4K6RA

Crystal structure of glmu in complex with atp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
469
structure length
469
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title GlmU (N-acetylglucosamine-1-phosphate uridyltransferase) bound to three magnesium ions and ATP at the active site
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 176
structure length 469
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4k6rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4k6rA01
1FOAA 4E75A 1ON8A 1LVWA 1ON6A 3OAMA 1YP2A 2QGIA 2E8BA 4Y7FA 3U2TA 4Y6UA 4DCLA 3Q4SA 2VHEA 1JV1A 1QGQA 5C49A 3FS8A 2RIYA 1VICA 1KK4A 3BSYA 3PKQA 4BQHA 3U2WA 2Y4KA 3K8EA 1ZCTA 3EH0A 4EA7A 3R5DA 4Y7TA 1TDTA 5CMHA 3JQYA 4G3SA 1ZJPA 3OH2A 4Y64A 3E25A 4M28A 3OH0A 4B2XA 1MC3A 3QVBA 4MYBA 4HG6A 5DG3A 2GGQA 5C1HA 3MQGA 2FYAA 1LL2A 2P73A 4HO4A 3SXDA 2OEFA 2VD4A 2O1HA 3JUJA 4Y7GA 3V0MA 1W57A 1V82A 4IHGA 2RIZA 2AGDA 4HO5A 1XATA 4ZDQA 1S80A 2WE9A 2VXMA 3GOSA 1H7GA 3D5NA 3I0LA 1TW5A 3IXCA 2JCOA 2VSHA 3OW5A 2ZU8A 5CMFX 1ZI3A 3R5BA 4D11C 1QQ0A 1XZ6A 1NMMB 1ZHJA 3VBPA 1ZJ1A 1KQAA 2BO6A 1WT0A 2IC7A 2RJ1A 1W55A 3R0SA 4KPZA 4EABA 2VXLA 3FWWA 4MFGA 5FV9A 4P00A 2IU9A 2A8UA 2YC5A 4B4MA 5E3QA 3OH3A 4LW3A 1FZWA 4AA7A 2APCA 1TW1A 1LZIA 2JCKA 5DDVA 5EJ1A 1H7LA 5C8RA 2YQCA 1R7XA 1LZ7A 4HO9A 3T7NA 5DEMA 1S4OA 1V3WA 4ASJA 1KK6A 1OCXA 1ZJOA 2RJ6A 4MNDA 1PZYB 3BSSA 1GWVA 3TDTA 4P02A 1FG5N 3I0KA 5FUHA 1SSTA 1QGSA 5IDSA 1VZUA 3T7OA 2X60A 1H7EA 1GQ9A 1H5SA 5CMJA 5JQQA 1WT3A 2D7IA 4MYOA 4DE7A 4IHHA 1QRLA 1MRLA 1FO8A 2JF3A 5AJNA 1YROB 3BSWA 1VM8A 1ZIZA 3VBKA 2X5SA 3PMOA 1VZXA 2BO4A 2XWMA 5DDTA 2WLGA 3T57A 5ADXU 4EA9A 2VSIA 1HM0A 4B5BA 4NAKA 2QIVX 1LL0A 2JCLA 5L6VA 4B4GA 2Z86A 3KIAA 4Y7VA 3OKRA 2AECA 2RIXA 3F1XA 5CQLX 3I3XA 1VGTA 3LW6A 3SX5A 3OUPA 1KGTA 3T7MA 5C1LA 1IIMA 2WGZA 1LZ0A 3KWCA 3USRA 4J18A 3F1YA 3F1CA 3SX3A 3SXBA 1OMXA 2P6WA 4KC2A 1G95A 4CJ8A 4G3PA 3V4EA 3RSBA 1ZJ2A 4BMAA 2D7RA 1KRRA 1VGUA 5I1FA 4FCUA 3SRTA 2Y4JA 4HOCA 4G3QA 2E3DA 2GGOA 3OH1A 2PGYA 4GBPA 1H4EA 1THJA 2XATA 3C8VA 4AYLA 4KPXA 3CJ8A 5FYEA 2V0JA 1QWJA 2YC3A 3ZLKA 4HCQA 3R8YA 4B2WA 1G9RA 3IOHA 3RMVA 5U2KA 3N9WA 1H5SC 1S4NA 2I5KA 1H7QA 2P2OA 4B42A 3CU0A 3JTJA 3VBIA 4Y9XA 1H7TA 1NKHB 4AYJA 2I5EA 3R3RA 2YQHA 3U0YA 5FTSA 4D48A 3JUKA 4M2BA 1WT2A 4HO6A 1KWSA 4FRPA 3DK5A 1H3MA 1LZJA 3NZ2A 4C2SA 4D0ZA 1ZCVA 2OI7A 3EEVA 2O1GA 3HSQA 4R7PA 4B3UA 3MQHA 1TZFA 5CQOA 3I0GA 1H7HA 5FU0A 1FGGA 1VH1A 2XWNA 2IU8A 2QKXA 4EGGA 3V0QA 1V67A 3I0DA 3ZGGA 5AJOA 1GWWA 4AC3A 1G93A 4FROA 2AE7A 1R7UA 4HO0A 3KWDA 2NXVA 4ASYA 1R7TA 5J49A 4JD0A 3P47A 3SX8A 2RJ0A 1J2ZA 1EYRA 1H5SD 4EEAA 3V0OA 4DDZA 3CKVA 3R5AA 1VGWA 1ZI4A 2TDTA 3CKNA 1V83A 4FQWA 2YESA 4E6TA 1KRUA 4R37A 1FR8A 3FSYA 2D0JA 4EEGA 1HM8A 5BXCA 2RJ5A 4HZCA 4HO8A 5C1GA 1G23A 4AAWA 2QH5A 4LW6A 2VS5A 1VH3A 4M9CA 3FSBA 1O23B 2V0LA 3BXYA 2Y7AA 5IFYA 2UX8A 1KGQA 3BRKX 5CQPA 4N69A 5EIYA 1EZIA 1H5TB 4FRQA 3R3IA 4N27A 2WLEA 2V0HA 5F42A 1OMZA 3OC9A 1WSZA 5AJPA 5L6SA 4M98A 1JVDA 2PX7A 3FSXA 4EE3A 4E79A 2CU2A 1T3DA 4IRQA 3K8DA 4ISXA 1KRVA 4E6UA 3OU9A 4J09A 3V90A 1WT1A 3FTTA 1Z90A 5EJZA 1WVCA 4D0TA 5C3DA 1ZI5A 4EEOA 2AM3A 5DEPA 1FXJA 3CKOA 3BFPA 5HS2A 4IHFA 4EVWA 5C4CA 2YQJA 4HO3A 4MZUA 1MP5A 3ZGFA 3VBJA 4UEGA 3V8YA 4EAAA 5CQNX 2MZBA 2AM5A 2AH9A 2XMEA 4HO2A 1MP3A 3CGXA 4L41C 2AQ9A 3OTMA 2AM4A 2RJ4A 3PKPA 4KNRA 3PNNA 3ECTA 3R2WA 1H5RB 3V8ZA 1QRFA 1ZI1A 4B4BA 2Y6PA 1O7QA 4JISA 4M4KA 3P1BA 5C4DA 2RJ7A 5IDTA 5AFUV 3U0XA 3D8VA 2RJ9A 1LL3A 3ZLLA 3I0HA 3IGJA 4HZDA 1LXAA 4Y6NA 3V0PA 3I0IX 3Q80A 5C4FA 4FRMA 3EE5A 2RITA 4Y7UA 1G1LA 3VBNA 3BCVA 4CJCA 3KWEA 1QRGA 2X5ZA 1NF5B 1G2VA 1ZCYA 5E3PA 1NHEB 5CMIA 3DUVA 4HURA 4Y63A 2OI5A 2FYDB 1IINA 4FRHA 2ICXA 5CQMX 1PZTA 4FREA 1XHDA 1YP4A 3SXCA 3IOJA 2PGVA 3TQDA 1ZDGA 2I7BA 2W0WA 1ZJ0A 1K4VA 2OI6A 1VZTA 4KNXA 4K6RA 1W77A 1XHBA 5C48A 2NPOA 2BO8A 3OH4A 1ZDFA 3FSCA 1H5SB 2PA4A 2BO7A 1S4PA 2ZU7A 1V84A 3OTZA 1FR9A 1O0RA 1MR7A 1GA8A 1MP4A 2XMHA 4KC4A 1SSQA 2AESA 2VFZA 3TZTA 1H4CA 3I0FA 5C36A 1FWYA 3Q7UA 1G3LA 3I0CA 3HL3A 1VPAA 4XWIA 5CMGX 1FXOA 1NWGB 2IUAA 3V91A 4NAIA 1GX0A 3D98A 3POLA 3TWDA 3V0NA 4M99A 1HV9A 1H5RA 1JVGA 2A8WA 1R80A 3I3AA 2P72A 1ZJ3A 3SX7A 3HJJA 4FRLA 5C3BA 4G87A 2O1FA 1MR9A 4N6AA 2VS3A 2V0IA 3CKJA 2DPWA 3TK8A 3GUEA 1O7OA 3TISA 2ZU9A 3IOIA 5C38A 1SS9A 1HM9A 2JF2A 4FRBA 1E5KA 1HJLA 1FRWA 4KRVA 2WLDA 3U2XA 4DECA 1KHRA 5C47A 3ZF8A 4H7OA 3USQA 1JYKA 5E3RA 3RMWA 2WEEA 4EE4A 2OEGA 3O3PA 3ST8A 2Y4LA 3TV0A 4EE5A 2QIAA 1INJA 4NALA 5C4EA 1NQIB 3DJ4A 2FFUA 3GVDA 2WLCA 4EQYA 3I0EA 4CJBA 4ARWA 2YCMA 4KQLA 5C3AA 1ZCUA 4N6BA 3SXEA 2VS4A 4Y62A 1QRMA 1INIA 3VNPA 2RJ8A 1SSMA 1JV3A 2V0KA 4ECMA 1H7FA 2Z87A 1TVYA 2FYCB 1KK5A 5AFUU 3MC4A 2W0VA 2RIJA 3DHOA 1FGXA 1R7YA 2FFVA 1JYLA 2YQSA 2WVMA 2FKOA 1YP3A 4NANA 2XWLA 3NGWA 4KC1A 4R36A 2WVLA 4EEMA 1FO9A 1H4DA 5C4BA 3E26A 3Q1XA 1G97A 3TIOA 4HUSA 3EG4A 2FYBA 4CVHA 4FCEA 3FOQA 2FY7A 1R7VA 1VGZA 2WVKA 3U2VA 3CKQA 2X65A 4M2AA 3OGZA 1QREA 1GQCA 2WAWA 1G8OA 1R82A 3R5CA 2Q4JA 4EA8A 4YS8A 1I52A 1R81A 2JCJA 2Y4MA 3V0LA 4E1KA 1QG8A 4FRAA 1HJJA 1OQMB 3U2UA 4KT7A 3VBLA 3SPTA 3SXAA 4D11A 3R1WA 2WLFA 1GX4A 4KXOA 5FU8A 3SXGA 1H5TA 2ICYA 4FRDA 5FTVA 3VBMA 1G0RA 3I0JA 5ADXV 4IRPA
