 1LL3A 1KK5A 1H3MA 2WVMA 4DE7A 5IFYA 4FIYA 1JV1A 1XHBA 1Z2FA 3CU0A 3OW5A 3BFPA 1XATA 4MFGA 2FKOA 2VXLA 4HURA 3ZF8A 1FZWA 3VBKA 2V0HA 4G3PA 1NF5B 3JUJA 2D7IA 3Q4SA 3MC4A 3Q7UA 4HO3A 4EEMA 3GOSA 5AFUU 2WVKA 4FQWA 4HO5A 3VBMA 1ZDGA 1VH1A 2X5SA 1TDTA 2XATA 3JQYA 2FFVA 4NAIA 2YESA 3OU9A 4ECMA 5I1FA 1FO8A 1FRWA 3TISA 3VBNA 4N6AA 1W77A 4E75A 1S4OA 2W0WA 5FTSA 1G9RA 5AFUV 1OMZA
chains in the Genus database with same CATH topology
1O7QA 4HOCA 1GWVA 1HV9A 2V0LA 1H5TA 5EIYA 1KGQA 1ZCTA 3TK8A 2WGZA 1FOAA 1QGSA 3OH1A 2A8WA 4J09A 4M98A 1KK6A 1SSQA 3HJJA 5ADXV 1ZJ1A 3QVBA 3SXEA 2RIXA 5C4FA 5AJNA 2OEFA 2E3DA 4UEGA 2WLGA 1MC3A 3SXDA 3IXCA 3V8ZA 2RJ9A 4HO2A 1MP4A 5DDVA 2WLDA 2WLEA 1H5SA 2PX7A 2VSIA 3FSCA 5FTVA 1GWWA 4HO0A 5C8RA 4FRPA 4Y6NA 4Y7GA 4B2WA 2NPOA 5C49A 5L6SA 4CVHA 4E79A 2VS4A 3PKQA 2Y6PA 5EJ1A 3OKRA 2J0AA 5C1LA 4M99A 1LZIA 3K8DA 2XWLA 4LW6A 3VBIA 2V0KA 3U2UA 2WLFA 1G3LA 5U2KA 4FRBA 4AYLA 3R2WA 4DDZA 2YQHA 3V4EA 3ECTA 2D7RA 1FR8A 1KK4A 2C0NA 1ZJ2A 5AJOA 4IHFA 1INIA 1O23B 2OEGA 2QGIA 1VM8A 4AC3A 1FXOA 3BCVA 3EEVA 2X5ZA 1WT0A 4EEAA 3T7MA 5ADXU 1FGXA 3E25A 2YC3A 4M4KA 4Y7UA 1ZJ3A 4B3UA 1H5RB 3N9WA 4P02A 4AYJA 2WVLA 3CJ8A 1IINA 4EE3A 4B4BA 4NAKA 5C4EA 1V67A 1HM0A 4FRAA 2RIZA 5CMGX 1ZI4A 2GGQA 4FREA 1WT3A 4L41C 1S80A 2ICYA 3OH3A 2QIAA 3SX5A 3JUKA 5C1GA 3SPTA 4Y9XA 3R5CA 4B5BA 4BQHA 4IHHA 1H7LA 3C8VA 5AJPA 1VGWA 1VICA 2Y4KA 2ZU8A 3I3AA 1WT2A 1KQAA 3U0XA 3FS8A 2IU9A 1G23A 1NHEB 4KPZA 4Y7TA 2AH9A 2ZU7A 4ARWA 2UX8A 1FGGA 1H4DA 1FG5N 3V0PA 4B2XA 3PMOA 4M2BA 2AESA 4E1KA 2BO6A 3BSWA 3OH2A 4EA9A 4DCLA 5D92A 1QGQA 1MP3A 1QRLA 2NXVA 5D91A 3HSQA 4B4GA 2VSHA 3POLA 2WAWA 3OAMA 3LW6A 1LZ0A 3GVDA 2Q4JA 2J0BA 1WSZA 4AA7A 1S4PA 3V0NA 4MIXA 3SXGA 1KRRA 4Q7CA 1FO9A 4M28A 3P1BA 1H5SC 3BSYA 1LL0A 1ZI3A 4ZDQA 3I0LA 4EABA 3CKQA 5FYEA 3U2XA 1KHRA 1QREA 1ZHJA 1ZIZA 4EE4A 1R81A 4FRDA 4R36A 4N69A 2JCJA 2O1HA 3EE5A 1HJLA 2PGYA 4G3QA 1V83A 1NKHB 1NWGB 1WVCA 5CQMX 4KXOA 4HO6A 3OUPA 3MQGA 5EJZA 1G0RA 3KIAA 4KPXA 3JTJA 2APCA 1H7TA 3EH0A 1J2ZA 5JQQA 1O0RA 3DK5A 1JYLA 1V82A 2JCOA 2Y4LA 2P2OA 1KWSA 4HG6A 3F1XA 4GBPA 1QRFA 1QG8A 1ZDFA 3V0OA 4E6UA 2FFUA 5C3BA 3V91A 1ZJOA 2VD4A 4G3SA 4MYBA 1KRVA 2RJ5A 3USQA 2VS5A 1GQ9A 3IGJA 1PZYB 5C3AA 2RJ1A 3FSBA 2FYBA 3GUEA 2A8UA 1G95A 2VHEA 3TV0A 4D48A 5C47A 4Y64A 2IC7A 4EE5A 3I3XA 4FRLA 3R3RA 5C1HA 1VH3A 2RIJA 5BXCA 4N6BA 3TDTA 2RJ6A 2VS3A 5CQLX 2JF3A 3USRA 4Y7FA 5CQOA 2Y4MA 4Y62A 3CGXA 3SXAA 1JVDA 1VGZA 3NZ2A 4EAAA 1TW1A 1TZFA 1ON8A 1VPAA 2Z87A 4HO9A 1V3WA 1OMXA 4ASJA 3TIOA 1QRGA 2RJ7A 1R7VA 2D0JA 3CKVA 3DJ4A 1Z90A 2I5EA 3RMWA 4HO8A 3BRKX 2JCLA 5C4BA 1ON6A 3FWWA 3D98A 2ZU9A 2W0VA 3TWDA 4CJCA 3T57A 2XMHA 3U2VA 1ZJ0A 1HJJA 3T7OA 5HS2A 2WE9A 4IRQA 4EA7A 2RITA 3R3IA 2YQSA 4EGGA 2IU8A 1MRLA 3MQHA 3PNNA 3FOQA 1JVGA 3PKPA 4Y7VA 3P47A 1JYKA 1R82A 3I0KA 4NANA 4KC1A 2BO4A 3KWCA 1W57A 1KGTA 1FWYA 2DPWA 5CMIA 3R0SA 3SX7A 5IDTA 4FRMA 5L6VA 1G1LA 3I0HA 1NQIB 4JISA 1PZTA 3V0MA 3F1CA 2FYCB 5C4DA 2RJ4A 2RIYA 2XWMA 1VGTA 1G97A 3I0JA 3U0YA 3V8YA 2O1FA 4B42A 5J49A 4G87A 4KT7A 3Q1XA 1QQ0A 1QWJA 2WEEA 4FROA 3DHOA 4EQYA 1O7OA 5E3RA 4D0ZA 3ZGFA 2YQJA 1ZI5A 4O6NA 1THJA 2X60A 2BO8A 2TDTA 1IIMA 1YROB 2YC5A 2OI5A 3I0CA 5FU8A 2FYDB 1HM9A 3F1YA 1T3DA 2QKXA 1EYRA 5E3QA 1QRMA 5C36A 3BXYA 1SSTA 2RJ0A 3OTZA 3FTTA 4DECA 3I0EA 2AGDA 2AM4A 1TVYA 4O6MA 2P72A 4KNXA 1VZUA 1OQMB 5F42A 2P73A 1ZCUA 3CKOA 4D11C 4MYOA 2FYAA 1XZ6A 2AE7A 3SX8A 4EA8A 3FSYA 2GGOA 1YP2A 1R7UA 2XMEA 4AAWA 3TZTA 3U2TA 4EEGA 3TQDA 5E3PA 1NMMB 1SS9A 1H7EA 3IOIA 2PA4A 3IOJA 1H5SD 3D5NA 4Y6UA 3ZLLA 2CU2A 3R5AA 1GX0A 1K4VA 5CMJA 3R8YA 2WLCA 2MZBA 2YQCA 3HL3A 3OTMA 1EZIA 3SXCA 2O1GA 4R37A 4Y63A 1I52A 1G2VA 3OH0A 4FRHA 1H7HA 1LVWA 5FU0A 4KNRA 4R7PA 2AM5A 1YP3A 2BO7A 3VBPA 4NALA 2E8BA 3R1WA 3I0IX 4HZDA 2AM3A 2AQ9A 1LZJA 3Q80A 3DUVA 4D0TA 4M2AA 5CQPA 2RJ8A 2VFZA 3K8EA 4JD0A 3V0QA 2QH5A 3R5BA 3CKJA 1ZCVA 1XHDA 1R7YA 4FIXA 3OC9A 4LW3A 3ZGGA 4C2SA 5DEMA 5CQNX 1FR9A 5DDTA 5FV9A 5FUHA 1HM8A 1H4CA 1MR7A 1H5SB 1R7TA 2ICXA 4HO4A 4FCEA 3RMVA 4M9CA 5C4CA 1SSMA 3ZLKA 1LXAA 4E6TA 4ISXA 3KWEA 2Y4JA 1WT1A 4K6RA 3V0LA 1S4NA 1ZI1A 4CJ8A 3CKNA 1MP5A 2PGVA 2Y7AA 1LZ7A 3OGZA 4HCQA 1GA8A 1JV3A 4EVWA 3R5DA 2JF2A 2FY7A 2X65A 2V0IA 2OI6A 4EEOA 5DG3A 4B4MA 1OCXA 3O3PA 4HUSA 1H5RA 1TW5A 5CMFX 2VK9A 4IRPA 3KWDA 1R7XA 1INJA 1W55A 4KQLA 1G8OA 2I5KA 1H7QA 4HZCA 2OI7A 1ZCYA 4ASYA 2Z86A 4H7OA 1H4EA 4FCUA 2YCMA 1R80A 3OH4A 3EG4A 4J18A 2V0JA 1GX4A 1MR9A 1G93A 3I0DA 1YP4A 4FRQA 1VZTA 3D8VA 5CMHA 2I7BA 3SRTA 3VBLA 1VZXA 5DEPA 3NGWA 3ST8A 1LL2A 3BSSA 1H5TB 4MNDA 3V90A 3E26A 4D11A 3SXBA 1VGUA 4XWIA 4YS8A 4N27A 4CJBA 2JCKA 4MZUA 3IOHA 4KC2A 2QIVX 1H7FA 4IHGA 2VXMA 5C38A 4KC4A 4BMAA 5IDSA 1ZJPA 3VBJA 5C3DA 2P6WA 1E5KA 1V84A 5C48A 2AECA 3RSBA 1KRUA 2IUAA 2XWNA 3T7NA 3VNPA 4KRVA 3SX3A 3U2WA 1GQCA 3I0FA 1H7GA 3I0GA 1FXJA 3FSXA 4P00A 1LL3A 1KK5A 1H3MA 2WVMA 4DE7A 5IFYA 4FIYA 1JV1A 1XHBA 3CU0A 3OW5A 3BFPA 1XATA 4MFGA 2FKOA 2VXLA 4HURA 3ZF8A 1FZWA 3VBKA 2V0HA 4G3PA 1NF5B 3JUJA 2D7IA 3Q4SA 3MC4A 3Q7UA 4HO3A 4EEMA 3GOSA 5AFUU 2WVKA 4FQWA 4HO5A 3VBMA 1ZDGA 1VH1A 2X5SA 1TDTA 2XATA 3JQYA 2FFVA 4NAIA 2YESA 3OU9A 4ECMA 5I1FA 1FO8A 1FRWA 3TISA 3VBNA 4N6AA 1W77A 4E75A 1S4OA 2W0WA 5FTSA 1G9RA 5AFUV 1OMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Q A;  4HOC A;  1GWV A;  1HV9 A;  2V0L A;  1H5T A;  5EIY A;  1KGQ A;  1ZCT A;  3TK8 A;  2WGZ A;  1FOA A;  1QGS A;  3OH1 A;  2A8W A;  4J09 A;  4M98 A;  1KK6 A;  1SSQ A;  3HJJ A;  5ADX V;  1ZJ1 A;  3QVB A;  3SXE A;  2RIX A;  5C4F A;  5AJN A;  2OEF A;  2E3D A;  4UEG A;  2WLG A;  1MC3 A;  3SXD A;  3IXC A;  3V8Z A;  2RJ9 A;  4HO2 A;  1MP4 A;  5DDV A;  2WLD A;  2WLE A;  1H5S A;  2PX7 A;  2VSI A;  3FSC A;  5FTV A;  1GWW A;  4HO0 A;  5C8R A;  4FRP A;  4Y6N A;  4Y7G A;  4B2W A;  2NPO A;  5C49 A;  5L6S A;  4CVH A;  4E79 A;  2VS4 A;  3PKQ A;  2Y6P A;  5EJ1 A;  3OKR A;  5C1L A;  4M99 A;  1LZI A;  3K8D A;  2XWL A;  4LW6 A;  3VBI A;  2V0K A;  3U2U A;  2WLF A;  1G3L A;  5U2K A;  4FRB A;  4AYL A;  3R2W A;  4DDZ A;  2YQH A;  3V4E A;  3ECT A;  2D7R A;  1FR8 A;  1KK4 A;  5AJO A;  1ZJ2 A;  4IHF A;  1INI A;  1O23 B;  2OEG A;  2QGI A;  1VM8 A;  4AC3 A;  1FXO A;  3BCV A;  3EEV A;  2X5Z A;  1WT0 A;  4EEA A;  3T7M A;  5ADX U;  1FGX A;  3E25 A;  2YC3 A;  4M4K A;  4Y7U A;  1ZJ3 A;  4B3U A;  1H5R B;  3N9W A;  4P02 A;  4AYJ A;  2WVL A;  3CJ8 A;  1IIN A;  4EE3 A;  4B4B A;  4NAK A;  5C4E A;  1V67 A;  1HM0 A;  4FRA A;  2RIZ A;  5CMG X;  1ZI4 A;  2GGQ A;  4FRE A;  1WT3 A;  4L41 C;  1S80 A;  2ICY A;  3OH3 A;  2QIA A;  3SX5 A;  3JUK A;  5C1G A;  3SPT A;  4Y9X A;  3R5C A;  4B5B A;  4BQH A;  4IHH A;  1H7L A;  3C8V A;  5AJP A;  1VGW A;  1VIC A;  2Y4K A;  2ZU8 A;  3I3A A;  1WT2 A;  1KQA A;  