chains in the Genus database with same CATH superfamily
1FOAA 4E75A 1ON8A 1LVWA 1ON6A 3OAMA 1YP2A 2QGIA 2E8BA 4Y7FA 3U2TA 4Y6UA 4DCLA 3Q4SA 2VHEA 1JV1A 1QGQA 5C49A 3FS8A 2RIYA 1VICA 1KK4A 3BSYA 3PKQA 1Z2FA 4BQHA 3U2WA 2Y4KA 3K8EA 1ZCTA 3EH0A 4EA7A 3R5DA 4Y7TA 1TDTA 5CMHA 3JQYA 4G3SA 1ZJPA 3OH2A 4Y64A 3E25A 4M28A 3OH0A 4B2XA 1MC3A 3QVBA 4MYBA 4HG6A 5DG3A 2GGQA 5C1HA 3MQGA 2FYAA 1LL2A 2P73A 4HO4A 3SXDA 2OEFA 2VD4A 2O1HA 3JUJA 4Y7GA 3V0MA 1W57A 1V82A 4IHGA 2RIZA 2AGDA 4HO5A 1XATA 4ZDQA 1S80A 2WE9A 2VXMA 3GOSA 1H7GA 3D5NA 3I0LA 1TW5A 3IXCA 2JCOA 2VSHA 3OW5A 2ZU8A 5CMFX 1ZI3A 3R5BA 4D11C 1QQ0A 1XZ6A 1NMMB 1ZHJA 3VBPA 1ZJ1A 1KQAA 2BO6A 1WT0A 2IC7A 2RJ1A 1W55A 3R0SA 4KPZA 4EABA 2VXLA 3FWWA 4MFGA 5FV9A 4P00A 2IU9A 2A8UA 2YC5A 4B4MA 3OH3A 5E3QA 4LW3A 1FZWA 4AA7A 2APCA 1TW1A 1LZIA 2JCKA 5DDVA 5EJ1A 1H7LA 5C8RA 2YQCA 1R7XA 1LZ7A 4HO9A 3T7NA 5DEMA 1S4OA 1V3WA 4ASJA 1KK6A 1OCXA 1ZJOA 2RJ6A 4MNDA 1PZYB 3BSSA 1GWVA 3TDTA 4P02A 1FG5N 3I0KA 5FUHA 1SSTA 1QGSA 5IDSA 1VZUA 3T7OA 2X60A 1H7EA 1GQ9A 1H5SA 5CMJA 5JQQA 1WT3A 2D7IA 4MYOA 4DE7A 4IHHA 1QRLA 1MRLA 1FO8A 2JF3A 5AJNA 1YROB 3BSWA 1VM8A 1ZIZA 3VBKA 2X5SA 2VK9A 3PMOA 1VZXA 2BO4A 2XWMA 5DDTA 2WLGA 3SUCA 3T57A 5ADXU 4EA9A 2VSIA 1HM0A 4B5BA 4NAKA 2QIVX 1LL0A 2JCLA 5L6VA 4B4GA 2Z86A 3KIAA 4Y7VA 3OKRA 2AECA 2RIXA 3F1XA 5CQLX 3I3XA 1VGTA 3LW6A 3SX5A 3OUPA 1KGTA 3T7MA 5C1LA 1IIMA 2WGZA 1LZ0A 3KWCA 3USRA 4J18A 3F1YA 3F1CA 3SX3A 3SXBA 1OMXA 2P6WA 4KC2A 1G95A 4CJ8A 4G3PA 3V4EA 3RSBA 1ZJ2A 4BMAA 2D7RA 1KRRA 1VGUA 5I1FA 4FCUA 3SRTA 2Y4JA 4HOCA 4G3QA 2E3DA 2GGOA 3OH1A 2PGYA 4GBPA 1H4EA 1THJA 2XATA 3C8VA 4AYLA 1L0SA 4KPXA 3CJ8A 5FYEA 2V0JA 1QWJA 2YC3A 3GQ7A 3ZLKA 4HCQA 3R8YA 4B2WA 1G9RA 3IOHA 3RMVA 5U2KA 3N9WA 1H5SC 1S4NA 2I5KA 1H7QA 2P2OA 4B42A 3CU0A 3JTJA 1M8NA 3VBIA 4Y9XA 1H7TA 1NKHB 4AYJA 2I5EA 3R3RA 2YQHA 3U0YA 5FTSA 4D48A 3JUKA 4M2BA 1WT2A 4HO6A 1KWSA 4FRPA 3DK5A 1H3MA 1LZJA 3NZ2A 4O6NA 4C2SA 4D0ZA 1ZCVA 2OI7A 3EEVA 2O1GA 3HSQA 4R7PA 4B3UA 3MQHA 1TZFA 5CQOA 3I0GA 1H7HA 5FU0A 1FGGA 1VH1A 2XWNA 2IU8A 2QKXA 4EGGA 3V0QA 1V67A 3I0DA 3ZGGA 5AJOA 1GWWA 4AC3A 1G93A 4FROA 2AE7A 1R7UA 4HO0A 3KWDA 2NXVA 4ASYA 1R7TA 5J49A 4JD0A 3P47A 3SX8A 2RJ0A 1J2ZA 1EYRA 1H5SD 4EEAA 3V0OA 4DDZA 3CKVA 3R5AA 1VGWA 1ZI4A 2TDTA 3CKNA 1V83A 4FQWA 1EWWA 2YESA 4E6TA 1KRUA 4Q7CA 4R37A 1FR8A 3FSYA 2D0JA 4FIXA 1HM8A 4EEGA 5BXCA 2RJ5A 4HZCA 4HO8A 5C1GA 1G23A 4AAWA 2QH5A 4LW6A 2VS5A 1VH3A 4M9CA 3FSBA 1O23B 2V0LA 3BXYA 2Y7AA 5IFYA 2UX8A 1KGQA 3BRKX 5CQPA 4N69A 2J0AA 5EIYA 1EZIA 1H5TB 4FRQA 4O6MA 3R3IA 4N27A 2WLEA 2V0HA 5F42A 1OMZA 3OC9A 1WSZA 5AJPA 5L6SA 4M98A 1JVDA 2PX7A 3FSXA 4EE3A 4E79A 2CU2A 1T3DA 4IRQA 3K8DA 4ISXA 1KRVA 4E6UA 3OU9A 4J09A 3V90A 1WT1A 3FTTA 1Z90A 5EJZA 1WVCA 4D0TA 5C3DA 1ZI5A 4EEOA 2AM3A 5DEPA 1FXJA 3CKOA 3BFPA 5HS2A 4IHFA 4EVWA 5C4CA 2YQJA 4HO3A 4MZUA 1MP5A 3ZGFA 3VBJA 4UEGA 3V8YA 4EAAA 5CQNX 2MZBA 2AM5A 2AH9A 2XMEA 4HO2A 1MP3A 3CGXA 4L41C 2AQ9A 3OTMA 2AM4A 2RJ4A 3PKPA 4KNRA 3PNNA 3ECTA 3R2WA 4MIXA 1H5RB 3V8ZA 1QRFA 1ZI1A 4B4BA 2Y6PA 1N4IA 1O7QA 4JISA 4M4KA 3P1BA 5C4DA 2RJ7A 5IDTA 5AFUV 3U0XA 3D8VA 2RJ9A 1LL3A 3ZLLA 3I0HA 3IGJA 4HZDA 1LXAA 4Y6NA 3V0PA 3I0IX 3GQ8A 3Q80A 5C4FA 4FRMA 3EE5A 2RITA 4Y7UA 1G1LA 3VBNA 3BCVA 4CJCA 3KWEA 1QRGA 5D92A 2X5ZA 1NF5B 1G2VA 1ZCYA 5E3PA 1NHEB 5CMIA 3DUVA 4HURA 4Y63A 2OI5A 2FYDB 1IINA 4FRHA 2ICXA 5CQMX 1PZTA 4FREA 1XHDA 1YP4A 3SXCA 3IOJA 2PGVA 3GQAA 3TQDA 1ZDGA 2I7BA 2W0WA 1ZJ0A 1K4VA 2OI6A 1VZTA 4KNXA 4K6RA 1W77A 1XHBA 5C48A 2NPOA 2BO8A 3OH4A 1ZDFA 3FSCA 1H5SB 2PA4A 2BO7A 1S4PA 2ZU7A 1V84A 3OTZA 1FR9A 1O0RA 1MR7A 1GA8A 1MP4A 2XMHA 4KC4A 1SSQA 2AESA 2VFZA 3TZTA 1H4CA 3I0FA 5D91A 1FWYA 3Q7UA 5C36A 1G3LA 3I0CA 3HL3A 1VPAA 4XWIA 5CMGX 1FXOA 1NWGB 2IUAA 3V91A 4NAIA 2J0BA 1GX0A 3D98A 3POLA 3TWDA 3V0NA 4M99A 1HV9A 4FIYA 1H5RA 1JVGA 2A8WA 1R80A 3I3AA 2P72A 1ZJ3A 3SX7A 3HJJA 4FRLA 5C3BA 4G87A 2O1FA 1MR9A 4N6AA 2VS3A 2V0IA 3CKJA 2DPWA 