3U0X A;  3FS8 A;  2IU9 A;  1G23 A;  1NHE B;  4KPZ A;  4Y7T A;  2AH9 A;  2ZU7 A;  4ARW A;  2UX8 A;  1FGG A;  1H4D A;  1FG5 N;  3V0P A;  4B2X A;  3PMO A;  4M2B A;  2AES A;  4E1K A;  2BO6 A;  3BSW A;  3OH2 A;  4EA9 A;  4DCL A;  1QGQ A;  1MP3 A;  1QRL A;  2NXV A;  3HSQ A;  4B4G A;  2VSH A;  3POL A;  2WAW A;  3OAM A;  3LW6 A;  1LZ0 A;  3GVD A;  2Q4J A;  1WSZ A;  4AA7 A;  1S4P A;  3V0N A;  3SXG A;  1KRR A;  1FO9 A;  4M28 A;  3P1B A;  1H5S C;  3BSY A;  1LL0 A;  1ZI3 A;  4ZDQ A;  3I0L A;  4EAB A;  3CKQ A;  5FYE A;  3U2X A;  1KHR A;  1QRE A;  1ZHJ A;  1ZIZ A;  4EE4 A;  1R81 A;  4FRD A;  4R36 A;  4N69 A;  2JCJ A;  2O1H A;  3EE5 A;  1HJL A;  2PGY A;  4G3Q A;  1V83 A;  1NKH B;  1NWG B;  1WVC A;  5CQM X;  4KXO A;  4HO6 A;  3OUP A;  3MQG A;  5EJZ A;  1G0R A;  3KIA A;  4KPX A;  3JTJ A;  2APC A;  1H7T A;  3EH0 A;  1J2Z A;  5JQQ A;  1O0R A;  3DK5 A;  1JYL A;  1V82 A;  2JCO A;  2Y4L A;  2P2O A;  1KWS A;  4HG6 A;  3F1X A;  4GBP A;  1QRF A;  1QG8 A;  1ZDF A;  3V0O A;  4E6U A;  2FFU A;  5C3B A;  3V91 A;  1ZJO A;  2VD4 A;  4G3S A;  4MYB A;  1KRV A;  2RJ5 A;  3USQ A;  2VS5 A;  1GQ9 A;  3IGJ A;  1PZY B;  5C3A A;  2RJ1 A;  3FSB A;  2FYB A;  3GUE A;  2A8U A;  1G95 A;  2VHE A;  3TV0 A;  4D48 A;  5C47 A;  4Y64 A;  2IC7 A;  4EE5 A;  3I3X A;  4FRL A;  3R3R A;  5C1H A;  1VH3 A;  2RIJ A;  5BXC A;  4N6B A;  3TDT A;  2RJ6 A;  2VS3 A;  5CQL X;  2JF3 A;  3USR A;  4Y7F A;  5CQO A;  2Y4M A;  4Y62 A;  3CGX A;  3SXA A;  1JVD A;  1VGZ A;  3NZ2 A;  4EAA A;  1TW1 A;  1TZF A;  1ON8 A;  1VPA A;  2Z87 A;  4HO9 A;  1V3W A;  1OMX A;  4ASJ A;  3TIO A;  1QRG A;  2RJ7 A;  1R7V A;  2D0J A;  3CKV A;  3DJ4 A;  1Z90 A;  2I5E A;  3RMW A;  4HO8 A;  3BRK X;  2JCL A;  5C4B A;  1ON6 A;  3FWW A;  3D98 A;  2ZU9 A;  2W0V A;  3TWD A;  4CJC A;  3T57 A;  2XMH A;  3U2V A;  1ZJ0 A;  1HJJ A;  3T7O A;  5HS2 A;  2WE9 A;  4IRQ A;  4EA7 A;  2RIT A;  3R3I A;  2YQS A;  4EGG A;  2IU8 A;  1MRL A;  3MQH A;  3PNN A;  3FOQ A;  1JVG A;  3PKP A;  4Y7V A;  3P47 A;  1JYK A;  1R82 A;  3I0K A;  4NAN A;  4KC1 A;  2BO4 A;  3KWC A;  1W57 A;  1KGT A;  1FWY A;  2DPW A;  5CMI A;  3R0S A;  3SX7 A;  5IDT A;  4FRM A;  5L6V A;  1G1L A;  3I0H A;  1NQI B;  4JIS A;  1PZT A;  3V0M A;  3F1C A;  2FYC B;  5C4D A;  2RJ4 A;  2RIY A;  2XWM A;  1VGT A;  1G97 A;  3I0J A;  3U0Y A;  3V8Y A;  2O1F A;  4B42 A;  5J49 A;  4G87 A;  4KT7 A;  3Q1X A;  1QQ0 A;  1QWJ A;  2WEE A;  4FRO A;  3DHO A;  4EQY A;  1O7O A;  5E3R A;  4D0Z A;  3ZGF A;  2YQJ A;  1ZI5 A;  1THJ A;  2X60 A;  2BO8 A;  2TDT A;  1IIM A;  1YRO B;  2YC5 A;  2OI5 A;  3I0C A;  5FU8 A;  2FYD B;  1HM9 A;  3F1Y A;  1T3D A;  2QKX A;  1EYR A;  5E3Q A;  1QRM A;  5C36 A;  3BXY A;  1SST A;  2RJ0 A;  3OTZ A;  3FTT A;  4DEC A;  3I0E A;  2AGD A;  2AM4 A;  1TVY A;  2P72 A;  4KNX A;  1VZU A;  1OQM B;  5F42 A;  2P73 A;  1ZCU A;  3CKO A;  4D11 C;  4MYO A;  2FYA A;  1XZ6 A;  2AE7 A;  3SX8 A;  4EA8 A;  3FSY A;  2GGO A;  1YP2 A;  1R7U A;  2XME A;  4AAW A;  3TZT A;  3U2T A;  4EEG A;  3TQD A;  5E3P A;  1NMM B;  1SS9 A;  1H7E A;  3IOI A;  2PA4 A;  3IOJ A;  1H5S D;  3D5N A;  4Y6U A;  3ZLL A;  2CU2 A;  3R5A A;  1GX0 A;  1K4V A;  5CMJ A;  3R8Y A;  2WLC A;  2MZB A;  2YQC A;  3HL3 A;  3OTM A;  1EZI A;  3SXC A;  2O1G A;  4R37 A;  4Y63 A;  1I52 A;  1G2V A;  3OH0 A;  4FRH A;  1H7H A;  1LVW A;  5FU0 A;  4KNR A;  4R7P A;  2AM5 A;  1YP3 A;  2BO7 A;  3VBP A;  4NAL A;  2E8B A;  3R1W A;  3I0I X;  4HZD A;  2AM3 A;  2AQ9 A;  1LZJ A;  3Q80 A;  3DUV A;  4D0T A;  4M2A A;  5CQP A;  2RJ8 A;  2VFZ A;  3K8E A;  4JD0 A;  3V0Q A;  2QH5 A;  3R5B A;  3CKJ A;  1ZCV A;  1XHD A;  1R7Y A;  4LW3 A;  3OC9 A;  3ZGG A;  4C2S A;  5DEM A;  5CQN X;  1FR9 A;  5DDT A;  5FV9 A;  5FUH A;  1HM8 A;  1H4C A;  1MR7 A;  1H5S B;  1R7T A;  2ICX A;  4HO4 A;  4FCE A;  3RMV A;  4M9C A;  5C4C A;  1SSM A;  3ZLK A;  1LXA A;  4E6T A;  4ISX A;  3KWE A;  2Y4J A;  1WT1 A;  4K6R A;  3V0L A;  1S4N A;  1ZI1 A;  4CJ8 A;  3CKN A;  1MP5 A;  2PGV A;  2Y7A A;  1LZ7 A;  3OGZ A;  4HCQ A;  1GA8 A;  1JV3 A;  4EVW A;  3R5D A;  2JF2 A;  2FY7 A;  2X65 A;  2V0I A;  2OI6 A;  4EEO A;  5DG3 A;  4B4M A;  1OCX A;  3O3P A;  4HUS A;  1H5R A;  1TW5 A;  5CMF X;  4IRP A;  3KWD A;  1R7X A;  1INJ A;  1W55 A;  4KQL A;  1G8O A;  2I5K A;  1H7Q A;  4HZC A;  2OI7 A;  1ZCY A;  4ASY A;  2Z86 A;  4H7O A;  1H4E A;  4FCU A;  2YCM A;  1R80 A;  3OH4 A;  3EG4 A;  4J18 A;  2V0J A;  1GX4 A;  1MR9 A;  1G93 A;  3I0D A;  1YP4 A;  4FRQ A;  1VZT A;  3D8V A;  5CMH A;  2I7B A;  3SRT A;  3VBL A;  1VZX A;  5DEP A;  3NGW A;  3ST8 A;  1LL2 A;  3BSS A;  1H5T B;  4MND A;  3V90 A;  3E26 A;  4D11 A;  3SXB A;  1VGU A;  4XWI A;  4YS8 A;  4N27 A;  4CJB A;  2JCK A;  4MZU A;  3IOH A;  4KC2 A;  2QIV X;  1H7F A;  4IHG A;  2VXM A;  5C38 A;  4KC4 A;  4BMA A;  5IDS A;  1ZJP A;  3VBJ A;  5C3D A;  2P6W A;  1E5K A;  1V84 A;  5C48 A;  2AEC A;  3RSB A;  1KRU A;  2IUA A;  2XWN A;  3T7N A;  3VNP A;  4KRV A;  3SX3 A;  3U2W A;  1GQC A;  3I0F A;  1H7G A;  3I0G A;  1FXJ A;  3FSX A;  4P00 A;  1LL3 A;  1KK5 A;  1H3M A;  2WVM A;  4DE7 A;  5IFY A;  1JV1 A;  1XHB A;  3CU0 A;  3OW5 A;  3BFP A;  1XAT A;  4MFG A;  2FKO A;  2VXL A;  4HUR A;  3ZF8 A;  1FZW A;  3VBK A;  2V0H A;  4G3P A;  1NF5 B;  3JUJ A;  2D7I A;  3Q4S A;  3MC4 A;  3Q7U A;  4HO3 A;  4EEM A;  3GOS A;  5AFU U;  2WVK A;  4FQW A;  4HO5 A;  3VBM A;  1ZDG A;  1VH1 A;  2X5S A;  1TDT A;  2XAT A;  3JQY A;  2FFV A;  4NAI A;  2YES A;  3OU9 A;  4ECM A;  5I1F A;  1FO8 A;  1FRW A;  3TIS A;  3VBN A;  4N6A A;  1W77 A;  4E75 A;  1S4O A;  2W0W A;  5FTS A;  1G9R A;  5AFU V;  1OMZ A; 
#chains in the Genus database with same CATH topology
 1O7Q A;  4HOC A;  1GWV A;  1HV9 A;  2V0L A;  1H5T A;  5EIY A;  1KGQ A;  1ZCT A;  3TK8 A;  2WGZ A;  1FOA A;  1QGS A;  3OH1 A;  2A8W A;  4J09 A;  4M98 A;  1KK6 A;  1SSQ A;  3HJJ A;  5ADX V;  1ZJ1 A;  3QVB A;  3SXE A;  2RIX A;  5C4F A;  5AJN A;  2OEF A;  2E3D A;  4UEG A;  2WLG A;  1MC3 A;  3SXD A;  3IXC A;  3V8Z A;  2RJ9 A;  4HO2 A;  1MP4 A;  5DDV A;  2WLD A;  2WLE A;  1H5S A;  2PX7 A;  2VSI A;  3FSC A;  5FTV A;  3GQ9 A;  1GWW A;  4HO0 A;  5C8R A;  4FRP A;  4Y6N A;  4Y7G A;  4B2W A;  2NPO A;  5C49 A;  5L6S A;  4CVH A;  4E79 A;  2VS4 A;  3PKQ A;  2Y6P A;  5EJ1 A;  3OKR A;  2J0A A;  5C1L A;  4M99 A;  1LZI A;  3K8D A;  2XWL A;  4LW6 A;  3VBI A;  2V0K A;  3U2U A;  2WLF A;  1G3L A;  5U2K A;  4FRB A;  4AYL A;  3R2W A;  4DDZ A;  2YQH A;  3V4E A;  3ECT A;  2D7R A;  1FR8 A;  1KK4 A;  2C0N A;  1ZJ2 A;  5AJO A;  4IHF A;  1INI A;  1O23 B;  2OEG A;  2QGI A;  1VM8 A;  4AC3 A;  1FXO A;  3BCV A;  3EEV A;  2X5Z A;  1L0S A;  1WT0 A;  3T7M A;  4EEA A;  5ADX U;  1FGX A;  3E25 A;  2YC3 A;  4M4K A;  3GQ7 A;  4Y7U A;  1ZJ3 A;  4B3U