3TK8A 3GUEA 1O7OA 3TISA 2ZU9A 3IOIA 5C38A 1SS9A 1HM9A 2JF2A 4FRBA 1E5KA 1HJLA 1FRWA 4KRVA 2WLDA 3U2XA 4DECA 1KHRA 5C47A 3ZF8A 4H7OA 3USQA 1JYKA 5E3RA 3RMWA 2WEEA 4EE4A 2OEGA 3O3PA 3ST8A 2Y4LA 3TV0A 4EE5A 2QIAA 1INJA 4NALA 5C4EA 1NQIB 3DJ4A 2FFUA 3GVDA 2WLCA 4EQYA 3I0EA 4CJBA 4ARWA 2YCMA 4KQLA 5C3AA 1ZCUA 4N6BA 3SXEA 2VS4A 4Y62A 1QRMA 1INIA 3VNPA 2RJ8A 1SSMA 1JV3A 2V0KA 4ECMA 1H7FA 2Z87A 1TVYA 2FYCB 1KK5A 3GQ9A 5AFUU 3MC4A 2W0VA 2RIJA 3DHOA 1FGXA 1R7YA 2FFVA 1JYLA 2YQSA 2WVMA 2FKOA 1YP3A 4NANA 2XWLA 3NGWA 4KC1A 4R36A 2WVLA 4EEMA 1FO9A 1H4DA 5C4BA 3E26A 3Q1XA 1G97A 3TIOA 4HUSA 3EG4A 2FYBA 4CVHA 4FCEA 3FOQA 2FY7A 1R7VA 1VGZA 2WVKA 3U2VA 3CKQA 2X65A 4M2AA 3OGZA 1QREA 1GQCA 2WAWA 1G8OA 1R82A 3R5CA 2Q4JA 4EA8A 4YS8A 1I52A 1R81A 2JCJA 2Y4MA 3V0LA 4E1KA 2C0NA 1QG8A 4FRAA 1HJJA 1OQMB 3U2UA 4KT7A 3VBLA 3SPTA 3SXAA 4D11A 3R1WA 2WLFA 1GX4A 4KXOA 5FU8A 3SXGA 1H5TA 2ICYA 4FRDA 5FTVA 3VBMA 1G0RA 3I0JA 5ADXV 4IRPA
chains in the Genus database with same CATH topology
1FOAA 4E75A 1ON8A 1LVWA 1ON6A 3OAMA 1YP2A 2QGIA 2E8BA 4Y7FA 3U2TA 4Y6UA 4DCLA 3Q4SA 2VHEA 1JV1A 1QGQA 5C49A 3FS8A 2RIYA 1VICA 1KK4A 3BSYA 3PKQA 4BQHA 3U2WA 2Y4KA 3K8EA 1ZCTA 3EH0A 4EA7A 3R5DA 4Y7TA 1TDTA 5CMHA 3JQYA 4G3SA 1ZJPA 3OH2A 4Y64A 3E25A 4M28A 3OH0A 4B2XA 1MC3A 3QVBA 4MYBA 4HG6A 5DG3A 2GGQA 5C1HA 3MQGA 2FYAA 1LL2A 2P73A 4HO4A 3SXDA 2OEFA 2VD4A 2O1HA 3JUJA 4Y7GA 3V0MA 1W57A 1V82A 4IHGA 2RIZA 2AGDA 4HO5A 1XATA 4ZDQA 1S80A 2WE9A 2VXMA 3GOSA 1H7GA 3D5NA 3I0LA 1TW5A 3IXCA 2JCOA 2VSHA 3OW5A 2ZU8A 5CMFX 1ZI3A 3R5BA 4D11C 1QQ0A 1XZ6A 1NMMB 1ZHJA 3VBPA 1ZJ1A 1KQAA 2BO6A 1WT0A 2IC7A 2RJ1A 1W55A 3R0SA 4KPZA 4EABA 2VXLA 3FWWA 4MFGA 5FV9A 4P00A 2IU9A 2A8UA 2YC5A 4B4MA 5E3QA 3OH3A 4LW3A 1FZWA 4AA7A 2APCA 1TW1A 1LZIA 2JCKA 5DDVA 5EJ1A 1H7LA 5C8RA 2YQCA 1R7XA 1LZ7A 4HO9A 3T7NA 5DEMA 1S4OA 1V3WA 4ASJA 1KK6A 1OCXA 1ZJOA 2RJ6A 4MNDA 1PZYB 3BSSA 1GWVA 3TDTA 4P02A 1FG5N 3I0KA 5FUHA 1SSTA 1QGSA 5IDSA 1VZUA 3T7OA 2X60A 1H7EA 1GQ9A 1H5SA 5CMJA 5JQQA 1WT3A 2D7IA 4MYOA 4DE7A 4IHHA 1QRLA 1MRLA 1FO8A 2JF3A 5AJNA 1YROB 3BSWA 1VM8A 1ZIZA 3VBKA 2X5SA 2VK9A 3PMOA 1VZXA 2BO4A 2XWMA 5DDTA 2WLGA 3T57A 5ADXU 4EA9A 2VSIA 1HM0A 4B5BA 4NAKA 2QIVX 1LL0A 2JCLA 5L6VA 4B4GA 2Z86A 3KIAA 4Y7VA 3OKRA 2AECA 2RIXA 3F1XA 5CQLX 3I3XA 1VGTA 3LW6A 3SX5A 3OUPA 1KGTA 3T7MA 5C1LA 1IIMA 2WGZA 1LZ0A 3KWCA 3USRA 4J18A 3F1YA 3F1CA 3SX3A 3SXBA 1OMXA 2P6WA 4KC2A 1G95A 4CJ8A 4G3PA 3V4EA 3RSBA 1ZJ2A 4BMAA 2D7RA 1KRRA 1VGUA 5I1FA 4FCUA 3SRTA 2Y4JA 4HOCA 4G3QA 2E3DA 2GGOA 3OH1A 2PGYA 4GBPA 1H4EA 1THJA 2XATA 3C8VA 4AYLA 4KPXA 3CJ8A 5FYEA 2V0JA 1QWJA 2YC3A 3ZLKA 4HCQA 3R8YA 4B2WA 1G9RA 3IOHA 3RMVA 5U2KA 3N9WA 1H5SC 1S4NA 2I5KA 1H7QA 2P2OA 4B42A 3CU0A 3JTJA 3VBIA 4Y9XA 1H7TA 1NKHB 4AYJA 2I5EA 3R3RA 2YQHA 3U0YA 5FTSA 4D48A 3JUKA 4M2BA 1WT2A 4HO6A 1KWSA 4FRPA 3DK5A 1H3MA 1LZJA 3NZ2A 4O6NA 4C2SA 4D0ZA 1ZCVA 2OI7A 3EEVA 2O1GA 3HSQA 4R7PA 4B3UA 3MQHA 1TZFA 5CQOA 3I0GA 1H7HA 5FU0A 1FGGA 1VH1A 2XWNA 2IU8A 2QKXA 4EGGA 3V0QA 1V67A 3I0DA 3ZGGA 5AJOA 1GWWA 4AC3A 1G93A 4FROA 2AE7A 1R7UA 4HO0A 3KWDA 2NXVA 4ASYA 1R7TA 5J49A 4JD0A 3P47A 3SX8A 2RJ0A 1J2ZA 1EYRA 1H5SD 4EEAA 3V0OA 4DDZA 3CKVA 3R5AA 1VGWA 1ZI4A 2TDTA 3CKNA 1V83A 4FQWA 2YESA 4E6TA 1KRUA 4Q7CA 4R37A 1FR8A 3FSYA 2D0JA 4FIXA 1HM8A 4EEGA 5BXCA 2RJ5A 4HZCA 4HO8A 5C1GA 1G23A 4AAWA 2QH5A 4LW6A 2VS5A 1VH3A 4M9CA 3FSBA 1O23B 2V0LA 3BXYA 2Y7AA 5IFYA 2UX8A 1KGQA 3BRKX 5CQPA 4N69A 2J0AA 5EIYA 1EZIA 1H5TB 4FRQA 4O6MA 3R3IA 4N27A 2WLEA 2V0HA 5F42A 1OMZA 3OC9A 1WSZA 5AJPA 5L6SA 4M98A 1JVDA 2PX7A 3FSXA 4EE3A 4E79A 2CU2A 1T3DA 4IRQA 3K8DA 4ISXA 1KRVA 4E6UA 3OU9A 4J09A 3V90A 1WT1A 3FTTA 1Z90A 5EJZA 1WVCA 4D0TA 5C3DA 1ZI5A 4EEOA 2AM3A 5DEPA 1FXJA 3CKOA 3BFPA 5HS2A 4IHFA 4EVWA 5C4CA 2YQJA 4HO3A 4MZUA 1MP5A 3ZGFA 3VBJA 4UEGA 3V8YA 4EAAA 5CQNX 2MZBA 2AM5A 2AH9A 2XMEA 4HO2A 1MP3A 3CGXA 4L41C 2AQ9A 3OTMA 2AM4A 2RJ4A 3PKPA 4KNRA 3PNNA 3ECTA 3R2WA 4MIXA 1H5RB 3V8ZA 1QRFA 1ZI1A 4B4BA 2Y6PA 1O7QA 4JISA 4M4KA 3P1BA 5C4DA 2RJ7A 5IDTA 5AFUV 3U0XA 3D8VA 2RJ9A 1LL3A 3ZLLA 3I0HA 3IGJA 4HZDA 1LXAA 4Y6NA 3V0PA 3I0IX 3Q80A 5C4FA 4FRMA 3EE5A 2RITA 4Y7UA 1G1LA 3VBNA 3BCVA 4CJCA 3KWEA 1QRGA 5D92A 2X5ZA 1NF5B 1G2VA 1ZCYA 5E3PA 1NHEB 5CMIA 3DUVA 4HURA 4Y63A 2OI5A 2FYDB 1IINA 4FRHA 2ICXA 5CQMX 1PZTA 4FREA 1XHDA 1YP4A 3SXCA 3IOJA 2PGVA 3TQDA 1ZDGA 2I7BA 2W0WA 1ZJ0A 1K4VA 2OI6A 1VZTA 4KNXA 4K6RA 1W77A 1XHBA 5C48A 2NPOA 2BO8A 3OH4A 1ZDFA 3FSCA 1H5SB 2PA4A 2BO7A 1S4PA 2ZU7A 1V84A 3OTZA 1FR9A 1O0RA 1MR7A 1GA8A 1MP4A 2XMHA 4KC4A 1SSQA 2AESA 2VFZA 3TZTA 1H4CA 3I0FA 5D91A 1FWYA 