A;  1H5R B;  3N9W A;  4P02 A;  4AYJ A;  2WVL A;  3CJ8 A;  1IIN A;  4EE3 A;  4B4B A;  4NAK A;  5C4E A;  1V67 A;  1HM0 A;  4FRA A;  2RIZ A;  5CMG X;  1ZI4 A;  2GGQ A;  4FRE A;  1WT3 A;  4L41 C;  1S80 A;  2ICY A;  3OH3 A;  2QIA A;  3SX5 A;  3JUK A;  5C1G A;  3SPT A;  4Y9X A;  3R5C A;  4B5B A;  4BQH A;  4IHH A;  1N4I A;  1H7L A;  3C8V A;  5AJP A;  1VGW A;  1VIC A;  2Y4K A;  2ZU8 A;  3I3A A;  1WT2 A;  1KQA A;  3U0X A;  3FS8 A;  2IU9 A;  1G23 A;  1NHE B;  4KPZ A;  4Y7T A;  2AH9 A;  2ZU7 A;  4ARW A;  2UX8 A;  1FGG A;  1H4D A;  1FG5 N;  3V0P A;  4B2X A;  3OH2 A;  3PMO A;  4M2B A;  4E1K A;  2AES A;  3BSW A;  2BO6 A;  4EA9 A;  4DCL A;  5D92 A;  1QGQ A;  1MP3 A;  1QRL A;  2NXV A;  5D91 A;  3HSQ A;  4B4G A;  2VSH A;  3POL A;  2WAW A;  3OAM A;  3LW6 A;  1LZ0 A;  3GVD A;  2Q4J A;  2J0B A;  1WSZ A;  4AA7 A;  1S4P A;  3V0N A;  4MIX A;  3SXG A;  1KRR A;  4Q7C A;  1FO9 A;  4M28 A;  3P1B A;  1H5S C;  3BSY A;  1LL0 A;  1ZI3 A;  4ZDQ A;  3I0L A;  4EAB A;  3CKQ A;  5FYE A;  3U2X A;  1KHR A;  1QRE A;  1ZHJ A;  1ZIZ A;  4EE4 A;  1R81 A;  3SUC A;  4FRD A;  4R36 A;  4N69 A;  2JCJ A;  2O1H A;  3EE5 A;  1HJL A;  2PGY A;  4G3Q A;  1V83 A;  1NKH B;  1NWG B;  1WVC A;  5CQM X;  4KXO A;  4HO6 A;  3OUP A;  3MQG A;  5EJZ A;  1G0R A;  3KIA A;  4KPX A;  3JTJ A;  2APC A;  1H7T A;  3EH0 A;  1J2Z A;  5JQQ A;  1O0R A;  3DK5 A;  1JYL A;  1V82 A;  2JCO A;  2Y4L A;  1EWW A;  2P2O A;  1KWS A;  4HG6 A;  3F1X A;  4GBP A;  1QRF A;  1QG8 A;  1ZDF A;  3V0O A;  4E6U A;  2FFU A;  5C3B A;  3V91 A;  1ZJO A;  2VD4 A;  4G3S A;  4MYB A;  1KRV A;  2RJ5 A;  3USQ A;  2VS5 A;  1GQ9 A;  3IGJ A;  1PZY B;  5C3A A;  2RJ1 A;  3FSB A;  2FYB A;  3GUE A;  2A8U A;  1G95 A;  2VHE A;  3TV0 A;  4D48 A;  5C47 A;  4Y64 A;  2IC7 A;  4EE5 A;  3I3X A;  4FRL A;  3R3R A;  5C1H A;  1VH3 A;  2RIJ A;  5BXC A;  4N6B A;  3TDT A;  2RJ6 A;  2VS3 A;  5CQL X;  2JF3 A;  3USR A;  4Y7F A;  5CQO A;  2Y4M A;  4Y62 A;  3CGX A;  3SXA A;  1JVD A;  1VGZ A;  3NZ2 A;  4EAA A;  1TW1 A;  1TZF A;  1ON8 A;  1VPA A;  2Z87 A;  4HO9 A;  1V3W A;  1OMX A;  4ASJ A;  3TIO A;  1QRG A;  2RJ7 A;  1R7V A;  2D0J A;  3CKV A;  3DJ4 A;  1Z90 A;  2I5E A;  3RMW A;  4HO8 A;  3BRK X;  2JCL A;  5C4B A;  1ON6 A;  3FWW A;  3D98 A;  2ZU9 A;  2W0V A;  3TWD A;  4CJC A;  3T57 A;  2XMH A;  3U2V A;  1ZJ0 A;  1HJJ A;  3T7O A;  5HS2 A;  2WE9 A;  4IRQ A;  4EA7 A;  2RIT A;  3R3I A;  2YQS A;  4EGG A;  2IU8 A;  1MRL A;  3MQH A;  3PNN A;  3FOQ A;  1JVG A;  3PKP A;  4Y7V A;  3P47 A;  1JYK A;  1R82 A;  3I0K A;  4NAN A;  4KC1 A;  2BO4 A;  3KWC A;  1W57 A;  1KGT A;  1FWY A;  2DPW A;  5CMI A;  3R0S A;  3SX7 A;  5IDT A;  4FRM A;  5L6V A;  1G1L A;  3I0H A;  1NQI B;  4JIS A;  1PZT A;  3V0M A;  3F1C A;  2FYC B;  5C4D A;  2RJ4 A;  2RIY A;  2XWM A;  1VGT A;  1G97 A;  3I0J A;  3U0Y A;  3V8Y A;  2O1F A;  4B42 A;  5J49 A;  4G87 A;  4KT7 A;  3Q1X A;  1QQ0 A;  1QWJ A;  2WEE A;  4FRO A;  3DHO A;  4EQY A;  1O7O A;  5E3R A;  4D0Z A;  3ZGF A;  2YQJ A;  1ZI5 A;  4O6N A;  1THJ A;  2X60 A;  2BO8 A;  2TDT A;  1IIM A;  1YRO B;  2YC5 A;  2OI5 A;  3I0C A;  5FU8 A;  2FYD B;  1HM9 A;  3F1Y A;  1T3D A;  2QKX A;  1EYR A;  5E3Q A;  1QRM A;  5C36 A;  3BXY A;  1SST A;  2RJ0 A;  3OTZ A;  3FTT A;  4DEC A;  3I0E A;  2AGD A;  1M8N A;  2AM4 A;  1TVY A;  4O6M A;  2P72 A;  4KNX A;  1VZU A;  1OQM B;  5F42 A;  