3Q7UA 5C36A 1G3LA 3I0CA 3HL3A 1VPAA 4XWIA 5CMGX 1FXOA 1NWGB 2IUAA 3V91A 4NAIA 2J0BA 1GX0A 3D98A 3POLA 3TWDA 3V0NA 4M99A 1HV9A 4FIYA 1H5RA 1JVGA 2A8WA 1R80A 3I3AA 2P72A 1ZJ3A 3SX7A 3HJJA 4FRLA 5C3BA 4G87A 2O1FA 1MR9A 4N6AA 2VS3A 2V0IA 3CKJA 2DPWA 3TK8A 3GUEA 1O7OA 3TISA 2ZU9A 3IOIA 5C38A 1SS9A 1HM9A 2JF2A 4FRBA 1E5KA 1HJLA 1FRWA 4KRVA 2WLDA 3U2XA 4DECA 1KHRA 5C47A 3ZF8A 4H7OA 3USQA 1JYKA 5E3RA 3RMWA 2WEEA 4EE4A 2OEGA 3O3PA 3ST8A 2Y4LA 3TV0A 4EE5A 2QIAA 1INJA 4NALA 5C4EA 1NQIB 3DJ4A 2FFUA 3GVDA 2WLCA 4EQYA 3I0EA 4CJBA 4ARWA 2YCMA 4KQLA 5C3AA 1ZCUA 4N6BA 3SXEA 2VS4A 4Y62A 1QRMA 1INIA 3VNPA 2RJ8A 1SSMA 1JV3A 2V0KA 4ECMA 1H7FA 2Z87A 1TVYA 2FYCB 1KK5A 5AFUU 3MC4A 2W0VA 2RIJA 3DHOA 1FGXA 1R7YA 2FFVA 1JYLA 2YQSA 2WVMA 2FKOA 1YP3A 4NANA 2XWLA 3NGWA 4KC1A 4R36A 2WVLA 4EEMA 1FO9A 1H4DA 5C4BA 3E26A 3Q1XA 1G97A 3TIOA 4HUSA 3EG4A 2FYBA 4CVHA 4FCEA 3FOQA 2FY7A 1R7VA 1VGZA 2WVKA 3U2VA 3CKQA 2X65A 4M2AA 3OGZA 1QREA 1GQCA 2WAWA 1G8OA 1R82A 3R5CA 2Q4JA 4EA8A 4YS8A 1I52A 1R81A 2JCJA 2Y4MA 3V0LA 4E1KA 2C0NA 1QG8A 4FRAA 1HJJA 1OQMB 3U2UA 4KT7A 3VBLA 3SPTA 3SXAA 4D11A 3R1WA 2WLFA 1GX4A 4KXOA 5FU8A 3SXGA 1H5TA 2ICYA 4FRDA 5FTVA 3VBMA 1G0RA 3I0JA 5ADXV 4IRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOA A;  4E75 A;  1ON8 A;  1LVW A;  1ON6 A;  3OAM A;  1YP2 A;  2QGI A;  2E8B A;  4Y7F A;  3U2T A;  4Y6U A;  4DCL A;  3Q4S A;  2VHE A;  1JV1 A;  1QGQ A;  5C49 A;  3FS8 A;  2RIY A;  1VIC A;  1KK4 A;  3BSY A;  3PKQ A;  4BQH A;  3U2W A;  2Y4K A;  3K8E A;  1ZCT A;  3EH0 A;  4EA7 A;  3R5D A;  4Y7T A;  1TDT A;  5CMH A;  3JQY A;  4G3S A;  1ZJP A;  3OH2 A;  4Y64 A;  3E25 A;  4M28 A;  3OH0 A;  4B2X A;  1MC3 A;  3QVB A;  4MYB A;  4HG6 A;  5DG3 A;  2GGQ A;  5C1H A;  3MQG A;  2FYA A;  1LL2 A;  2P73 A;  4HO4 A;  3SXD A;  2OEF A;  2VD4 A;  2O1H A;  3JUJ A;  4Y7G A;  3V0M A;  1W57 A;  1V82 A;  4IHG A;  2RIZ A;  2AGD A;  4HO5 A;  1XAT A;  4ZDQ A;  1S80 A;  2WE9 A;  2VXM A;  3GOS A;  1H7G A;  3D5N A;  3I0L A;  1TW5 A;  3IXC A;  2JCO A;  2VSH A;  3OW5 A;  2ZU8 A;  5CMF X;  1ZI3 A;  3R5B A;  4D11 C;  1QQ0 A;  1XZ6 A;  1NMM B;  1ZHJ A;  3VBP A;  1ZJ1 A;  1KQA A;  2BO6 A;  1WT0 A;  2IC7 A;  2RJ1 A;  1W55 A;  3R0S A;  4KPZ A;  4EAB A;  2VXL A;  3FWW A;  4MFG A;  5FV9 A;  4P00 A;  2IU9 A;  2A8U A;  2YC5 A;  4B4M A;  5E3Q A;  3OH3 A;  4LW3 A;  1FZW A;  4AA7 A;  2APC A;  1TW1 A;  1LZI A;  2JCK A;  5DDV A;  5EJ1 A;  1H7L A;  5C8R A;  2YQC A;  1R7X A;  1LZ7 A;  4HO9 A;  3T7N A;  5DEM A;  1S4O A;  1V3W A;  4ASJ A;  1KK6 A;  1OCX A;  1ZJO A;  2RJ6 A;  4MND A;  1PZY B;  3BSS A;  1GWV A;  3TDT A;  4P02 A;  1FG5 N;  3I0K A;  5FUH A;  1SST A;  1QGS A;  5IDS A;  1VZU A;  3T7O A;  2X60 A;  1H7E A;  1GQ9 A;  1H5S A;  5CMJ A;  5JQQ A;  1WT3 A;  2D7I A;  4MYO A;  4DE7 A;  4IHH A;  1QRL A;  1MRL A;  1FO8 A;  2JF3 A;  5AJN A;  1YRO B;  3BSW A;  1VM8 A;  1ZIZ A;  3VBK A;  2X5S A;  3PMO A;  1VZX A;  2BO4 A;  2XWM A;  5DDT A;  2WLG A;  3T57 A;  5ADX U;  4EA9 A;  2VSI A;  1HM0 A;  4B5B A;  4NAK A;  2QIV X;  1LL0 A;  2JCL A;  5L6V A;  4B4G A;  2Z86 A;  3KIA A;  4Y7V A;  3OKR A;  2AEC A;  2RIX A;  3F1X A;  5CQL X;  3I3X A;  1VGT A;  3LW6 A;  3SX5 A;  3OUP A;  1KGT A;  3T7M A;  5C1L A;  1IIM A;  2WGZ A;  1LZ0 A;  3KWC A;  3USR A;  4J18 A;  3F1Y A;  3F1C A;  3SX3 A;  3SXB A;  1OMX A;  2P6W A;  4KC2 A;  1G95 A;  4CJ8 A;  4G3P A;  3V4E A;  3RSB A;  1ZJ2 A;  4BMA A;  2D7R A;  1KRR A;  1VGU A;  5I1F A;  4FCU A;  3SRT A;  2Y4J A;  4HOC A;  4G3Q A;  2E3D A;  2GGO A;  3OH1 A;  2PGY A;  4GBP A;  1H4E A;  1THJ A;  2XAT A;  3C8V A;  4AYL A;  4KPX A;  3CJ8 A;  5FYE A;  2V0J A;  1QWJ A;  2YC3 A;  3ZLK A;  4HCQ A;  3R8Y A;  4B2W A;  1G9R A;  3IOH A;  3RMV A;  5U2K A;  3N9W A;  1H5S C;  1S4N A;  2I5K A;  1H7Q A;  2P2O A;  4B42 A;  3CU0 A;  3JTJ A;  3VBI A;  4Y9X A;  1H7T A;  1NKH B;  4AYJ A;  2I5E A;  3R3R A;  2YQH A;  3U0Y A;  5FTS A;  4D48 A;  3JUK A;  4M2B A;  1WT2 A;  4HO6 A;  1KWS A;  4FRP A;  3DK5 A;  1H3M A;  1LZJ A;  3NZ2 A;  4C2S A;  4D0Z A;  1ZCV A;  2OI7 A;  3EEV A;  2O1G A;  3HSQ A;  4R7P A;  4B3U A;  3MQH A;  1TZF A;  5CQO A;  3I0G A;  1H7H A;  5FU0 A;  1FGG A;  1VH1 A;  2XWN A;  2IU8 A;  2QKX A;  4EGG A;  3V0Q A;  1V67 A;  3I0D A;  3ZGG A;  5AJO A;  1GWW A;  4AC3 A;  1G93 A;  4FRO A;  2AE7 A;  1R7U A;  4HO0 A;  3KWD A;  2NXV A;  4ASY A;  1R7T A;  5J49 A;  4JD0 A;  3P47 A;  3SX8 A;  2RJ0 A;  1J2Z A;  1EYR A;  1H5S D;  4EEA A;  3V0O A;  4DDZ A;  3CKV A;  3R5A A;  1VGW A;  1ZI4 A;  2TDT A;  3CKN A;  1V83 A;  4FQW A;  2YES A;  4E6T A;  1KRU A;  4R37 A;  1FR8 A;  3FSY A;  2D0J A;  4EEG A;  1HM8 A;  5BXC A;  2RJ5 A;  4HZC A;  4HO8 A;  5C1G A;  1G23 A;  4AAW A;  2QH5 A;  4LW6 A;  2VS5 A;  1VH3 A;  4M9C A;  3FSB A;  1O23 B;  2V0L A;  3BXY A;  2Y7A A;  5IFY A;  2UX8 A;  1KGQ A;  3BRK X;  5CQP A;  4N69 A;  5EIY A;  1EZI A;  1H5T B;  4FRQ A;  3R3I A;  4N27 A;  2WLE A;  2V0H A;  5F42 A;  1OMZ A;  3OC9 A;  1WSZ A;  5AJP A;  5L6S A;  4M98 A;  1JVD A;  2PX7 A;  3FSX A;  4EE3 A;  4E79 A;  2CU2 A;  1T3D A;  4IRQ A;  3K8D A;  4ISX A;  1KRV A;  4E6U A;  3OU9 A;  4J09 A;  3V90 A;  1WT1 A;  3FTT A;  1Z90 A;  5EJZ A;  1WVC A;  4D0T A;  5C3D A;  1ZI5 A;  4EEO A;  2AM3 A;  5DEP A;  1FXJ A;  3CKO A;  3BFP A;  5HS2 A;  4IHF A;  4EVW A;  5C4C A;  2YQJ A;  4HO3 A;  4MZU A;  1MP5 A;  3ZGF A;  3VBJ A;  4UEG A;  3V8Y A;  4EAA A;  5CQN X;  2MZB A;  2AM5 A;  2AH9 A;  2XME A;  4HO2 A;  1MP3 A;  3CGX A;  4L41 C;  2AQ9 A;  3OTM A;  2AM4 A;  2RJ4 A;  3PKP A;  4KNR A;  3PNN A;  3ECT A;  3R2W A;  1H5R B;  3V8Z A;  1QRF A;  1ZI1 A;  4B4B A;  2Y6P A;  1O7Q A;  4JIS A;  4M4K A;  3P1B A;  5C4D A;  2RJ7 A;  5IDT A;  5AFU V;  3U0X A;  3D8V A;  2RJ9 A;  1LL3 A;  3ZLL A;  3I0H A;  3IGJ A;  4HZD A;  1LXA A;  4Y6N A;  3V0P A;  3I0I X;  3Q80 A;  5C4F A;  4FRM A;  3EE5 A;  2RIT A;  4Y7U A;  1G1L A;  3VBN A;  3BCV A;  4CJC A;  3KWE A;  1QRG A;  2X5Z A;  1NF5 B;  1G2V A;  1ZCY A;  5E3P A;  1NHE B;  5CMI A;  3DUV A;  4HUR A;  4Y63 A;  2OI5 A;  2FYD B;  1IIN A;  4FRH A;  2ICX A;  5CQM X;  1PZT A;  4FRE A;  1XHD A;  1YP4 A;  3SXC A;  3IOJ A;  2PGV A;  3TQD A;  1ZDG A;  2I7B A;  2W0W A;  1ZJ0 A;  1K4V A;  2OI6 A;  1VZT A;  4KNX A;  4K6R A;  1W77 A;  1XHB A;  5C48 A;  2NPO A;  2BO8 A;  3OH4 A;  1ZDF A;  3FSC A;  1H5S B;  2PA4 A;  2BO7 A;  1S4P A;  2ZU7 A;  1V84 A;  3OTZ A;  1FR9 A;  1O0R A;  1MR7 A;  1GA8 A;  1MP4 A;  2XMH A;  4KC4 A;  1SSQ A;  2AES A;  2VFZ A;  3TZT A;  1H4C A;  3I0F A;  5C36 A;  1FWY A;  3Q7U A;  1G3L A;  3I0C A;  3HL3 A;  1VPA A;  4XWI A;  5CMG X;  1FXO A;  1NWG B;  2IUA A;  3V91 A;  4NAI A;  1GX0 A;  3D98 A;  3POL A;  3TWD A;  3V0N A;  4M99 A;  1HV9 A;  1H5R A;  1JVG A;  2A8W A;  1R80 A;  3I3A A;  2P72 A;  1ZJ3 A;  3SX7 A;  3HJJ A;  4FRL A;  5C3B A;  4G87 A;  2O1F A;  1MR9 A;  4N6A A;  2VS3 A;  2V0I A;  3CKJ A;  2DPW A;  3TK8 A;  3GUE A;  1O7O A;  3TIS A;  2ZU9 A;  3IOI A;  5C38 A;  1SS9 A;  1HM9 A;  2JF2 A;  4FRB A;  1E5K A;  1HJL A;  1FRW A;  4KRV A;  2WLD A;  3U2X A;  4DEC A;  1KHR A;  5C47 A;  3ZF8 A;  4H7O A;  3USQ A;  1JYK A;  5E3R A;  3RMW A;  2WEE A;  4EE4 A;  2OEG A;  3O3P A;  3ST8 A;  2Y4L A;  3TV0 A;  4EE5 A;  2QIA A;  1INJ A;  4NAL A;  5C4E A;  1NQI B;  3DJ4 A;  2FFU A;  3GVD A;  2WLC A;  4EQY A;  3I0E A;  4CJB A;  4ARW A;  2YCM A;  4KQL A;  5C3A A;  1ZCU A;  4N6B A;  3SXE A;  2VS4 A;  4Y62 A;  1QRM A;  1INI A;  3VNP A;  2RJ8 A;  1SSM A;  1JV3 A;  2V0K A;  4ECM A;  1H7F A;  2Z87 A;  1TVY A;  2FYC B;  1KK5 A;  5AFU U;  3MC4 A;  2W0V A;  2RIJ A;  3DHO A;  1FGX A;  1R7Y A;  2FFV A;  1JYL A;  2YQS A;  2WVM A;  2FKO A;  1YP3 A;  4NAN A;  2XWL A;  3NGW A;  4KC1 A;  4R36 A;  2WVL A;  4EEM A;  1FO9 A;  1H4D A;  5C4B A;  3E26 A;  3Q1X A;  1G97 A;  3TIO A;  4HUS A;  3EG4 A;  2FYB A;  4CVH A;  4FCE A;  3FOQ A;  2FY7 A;  1R7V A;  1VGZ A;  2WVK A;  3U2V A;  3CKQ A;  2X65 A;  4M2A A;  3OGZ A;  1QRE A;  1GQC A;  2WAW A;  1G8O A;  1R82 A;  3R5C A;  2Q4J A;  4EA8 A;  4YS8 A;  1I52 A;  1R81 A;  2JCJ A;  2Y4M A;  3V0L A;  4E1K A;  1QG8 A;  4FRA A;  1HJJ A;  1OQM B;  3U2U A;  4KT7 A;  3VBL A;  3SPT A;  3SXA A;  4D11 A;  3R1W A;  2WLF A;  1GX4 A;  4KXO A;  5FU8 A;  3SXG A;  1H5T A;  2ICY A;  4FRD A;  5FTV A;  3VBM A;  1G0R A;  3I0J A;  5ADX V;  4IRP A; 
#chains in the Genus database with same CATH topology
 1FOA A;  4E75 A;  1ON8 A;  1LVW A;  1ON6 A;  3OAM A;  1YP2 A;  2QGI A;  2E8B A;  4Y7F A;  3U2T A;  4Y6U A;  4DCL A;  3Q4S A;  2VHE A;  1JV1 A;  1QGQ A;  5C49 A;  3FS8 A;  2RIY A;  1VIC A;  1KK4 A;  3BSY A;  3PKQ A;  1Z2F A;  4BQH A;  3U2W A;  2Y4K A;  3K8E A;  1ZCT A;  3EH0 A;  4EA7 A;  3R5D A;  4Y7T A;  1TDT A;  5CMH A;  3JQY A;  4G3S A;  1ZJP A;  3OH2 A;  4Y64 A;  3E25 A;  4M28 A;  3OH0 A;  4B2X A;  1MC3 A;  3QVB A;  4MYB A;  4HG6 A;  5DG3 A;  2GGQ A;  5C1H A;  3MQG A;  2FYA A;  1LL2 A;  2P73 A;  4HO4 A;  3SXD A;  2OEF A;  2VD4 A;  2O1H A;  3JUJ A;  4Y7G A;  3V0M A;  1W57 A;  1V82 A;  4IHG A;  2RIZ A;  2AGD A;  4HO5 A;  1XAT A;  4ZDQ A;  1S80 A;  2WE9 A;  2VXM A;  3GOS A;  1H7G A;  3D5N A;  3I0L A;  1TW5 A;  3IXC A;  2JCO A;  2VSH A;  