2P73 A;  1ZCU A;  3CKO A;  4D11 C;  4MYO A;  2FYA A;  1XZ6 A;  2AE7 A;  3SX8 A;  4EA8 A;  3FSY A;  2GGO A;  1YP2 A;  3GQA A;  1R7U A;  4AAW A;  2XME A;  3TZT A;  3U2T A;  4EEG A;  3TQD A;  5E3P A;  1NMM B;  1SS9 A;  1H7E A;  3IOI A;  2PA4 A;  3IOJ A;  1H5S D;  3D5N A;  4Y6U A;  3ZLL A;  2CU2 A;  3R5A A;  1GX0 A;  1K4V A;  5CMJ A;  3R8Y A;  2WLC A;  2MZB A;  2YQC A;  3HL3 A;  3OTM A;  1EZI A;  3SXC A;  2O1G A;  4R37 A;  4Y63 A;  1I52 A;  1G2V A;  3OH0 A;  4FRH A;  1H7H A;  1LVW A;  5FU0 A;  4KNR A;  4R7P A;  2AM5 A;  1YP3 A;  2BO7 A;  3VBP A;  4NAL A;  2E8B A;  3R1W A;  3I0I X;  4HZD A;  2AM3 A;  2AQ9 A;  3GQ8 A;  1LZJ A;  3Q80 A;  3DUV A;  4D0T A;  4M2A A;  5CQP A;  2RJ8 A;  2VFZ A;  3K8E A;  4JD0 A;  3V0Q A;  2QH5 A;  3R5B A;  3CKJ A;  1ZCV A;  1XHD A;  1R7Y A;  4FIX A;  3OC9 A;  4LW3 A;  3ZGG A;  4C2S A;  5DEM A;  5CQN X;  1FR9 A;  5DDT A;  5FV9 A;  5FUH A;  1HM8 A;  1H4C A;  1MR7 A;  1H5S B;  1R7T A;  2ICX A;  4HO4 A;  4FCE A;  3RMV A;  4M9C A;  5C4C A;  1SSM A;  3ZLK A;  1LXA A;  4E6T A;  4ISX A;  3KWE A;  2Y4J A;  1WT1 A;  4K6R A;  3V0L A;  1S4N A;  1ZI1 A;  4CJ8 A;  3CKN A;  1MP5 A;  2PGV A;  2Y7A A;  1LZ7 A;  3OGZ A;  4HCQ A;  1GA8 A;  1JV3 A;  4EVW A;  3R5D A;  2JF2 A;  2FY7 A;  2X65 A;  2V0I A;  2OI6 A;  4EEO A;  5DG3 A;  4B4M A;  1OCX A;  3O3P A;  4HUS A;  1H5R A;  1TW5 A;  5CMF X;  2VK9 A;  4IRP A;  3KWD A;  1R7X A;  1INJ A;  1W55 A;  4KQL A;  1G8O A;  2I5K A;  1H7Q A;  4HZC A;  2OI7 A;  1ZCY A;  4ASY A;  2Z86 A;  4H7O A;  1H4E A;  4FCU A;  2YCM A;  1R80 A;  3OH4 A;  3EG4 A;  4J18 A;  2V0J A;  1GX4 A;  1MR9 A;  1G93 A;  3I0D A;  1YP4 A;  4FRQ A;  1VZT A;  3D8V A;  5CMH A;  2I7B A;  3SRT A;  3VBL A;  1VZX A;  5DEP A;  3NGW A;  3ST8 A;  1LL2 A;  3BSS A;  1H5T B;  4MND A;  3V90 A;  3E26 A;  4D11 A;  3SXB A;  1VGU A;  4XWI A;  4YS8 A;  4N27 A;  4CJB A;  2JCK A;  4MZU A;  3IOH A;  4KC2 A;  2QIV X;  1H7F A;  4IHG A;  2VXM A;  5C38 A;  4KC4 A;  4BMA A;  5IDS A;  1ZJP A;  3VBJ A;  5C3D A;  2P6W A;  1E5K A;  1V84 A;  5C48 A;  2AEC A;  3RSB A;  1KRU A;  2IUA A;  2XWN A;  3T7N A;  3VNP A;  4KRV A;  3SX3 A;  3U2W A;  1GQC A;  3I0F A;  1H7G A;  3I0G A;  1FXJ A;  3FSX A;  4P00 A;  1LL3 A;  1KK5 A;  1H3M A;  2WVM A;  4DE7 A;  5IFY A;  4FIY A;  1JV1 A;  1XHB A;  1Z2F A;  3CU0 A;  3OW5 A;  3BFP A;  1XAT A;  4MFG A;  2FKO A;  2VXL A;  4HUR A;  3ZF8 A;  1FZW A;  3VBK A;  2V0H A;  4G3P A;  1NF5 B;  3JUJ A;  2D7I A;  3Q4S A;  3MC4 A;  3Q7U A;  4HO3 A;  4EEM A;  3GOS A;  5AFU U;  2WVK A;  4FQW A;  4HO5 A;  3VBM A;  1ZDG A;  1VH1 A;  2X5S A;  1TDT A;  2XAT A;  3JQY A;  2FFV A;  4NAI A;  2YES A;  3OU9 A;  4ECM A;  5I1F A;  1FO8 A;  1FRW A;  3TIS A;  3VBN A;  4N6A A;  1W77 A;  4E75 A;  1S4O A;  2W0W A;  5FTS A;  1G9R A;  5AFU V;  1OMZ A; 
#chains in the Genus database with same CATH homology