3OW5 A;  2ZU8 A;  5CMF X;  1ZI3 A;  3R5B A;  4D11 C;  1QQ0 A;  1XZ6 A;  1NMM B;  1ZHJ A;  3VBP A;  1ZJ1 A;  1KQA A;  2BO6 A;  1WT0 A;  2IC7 A;  2RJ1 A;  1W55 A;  3R0S A;  4KPZ A;  4EAB A;  2VXL A;  3FWW A;  4MFG A;  5FV9 A;  4P00 A;  2IU9 A;  2A8U A;  2YC5 A;  4B4M A;  3OH3 A;  5E3Q A;  4LW3 A;  1FZW A;  4AA7 A;  2APC A;  1TW1 A;  1LZI A;  2JCK A;  5DDV A;  5EJ1 A;  1H7L A;  5C8R A;  2YQC A;  1R7X A;  1LZ7 A;  4HO9 A;  3T7N A;  5DEM A;  1S4O A;  1V3W A;  4ASJ A;  1KK6 A;  1OCX A;  1ZJO A;  2RJ6 A;  4MND A;  1PZY B;  3BSS A;  1GWV A;  3TDT A;  4P02 A;  1FG5 N;  3I0K A;  5FUH A;  1SST A;  1QGS A;  5IDS A;  1VZU A;  3T7O A;  2X60 A;  1H7E A;  1GQ9 A;  1H5S A;  5CMJ A;  5JQQ A;  1WT3 A;  2D7I A;  4MYO A;  4DE7 A;  4IHH A;  1QRL A;  1MRL A;  1FO8 A;  2JF3 A;  5AJN A;  1YRO B;  3BSW A;  1VM8 A;  1ZIZ A;  3VBK A;  2X5S A;  2VK9 A;  3PMO A;  1VZX A;  2BO4 A;  2XWM A;  5DDT A;  2WLG A;  3SUC A;  3T57 A;  5ADX U;  4EA9 A;  2VSI A;  1HM0 A;  4B5B A;  4NAK A;  2QIV X;  1LL0 A;  2JCL A;  5L6V A;  4B4G A;  2Z86 A;  3KIA A;  4Y7V A;  3OKR A;  2AEC A;  2RIX A;  3F1X A;  5CQL X;  3I3X A;  1VGT A;  3LW6 A;  3SX5 A;  3OUP A;  1KGT A;  3T7M A;  5C1L A;  1IIM A;  2WGZ A;  1LZ0 A;  3KWC A;  3USR A;  4J18 A;  3F1Y A;  3F1C A;  3SX3 A;  3SXB A;  1OMX A;  2P6W A;  4KC2 A;  1G95 A;  4CJ8 A;  4G3P A;  3V4E A;  3RSB A;  1ZJ2 A;  4BMA A;  2D7R A;  1KRR A;  1VGU A;  5I1F A;  4FCU A;  3SRT A;  2Y4J A;  4HOC A;  4G3Q A;  2E3D A;  2GGO A;  3OH1 A;  2PGY A;  4GBP A;  1H4E A;  1THJ A;  2XAT A;  3C8V A;  4AYL A;  1L0S A;  4KPX A;  3CJ8 A;  5FYE A;  2V0J A;  1QWJ A;  2YC3 A;  3GQ7 A;  3ZLK A;  4HCQ A;  3R8Y A;  4B2W A;  1G9R A;  3IOH A;  3RMV A;  5U2K A;  3N9W A;  1H5S C;  1S4N A;  2I5K A;  1H7Q A;  2P2O A;  4B42 A;  3CU0 A;  3JTJ A;  1M8N A;  3VBI A;  4Y9X A;  1H7T A;  1NKH B;  4AYJ A;  2I5E A;  3R3R A;  2YQH A;  3U0Y A;  5FTS A;  4D48 A;  3JUK A;  4M2B A;  1WT2 A;  4HO6 A;  1KWS A;  4FRP A;  3DK5 A;  1H3M A;  1LZJ A;  3NZ2 A;  4O6N A;  4C2S A;  4D0Z A;  1ZCV A;  2OI7 A;  3EEV A;  2O1G A;  3HSQ A;  4R7P A;  4B3U A;  3MQH A;  1TZF A;  5CQO A;  3I0G A;  1H7H A;  5FU0 A;  1FGG A;  1VH1 A;  2XWN A;  2IU8 A;  2QKX A;  4EGG A;  3V0Q A;  1V67 A;  3I0D A;  3ZGG A;  5AJO A;  1GWW A;  4AC3 A;  1G93 A;  4FRO A;  2AE7 A;  1R7U A;  4HO0 A;  3KWD A;  2NXV A;  4ASY A;  1R7T A;  5J49 A;  4JD0 A;  3P47 A;  3SX8 A;  2RJ0 A;  1J2Z A;  1EYR A;  1H5S D;  4EEA A;  3V0O A;  4DDZ A;  3CKV A;  3R5A A;  1VGW A;  1ZI4 A;  2TDT A;  3CKN A;  1V83 A;  4FQW A;  1EWW A;  2YES A;  4E6T A;  1KRU A;  4Q7C A;  4R37 A;  1FR8 A;  3FSY A;  2D0J A;  4FIX A;  1HM8 A;  4EEG A;  5BXC A;  2RJ5 A;  4HZC A;  4HO8 A;  5C1G A;  1G23 A;  4AAW A;  2QH5 A;  4LW6 A;  2VS5 A;  1VH3 A;  4M9C A;  3FSB A;  1O23 B;  2V0L A;  3BXY A;  2Y7A A;  5IFY A;  2UX8 A;  1KGQ A;  3BRK X;  5CQP A;  4N69 A;  2J0A A;  5EIY A;  1EZI A;  1H5T B;  4FRQ A;  4O6M A;  3R3I A;  4N27 A;  2WLE A;  2V0H A;  5F42 A;  1OMZ A;  3OC9 A;  1WSZ A;  5AJP A;  5L6S A;  4M98 A;  1JVD A;  2PX7 A;  3FSX A;  4EE3 A;  4E79 A;  2CU2 A;  1T3D A;  4IRQ A;  3K8D A;  4ISX A;  1KRV A;  4E6U A;  3OU9 A;  4J09 A;  3V90 A;  1WT1 A;  3FTT A;  1Z90 A;  5EJZ A;  1WVC A;  4D0T A;  5C3D A;  1ZI5 A;  4EEO A;  2AM3 A;  5DEP A;  1FXJ A;  3CKO A;  3BFP A;  5HS2 A;  4IHF A;  4EVW A;  5C4C A;  2YQJ A;  4HO3 A;  4MZU A;  1MP5 A;  3ZGF A;  3VBJ A;  4UEG A;  3V8Y A;  4EAA A;  5CQN X;  2MZB A;  2AM5 A;  2AH9 A;  2XME A;  4HO2 A;  1MP3 A;  3CGX A;  4L41 C;  2AQ9 A;  3OTM A;  2AM4 A;  2RJ4 A;  3PKP A;  4KNR A;  3PNN A;  3ECT A;  3R2W A;  4MIX A;  1H5R B;  3V8Z A;  1QRF A;  1ZI1 A;  4B4B A;  2Y6P A;  1N4I A;  1O7Q A;  4JIS A;  4M4K A;  3P1B A;  5C4D A;  2RJ7 A;  5IDT A;  5AFU V;  3U0X A;  3D8V A;  2RJ9 A;  1LL3 A;  3ZLL A;  3I0H A;  3IGJ A;  4HZD A;  1LXA A;  4Y6N A;  3V0P A;  3I0I X;  3GQ8 A;  3Q80 A;  5C4F A;  4FRM A;  3EE5 A;  2RIT A;  4Y7U A;  1G1L A;  3VBN A;  3BCV A;  4CJC A;  3KWE A;  1QRG A;  5D92 A;  2X5Z A;  1NF5 B;  1G2V A;  1ZCY A;  5E3P A;  1NHE B;  5CMI A;  3DUV A;  4HUR A;  4Y63 A;  2OI5 A;  2FYD B;  1IIN A;  4FRH A;  2ICX A;  5CQM X;  1PZT A;  4FRE A;  1XHD A;  1YP4 A;  3SXC A;  3IOJ A;  2PGV A;  3GQA A;  3TQD A;  1ZDG A;  2I7B A;  2W0W A;  1ZJ0 A;  1K4V A;  2OI6 A;  1VZT A;  4KNX A;  4K6R A;  1W77 A;  1XHB A;  5C48 A;  2NPO A;  2BO8 A;  3OH4 A;  1ZDF A;  3FSC A;  1H5S B;  2PA4 A;  2BO7 A;  1S4P A;  2ZU7 A;  1V84 A;  3OTZ A;  1FR9 A;  1O0R A;  1MR7 A;  1GA8 A;  1MP4 A;  2XMH A;  4KC4 A;  1SSQ A;  2AES A;  