 1O7Q A;  4HOC A;  1GWV A;  1HV9 A;  2V0L A;  1H5T A;  5EIY A;  1KGQ A;  1ZCT A;  3TK8 A;  2WGZ A;  1FOA A;  1QGS A;  3OH1 A;  2A8W A;  4J09 A;  4M98 A;  1KK6 A;  1SSQ A;  3HJJ A;  5ADX V;  1ZJ1 A;  3QVB A;  3SXE A;  2RIX A;  5C4F A;  5AJN A;  2OEF A;  2E3D A;  4UEG A;  2WLG A;  1MC3 A;  3SXD A;  3IXC A;  3V8Z A;  2RJ9 A;  4HO2 A;  1MP4 A;  5DDV A;  2WLD A;  2WLE A;  1H5S A;  2PX7 A;  2VSI A;  3FSC A;  5FTV A;  1GWW A;  4HO0 A;  5C8R A;  4FRP A;  4Y6N A;  4Y7G A;  4B2W A;  2NPO A;  5C49 A;  5L6S A;  4CVH A;  4E79 A;  2VS4 A;  3PKQ A;  2Y6P A;  5EJ1 A;  3OKR A;  2J0A A;  5C1L A;  4M99 A;  1LZI A;  3K8D A;  2XWL A;  4LW6 A;  3VBI A;  2V0K A;  3U2U A;  2WLF A;  1G3L A;  5U2K A;  4FRB A;  4AYL A;  3R2W A;  4DDZ A;  2YQH A;  3V4E A;  3ECT A;  2D7R A;  1FR8 A;  1KK4 A;  2C0N A;  1ZJ2 A;  5AJO A;  4IHF A;  1INI A;  1O23 B;  2OEG A;  2QGI A;  1VM8 A;  4AC3 A;  1FXO A;  3BCV A;  3EEV A;  2X5Z A;  1WT0 A;  4EEA A;  3T7M A;  5ADX U;  1FGX A;  3E25 A;  2YC3 A;  4M4K A;  4Y7U A;  1ZJ3 A;  4B3U A;  1H5R B;  3N9W A;  4P02 A;  4AYJ A;  2WVL A;  3CJ8 A;  1IIN A;  4EE3 A;  4B4B A;  4NAK A;  5C4E A;  1V67 A;  1HM0 A;  4FRA A;  2RIZ A;  5CMG X;  1ZI4 A;  2GGQ A;  4FRE A;  1WT3 A;  4L41 C;  1S80 A;  2ICY A;  3OH3 A;  2QIA A;  3SX5 A;  3JUK A;  5C1G A;  3SPT A;  4Y9X A;  3R5C A;  4B5B A;  4BQH A;  4IHH A;  1H7L A;  3C8V A;  5AJP A;  1VGW A;  1VIC A;  2Y4K A;  2ZU8 A;  3I3A A;  1WT2 A;  1KQA A;  3U0X A;  3FS8 A;  2IU9 A;  1G23 A;  1NHE B;  4KPZ A;  4Y7T A;  2AH9 A;  2ZU7 A;  4ARW A;  2UX8 A;  1FGG A;  1H4D A;  1FG5 N;  3V0P A;  4B2X A;  3PMO A;  4M2B A;  2AES A;  4E1K A;  2BO6 A;  3BSW A;  3OH2 A;  4EA9 A;  4DCL A;  5D92 A;  1QGQ A;  1MP3 A;  1QRL A;  2NXV A;  5D91 A;  3HSQ A;  4B4G A;  2VSH A;  3POL A;  2WAW A;  3OAM A;  3LW6 A;  1LZ0 A;  3GVD A;  2Q4J A;  2J0B A;  1WSZ A;  4AA7 A;  1S4P A;  3V0N A;  4MIX A;  3SXG A;  1KRR A;  4Q7C A;  1FO9 A;  4M28 A;  3P1B A;  1H5S C;  3BSY A;  1LL0 A;  1ZI3 A;  4ZDQ A;  3I0L A;  4EAB A;  3CKQ A;  5FYE A;  3U2X A;  1KHR A;  1QRE A;  1ZHJ A;  1ZIZ A;  4EE4 A;  1R81 A;  4FRD A;  4R36 A;  4N69 A;  2JCJ A;  2O1H A;  3EE5 A;  1HJL A;  2PGY A;  4G3Q A;  1V83 A;  1NKH B;  1NWG B;  1WVC A;  5CQM X;  4KXO A;  4HO6 A;  3OUP A;  3MQG A;  5EJZ A;  1G0R A;  3KIA A;  4KPX A;  3JTJ A;  2APC A;  1H7T A;  3EH0 A;  1J2Z A;  5JQQ A;  1O0R A;  3DK5 A;  1JYL A;  1V82 A;  2JCO A;  2Y4L A;  2P2O A;  1KWS A;  4HG6 A;  3F1X A;  4GBP A;  1QRF A;  1QG8 A;  1ZDF A;  3V0O A;  4E6U A;  2FFU A;  5C3B A;  3V91 A;  1ZJO A;  2VD4 A;  4G3S A;  4MYB A;  1KRV A;  2RJ5 A;  3USQ A;  2VS5 A;  1GQ9 A;  3IGJ A;  1PZY B;  5C3A A;  2RJ1 A;  3FSB A;  2FYB A;  3GUE A;  2A8U A;  1G95 A;  2VHE A;  3TV0 A;  4D48 A;  5C47 A;  4Y64 A;  2IC7 A;  4EE5 A;  3I3X A;  4FRL A;  3R3R A;  5C1H A;  1VH3 A;  2RIJ A;  5BXC A;  4N6B A;  3TDT A;  2RJ6 A;  2VS3 A;  5CQL X;  2JF3 A;  3USR A;  4Y7F A;  5CQO A;  2Y4M A;  4Y62 A;  3CGX A;  3SXA A;  1JVD A;  1VGZ A;  3NZ2 A;  4EAA A;  1TW1 A;  1TZF A;  1ON8 A;  1VPA A;  2Z87 A;  4HO9 A;  1V3W A;  1OMX A;  4ASJ A;  3TIO A;  1QRG A;  2RJ7 A;  1R7V A;  2D0J A;  3CKV A;  3DJ4 A;  1Z90 A;  2I5E A;  3RMW A;  4HO8 A;  3BRK X;  2JCL A;  5C4B A;  1ON6 A;  3FWW A;  3D98 A;  2ZU9 A;  2W0V A;  3TWD A;  4CJC A;  3T57 A;  2XMH A;  3U2V A;  1ZJ0 A;  1HJJ A;  3T7O A;  5HS2 A;  2WE9 A;  4IRQ A;  4EA7 A;  2RIT A;  3R3I A;  2YQS A;  4EGG A;  2IU8 A;  1MRL A;  3MQH A;  3PNN A;  3FOQ A;  1JVG A;  3PKP A;  4Y7V A;  3P47 A;  1JYK A;  1R82 A;  3I0K A;  4NAN A;  4KC1 A;  2BO4 A;  3KWC A;  1W57 A;  1KGT A;  1FWY A;  2DPW A;  5CMI A;  3R0S A;  3SX7 A;  5IDT A;  4FRM A;  5L6V A;  1G1L A;  3I0H A;  1NQI B;  4JIS A;  1PZT A;  3V0M A;  3F1C A;  2FYC B;  5C4D A;  2RJ4 A;  2RIY A;  2XWM A;  1VGT A;  1G97 A;  3I0J A;  3U0Y A;  3V8Y A;  2O1F A;  4B42 A;  5J49 A;  4G87 A;  4KT7 A;  3Q1X A;  1QQ0 A;  1QWJ A;  2WEE A;  4FRO A;  3DHO A;  4EQY A;  1O7O A;  5E3R A;  4D0Z A;  3ZGF A;  2YQJ A;  1ZI5 A;  4O6N A;  1THJ A;  2X60 A;  2BO8 A;  2TDT A;  1IIM A;  1YRO B;  2YC5 A;  2OI5 A;  3I0C A;  5FU8 A;  2FYD B;  1HM9 A;  3F1Y A;  1T3D A;  2QKX A;  1EYR A;  5E3Q A;  1QRM A;  5C36 A;  3BXY A;  1SST A;  2RJ0 A;  3OTZ A;  3FTT A;  4DEC A;  3I0E A;  2AGD A;  2AM4 A;  1TVY A;  4O6M A;  2P72 A;  4KNX A;  1VZU A;  1OQM B;  5F42 A;  2P73 A;  1ZCU A;  3CKO A;  4D11 C;  4MYO A;  2FYA A;  1XZ6 A;  2AE7 A;  3SX8 A;  4EA8 A;  3FSY A;  2GGO A;  1YP2 A;  1R7U A;  2XME A;  4AAW A;  3TZT A;  3U2T A;  4EEG A;  3TQD A;  5E3P A;  1NMM B;  1SS9 A;  1H7E A;  3IOI A;  2PA4 A;  3IOJ A;  1H5S D;  3D5N A;  4Y6U A;  3ZLL A;  2CU2 A;  3R5A A;  1GX0 A;  1K4V A;  5CMJ A;  3R8Y A;  2WLC A;  2MZB A;  2YQC A;  3HL3 A;  3OTM A;  1EZI A;  3SXC A;  2O1G A;  4R37 A;  4Y63 A;  1I52 A;  1G2V A;  3OH0 A;  4FRH A;  1H7H A;  1LVW A;  5FU0 A;  4KNR A;  4R7P A;  2AM5 A;  1YP3 A;  2BO7 A;  3VBP A;  4NAL A;  2E8B A;  3R1W A;  3I0I X;  4HZD A;  2AM3 A;  2AQ9 A;  1LZJ A;  3Q80 A;  3DUV A;  4D0T A;  4M2A A;  5CQP A;  2RJ8 A;  2VFZ A;  3K8E A;  4JD0 A;  3V0Q A;  2QH5 A;  3R5B A;  3CKJ A;  1ZCV A;  1XHD A;  1R7Y A;  4FIX A;  3OC9 A;  4LW3 A;  3ZGG A;  4C2S A;  5DEM A;  5CQN X;  1FR9 A;  5DDT A;  5FV9 A;  5FUH A;  1HM8 A;  1H4C A;  1MR7 A;  1H5S B;  1R7T A;  2ICX A;  4HO4 A;  4FCE A;  3RMV A;  4M9C A;  5C4C A;  1SSM A;  3ZLK A;  1LXA A;  4E6T A;  4ISX A;  3KWE A;  2Y4J A;  1WT1 A;  4K6R A;  3V0L A;  1S4N A;  1ZI1 A;  4CJ8 A;  3CKN A;  1MP5 A;  2PGV A;  2Y7A A;  1LZ7 A;  3OGZ A;  4HCQ A;  1GA8 A;  1JV3 A;  4EVW A;  3R5D A;  2JF2 A;  2FY7 A;  2X65 A;  2V0I A;  2OI6 A;  4EEO A;  5DG3 A;  4B4M A;  1OCX A;  3O3P A;  4HUS A;  1H5R A;  1TW5 A;  5CMF X;  2VK9 A;  4IRP A;  3KWD A;  1R7X A;  1INJ A;  1W55 A;  4KQL A;  1G8O A;  2I5K A;  1H7Q A;  4HZC A;  2OI7 A;  1ZCY A;  4ASY A;  2Z86 A;  4H7O A;  1H4E A;  4FCU A;  2YCM A;  1R80 A;  3OH4 A;  3EG4 A;  4J18 A;  2V0J A;  1GX4 A;  1MR9 A;  1G93 A;  3I0D A;  1YP4 A;  4FRQ A;  1VZT A;  3D8V A;  5CMH A;  2I7B A;  3SRT A;  3VBL A;  1VZX A;  5DEP A;  3NGW A;  3ST8 A;  1LL2 A;  3BSS A;  1H5T B;  4MND A;  3V90 A;  3E26 A;  4D11 A;  3SXB A;  1VGU A;  4XWI A;  4YS8 A;  4N27 A;  4CJB A;  2JCK A;  4MZU A;  3IOH A;  4KC2 A;  2QIV X;  1H7F A;  4IHG A;  2VXM A;  5C38 A;  4KC4 A;  4BMA A;  5IDS A;  1ZJP A;  3VBJ A;  5C3D A;  2P6W A;  1E5K A;  1V84 A;  5C48 A;  2AEC A;  3RSB A;  1KRU A;  2IUA A;  2XWN A;  3T7N A;  3VNP A;  4KRV A;  3SX3 A;  3U2W A;  1GQC A;  3I0F A;  1H7G A;  3I0G A;  1FXJ A;  3FSX A;  4P00 A;  1LL3 A;  1KK5 A;  1H3M A;  2WVM A;  4DE7 A;  5IFY A;  4FIY A;  1JV1 A;  1XHB A;  3CU0 A;  3OW5 A;  3BFP A;  1XAT A;  4MFG A;  2FKO A;  2VXL A;  4HUR A;  3ZF8 A;  1FZW A;  3VBK A;  2V0H A;  4G3P A;  1NF5 B;  3JUJ A;  2D7I A;  3Q4S A;  3MC4 A;  3Q7U A;  4HO3 A;  4EEM A;  3GOS A;  5AFU U;  2WVK A;  4FQW A;  4HO5 A;  3VBM A;  1ZDG A;  1VH1 A;  2X5S A;  1TDT A;  2XAT A;  3JQY A;  2FFV A;  4NAI A;  2YES A;  3OU9 A;  4ECM A;  5I1F A;  1FO8 A;  1FRW A;  3TIS A;  3VBN A;  4N6A A;  1W77 A;  4E75 A;  1S4O A;  2W0W A;  5FTS A;  1G9R A;  5AFU V;  1OMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...