2VFZ A;  3TZT A;  1H4C A;  3I0F A;  5D91 A;  1FWY A;  3Q7U A;  5C36 A;  1G3L A;  3I0C A;  3HL3 A;  1VPA A;  4XWI A;  5CMG X;  1FXO A;  1NWG B;  2IUA A;  3V91 A;  4NAI A;  2J0B A;  1GX0 A;  3D98 A;  3POL A;  3TWD A;  3V0N A;  4M99 A;  1HV9 A;  4FIY A;  1H5R A;  1JVG A;  2A8W A;  1R80 A;  3I3A A;  2P72 A;  1ZJ3 A;  3SX7 A;  3HJJ A;  4FRL A;  5C3B A;  4G87 A;  2O1F A;  1MR9 A;  4N6A A;  2VS3 A;  2V0I A;  3CKJ A;  2DPW A;  3TK8 A;  3GUE A;  1O7O A;  3TIS A;  2ZU9 A;  3IOI A;  5C38 A;  1SS9 A;  1HM9 A;  2JF2 A;  4FRB A;  1E5K A;  1HJL A;  1FRW A;  4KRV A;  2WLD A;  3U2X A;  4DEC A;  1KHR A;  5C47 A;  3ZF8 A;  4H7O A;  3USQ A;  1JYK A;  5E3R A;  3RMW A;  2WEE A;  4EE4 A;  2OEG A;  3O3P A;  3ST8 A;  2Y4L A;  3TV0 A;  4EE5 A;  2QIA A;  1INJ A;  4NAL A;  5C4E A;  1NQI B;  3DJ4 A;  2FFU A;  3GVD A;  2WLC A;  4EQY A;  3I0E A;  4CJB A;  4ARW A;  2YCM A;  4KQL A;  5C3A A;  1ZCU A;  4N6B A;  3SXE A;  2VS4 A;  4Y62 A;  1QRM A;  1INI A;  3VNP A;  2RJ8 A;  1SSM A;  1JV3 A;  2V0K A;  4ECM A;  1H7F A;  2Z87 A;  1TVY A;  2FYC B;  1KK5 A;  3GQ9 A;  5AFU U;  3MC4 A;  2W0V A;  2RIJ A;  3DHO A;  1FGX A;  1R7Y A;  2FFV A;  1JYL A;  2YQS A;  2WVM A;  2FKO A;  1YP3 A;  4NAN A;  2XWL A;  3NGW A;  4KC1 A;  4R36 A;  2WVL A;  4EEM A;  1FO9 A;  1H4D A;  5C4B A;  3E26 A;  3Q1X A;  1G97 A;  3TIO A;  4HUS A;  3EG4 A;  2FYB A;  4CVH A;  4FCE A;  3FOQ A;  2FY7 A;  1R7V A;  1VGZ A;  2WVK A;  3U2V A;  3CKQ A;  2X65 A;  4M2A A;  3OGZ A;  1QRE A;  1GQC A;  2WAW A;  1G8O A;  1R82 A;  3R5C A;  2Q4J A;  4EA8 A;  4YS8 A;  1I52 A;  1R81 A;  2JCJ A;  2Y4M A;  3V0L A;  4E1K A;  2C0N A;  1QG8 A;  4FRA A;  1HJJ A;  1OQM B;  3U2U A;  4KT7 A;  3VBL A;  3SPT A;  3SXA A;  4D11 A;  3R1W A;  2WLF A;  1GX4 A;  4KXO A;  5FU8 A;  3SXG A;  1H5T A;  2ICY A;  4FRD A;  5FTV A;  3VBM A;  1G0R A;  3I0J A;  5ADX V;  4IRP A; 
#chains in the Genus database with same CATH homology
 1FOA A;  4E75 A;  1ON8 A;  1LVW A;  1ON6 A;  3OAM A;  1YP2 A;  2QGI A;  2E8B A;  4Y7F A;  3U2T A;  4Y6U A;  4DCL A;  3Q4S A;  2VHE A;  1JV1 A;  1QGQ A;  5C49 A;  3FS8 A;  2RIY A;  1VIC A;  1KK4 A;  3BSY A;  3PKQ A;  4BQH A;  3U2W A;  2Y4K A;  3K8E A;  1ZCT A;  3EH0 A;  4EA7 A;  3R5D A;  4Y7T A;  1TDT A;  5CMH A;  3JQY A;  4G3S A;  1ZJP A;  3OH2 A;  4Y64 A;  3E25 A;  4M28 A;  3OH0 A;  4B2X A;  1MC3 A;  3QVB A;  4MYB A;  4HG6 A;  5DG3 A;  2GGQ A;  5C1H A;  3MQG A;  2FYA A;  1LL2 A;  2P73 A;  4HO4 A;  3SXD A;  2OEF A;  2VD4 A;  2O1H A;  3JUJ A;  4Y7G A;  3V0M A;  1W57 A;  1V82 A;  4IHG A;  2RIZ A;  2AGD A;  4HO5 A;  1XAT A;  4ZDQ A;  1S80 A;  2WE9 A;  2VXM A;  3GOS A;  1H7G A;  3D5N A;  3I0L A;  1TW5 A;  3IXC A;  2JCO A;  2VSH A;  3OW5 A;  2ZU8 A;  5CMF X;  1ZI3 A;  3R5B A;  4D11 C;  1QQ0 A;  1XZ6 A;  1NMM B;  1ZHJ A;  3VBP A;  1ZJ1 A;  1KQA A;  2BO6 A;  1WT0 A;  2IC7 A;  2RJ1 A;  1W55 A;  3R0S A;  4KPZ A;  4EAB A;  2VXL A;  3FWW A;  4MFG A;  5FV9 A;  4P00 A;  2IU9 A;  2A8U A;  2YC5 A;  4B4M A;  5E3Q A;  3OH3 A;  4LW3 A;  1FZW A;  4AA7 A;  2APC A;  1TW1 A;  1LZI A;  2JCK A;  5DDV A;  5EJ1 A;  1H7L A;  5C8R A;  2YQC A;  1R7X A;  1LZ7 A;  4HO9 A;  3T7N A;  5DEM A;  1S4O A;  1V3W A;  4ASJ A;  1KK6 A;  1OCX A;  1ZJO A;  2RJ6 A;  4MND A;  1PZY B;  3BSS A;  1GWV A;  3TDT A;  4P02 A;  1FG5 N;  3I0K A;  5FUH A;  1SST A;  1QGS A;  5IDS A;  1VZU A;  3T7O A;  2X60 A;  1H7E A;  1GQ9 A;  1H5S A;  5CMJ A;  5JQQ A;  1WT3 A;  2D7I A;  4MYO A;  4DE7 A;  4IHH A;  1QRL A;  1MRL A;  1FO8 A;  2JF3 A;  5AJN A;  1YRO B;  3BSW A;  1VM8 A;  1ZIZ A;  3VBK A;  2X5S A;  2VK9 A;  3PMO A;  1VZX A;  2BO4 A;  2XWM A;  5DDT A;  2WLG A;  3T57 A;  5ADX U;  4EA9 A;  2VSI A;  1HM0 A;  4B5B A;  4NAK A;  2QIV X;  1LL0 A;  2JCL A;  5L6V A;  4B4G A;  2Z86 A;  3KIA A;  4Y7V A;  3OKR A;  2AEC A;  2RIX A;  3F1X A;  5CQL X;  3I3X A;  1VGT A;  3LW6 A;  3SX5 A;  3OUP A;  1KGT A;  3T7M A;  5C1L A;  1IIM A;  2WGZ A;  1LZ0 A;  3KWC A;  3USR A;  4J18 A;  3F1Y A;  3F1C A;  3SX3 A;  3SXB A;  1OMX A;  2P6W A;  4KC2 A;  1G95 A;  4CJ8 A;  4G3P A;  3V4E A;  3RSB A;  1ZJ2 A;  4BMA A;  2D7R A;  1KRR A;  1VGU A;  5I1F A;  4FCU A;  3SRT A;  2Y4J A;  4HOC A;  4G3Q A;  2E3D A;  2GGO A;  3OH1 A;  2PGY A;  4GBP A;  1H4E A;  1THJ A;  2XAT A;  3C8V A;  4AYL A;  4KPX A;  3CJ8 A;  5FYE A;  2V0J A;  1QWJ A;  2YC3 A;  3ZLK A;  4HCQ A;  3R8Y A;  4B2W A;  1G9R A;  3IOH A;  3RMV A;  5U2K A;  3N9W A;  1H5S C;  1S4N A;  2I5K A;  1H7Q A;  2P2O A;  4B42 A;  3CU0 A;  3JTJ A;  3VBI A;  4Y9X A;  1H7T A;  1NKH B;  4AYJ A;  2I5E A;  3R3R A;  2YQH A;  3U0Y A;  5FTS A;  4D48 A;  3JUK A;  4M2B A;  1WT2 A;  4HO6 A;  1KWS A;  4FRP A;  3DK5 A;  1H3M A;  1LZJ A;  3NZ2 A;  4O6N A;  4C2S A;  4D0Z A;  1ZCV A;  2OI7 A;  3EEV A;  2O1G A;  3HSQ A;  4R7P A;  4B3U A;  3MQH A;  1TZF A;  5CQO A;  3I0G A;  1H7H A;  5FU0 A;  1FGG A;  1VH1 A;  2XWN A;  2IU8 A;  2QKX A;  4EGG A;  3V0Q A;  1V67 A;  3I0D A;  3ZGG A;  5AJO A;  1GWW A;  4AC3 A;  1G93 A;  4FRO A;  2AE7 A;  1R7U A;  4HO0 A;  3KWD A;  2NXV A;  4ASY A;  1R7T A;  5J49 A;  4JD0 A;  3P47 A;  3SX8 A;  2RJ0 A;  1J2Z A;  1EYR A;  1H5S D;  4EEA A;  3V0O A;  4DDZ A;  3CKV A;  3R5A A;  1VGW A;  1ZI4 A;  2TDT A;  3CKN A;  1V83 A;  4FQW A;  2YES A;  4E6T A;  1KRU A;  4Q7C A;  4R37 A;  1FR8 A;  3FSY A;  2D0J A;  4FIX A;  1HM8 A;  4EEG A;  5BXC A;  2RJ5 A;  4HZC A;  4HO8 A;  5C1G A;  1G23 A;  4AAW A;  2QH5 A;  4LW6 A;  2VS5 A;  1VH3 A;  4M9C A;  3FSB A;  1O23 B;  2V0L A;  3BXY A;  2Y7A A;  5IFY A;  2UX8 A;  1KGQ A;  3BRK X;  5CQP A;  4N69 A;  2J0A A;  5EIY A;  1EZI A;  1H5T B;  4FRQ A;  4O6M A;  3R3I A;  4N27 A;  2WLE A;  2V0H A;  5F42 A;  1OMZ A;  3OC9 A;  1WSZ A;  5AJP A;  5L6S A;  4M98 A;  1JVD A;  2PX7 A;  3FSX A;  4EE3 A;  4E79 A;  2CU2 A;  1T3D A;  4IRQ A;  3K8D A;  4ISX A;  1KRV A;  4E6U A;  3OU9 A;  4J09 A;  3V90 A;  1WT1 A;  3FTT A;  1Z90 A;  5EJZ A;  1WVC A;  4D0T A;  5C3D A;  1ZI5 A;  4EEO A;  2AM3 A;  5DEP A;  1FXJ A;  3CKO A;  3BFP A;  5HS2 A;  4IHF A;  4EVW A;  5C4C A;  2YQJ A;  4HO3 A;  4MZU A;  1MP5 A;  3ZGF A;  3VBJ A;  4UEG A;  3V8Y A;  4EAA A;  5CQN X;  2MZB A;  2AM5 A;  2AH9 A;  2XME A;  4HO2 A;  1MP3 A;  3CGX A;  4L41 C;  2AQ9 A;  3OTM A;  2AM4 A;  2RJ4 A;  3PKP A;  4KNR A;  3PNN A;  3ECT A;  3R2W A;  4MIX A;  1H5R B;  3V8Z A;  1QRF A;  1ZI1 A;  4B4B A;  2Y6P A;  1O7Q A;  4JIS A;  4M4K A;  3P1B A;  5C4D A;  2RJ7 A;  5IDT A;  5AFU V;  3U0X A;  3D8V A;  2RJ9 A;  1LL3 A;  3ZLL A;  3I0H A;  3IGJ A;  4HZD A;  1LXA A;  4Y6N A;  3V0P A;  3I0I X;  3Q80 A;  5C4F A;  4FRM A;  3EE5 A;  2RIT A;  4Y7U A;  1G1L A;  3VBN A;  3BCV A;  4CJC A;  3KWE A;  1QRG A;  5D92 A;  2X5Z A;  1NF5 B;  1G2V A;  1ZCY A;  5E3P A;  1NHE B;  5CMI A;  3DUV A;  4HUR A;  4Y63 A;  2OI5 A;  2FYD B;  1IIN A;  4FRH A;  2ICX A;  5CQM X;  1PZT A;  4FRE A;  1XHD A;  1YP4 A;  3SXC A;  3IOJ A;  2PGV A;  3TQD A;  1ZDG A;  2I7B A;  2W0W A;  1ZJ0 A;  1K4V A;  2OI6 A;  1VZT A;  4KNX A;  4K6R A;  1W77 A;  1XHB A;  5C48 A;  2NPO A;  2BO8 A;  3OH4 A;  1ZDF A;  3FSC A;  1H5S B;  2PA4 A;  2BO7 A;  1S4P A;  2ZU7 A;  1V84 A;  3OTZ A;  1FR9 A;  1O0R A;  1MR7 A;  1GA8 A;  1MP4 A;  2XMH A;  4KC4 A;  1SSQ A;  2AES A;  2VFZ A;  3TZT A;  1H4C A;  3I0F A;  5D91 A;  1FWY A;  3Q7U A;  5C36 A;  1G3L A;  3I0C A;  3HL3 A;  1VPA A;  4XWI A;  5CMG X;  1FXO A;  1NWG B;  2IUA A;  3V91 A;  4NAI A;  2J0B A;  1GX0 A;  3D98 A;  3POL A;  3TWD A;  3V0N A;  4M99 A;  1HV9 A;  4FIY A;  1H5R A;  1JVG A;  2A8W A;  1R80 A;  3I3A A;  2P72 A;  1ZJ3 A;  3SX7 A;  3HJJ A;  4FRL A;  5C3B A;  4G87 A;  2O1F A;  1MR9 A;  4N6A A;  2VS3 A;  2V0I A;  3CKJ A;  2DPW A;  3TK8 A;  3GUE A;  1O7O A;  3TIS A;  2ZU9 A;  3IOI A;  5C38 A;  1SS9 A;  1HM9 A;  2JF2 A;  4FRB A;  1E5K A;  1HJL A;  1FRW A;  4KRV A;  2WLD A;  3U2X A;  4DEC A;  1KHR A;  5C47 A;  3ZF8 A;  4H7O A;  3USQ A;  1JYK A;  5E3R A;  3RMW A;  2WEE A;  4EE4 A;  2OEG A;  3O3P A;  3ST8 A;  2Y4L A;  3TV0 A;  4EE5 A;  2QIA A;  1INJ A;  4NAL A;  5C4E A;  1NQI B;  3DJ4 A;  2FFU A;  3GVD A;  2WLC A;  4EQY A;  3I0E A;  4CJB A;  4ARW A;  2YCM A;  4KQL A;  5C3A A;  1ZCU A;  4N6B A;  3SXE A;  2VS4 A;  4Y62 A;  1QRM A;  1INI A;  3VNP A;  2RJ8 A;  1SSM A;  1JV3 A;  2V0K A;  4ECM A;  1H7F A;  2Z87 A;  1TVY A;  2FYC B;  1KK5 A;  5AFU U;  3MC4 A;  2W0V A;  2RIJ A;  3DHO A;  1FGX A;  1R7Y A;  2FFV A;  1JYL A;  2YQS A;  2WVM A;  2FKO A;  1YP3 A;  4NAN A;  2XWL A;  3NGW A;  4KC1 A;  4R36 A;  2WVL A;  4EEM A;  1FO9 A;  1H4D A;  5C4B A;  3E26 A;  3Q1X A;  1G97 A;  3TIO A;  4HUS A;  3EG4 A;  2FYB A;  4CVH A;  4FCE A;  3FOQ A;  2FY7 A;  1R7V A;  1VGZ A;  2WVK A;  3U2V A;  3CKQ A;  2X65 A;  4M2A A;  3OGZ A;  1QRE A;  1GQC A;  2WAW A;  1G8O A;  1R82 A;  3R5C A;  2Q4J A;  4EA8 A;  4YS8 A;  1I52 A;  1R81 A;  2JCJ A;  2Y4M A;  3V0L A;  4E1K A;  2C0N A;  1QG8 A;  4FRA A;  1HJJ A;  1OQM B;  3U2U A;  4KT7 A;  3VBL A;  3SPT A;  3SXA A;  4D11 A;  3R1W A;  2WLF A;  1GX4 A;  4KXO A;  5FU8 A;  3SXG A;  1H5T A;  2ICY A;  4FRD A;  5FTV A;  3VBM A;  1G0R A;  3I0J A;  5ADX V;  4IRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...