4K6RA

Crystal structure of glmu in complex with atp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
469
structure length
469
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Bifunctional protein GlmU
publication title GlmU (N-acetylglucosamine-1-phosphate uridyltransferase) bound to three magnesium ions and ATP at the active site
doi rcsb
source organism Mycobacterium tuberculosis
total genus 176
structure length 469
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4k6rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4k6rA01
4HO6A 1SSMA 1JVGA 2XMHA 3T57A 1E5KA 2V0HA 3U2XA 5ADXV 2V0KA 4LW3A 4B4GA 1H4CA 2Y4KA 3K8DA 4HO4A 2NXVA 3OH0A 1EZIA 4MNDA 1PZYB 3E26A 1G2VA 4KNRA 4M99A 1MP4A 4D0TA 1MR9A 4MYOA 3ZGFA 1MP3A 2ZU9A 1O7QA 2GGQA 2BO8A 2O1HA 1H5SD 3R5AA 1ZCTA 4N69A 2UX8A 3SXBA 1QRFA 2DPWA 3CKOA 4NANA 1JYKA 5AJOA 1G93A 2V0JA 3FS8A 3I0HA 2VS4A 4IHHA 2WLDA 1R81A 5E3PA 4FRLA 5EJZA 3Q80A 3EG4A 1LZIA 4E6TA 3TZTA 3BSYA 5FU0A 5BXCA 2X5ZA 4FCEA 2P73A 1R7YA 1QQ0A 4DCLA 3MC4A 3F1YA 2BO4A 4NAKA 1VPAA 1QGQA 2WEEA 3OTZA 4J18A 1ZJ3A 1WT1A 1QGSA 1VGZA 1JV1A 4B2WA 1R7XA 1WT2A 3SXCA 2WAWA 2XWNA 3V8ZA 4DE7A 1INJA 5FTVA 1T3DA 3SX5A 4D0ZA 2AM4A 2IUAA 3MQHA 1VZTA 2E3DA 1OQMB 5C3BA 1GA8A 3I0FA 2D7RA 1THJA 1HJJA 2APCA 3HL3A 5U2KA 1WVCA 3SXEA 5FV9A 4EGGA 1H3MA 4Y9XA 2IU9A 1JV3A 1MP5A 3CGXA 4AC3A 3TIOA 1IIMA 3CJ8A 2X5SA 1LZJA 4R37A 1J2ZA 2W0VA 2QKXA 4N27A 1H5SB 4EE4A 3FWWA 1QRGA 2RJ5A 4E75A 2X65A 3TDTA 3I0IX 5E3RA 1ZJ2A 2D0JA 2GGOA 4EEOA 3D8VA 4Y7VA 2I7BA 1YP3A 1H5RB 5C1GA 3I0GA 1I52A 4EE3A 3MQGA 4AAWA 3SRTA 1EYRA 3TV0A 4EABA 4HZDA 2Y4LA 4EEAA 4B2XA 3DHOA 1HM8A 1O0RA 2VXMA 4FRBA 4G3SA 1VGWA 2RJ1A 3R3RA 1FRWA 2V0LA 4FROA 3IOIA 3I0KA 5DDTA 1XHBA 3I0CA 5F42A 4E6UA 4G3PA 1NKHB 1LL2A 2YQCA 1XZ6A 3RSBA 3SXAA 1TDTA 2WVMA 3JUKA 2FYBA 2IU8A 1VGTA 1H7TA 4KC2A 2I5EA 3TISA 1K4VA 1H7GA 1FXJA 3GOSA 2NPOA 5EIYA 4MZUA 3USQA 1GQ9A 4HO2A 1LL0A 5CQMX 1VZUA 2Y4MA 1WT0A 1KGTA 3ST8A 2I5KA 2IC7A 1H4EA 1V82A 2Y4JA 1ZJPA 4LW6A 1JYLA 2AECA 4JISA 1ON8A 2BO6A 2AM3A 1ZDGA 4H7OA 4IHGA 1R80A 3NZ2A 2P72A 2CU2A 2WLCA 4FQWA 3PNNA 3NGWA 4C2SA 1TVYA 2V0IA 4M4KA 1KK4A 3VBKA 3V91A 1Z90A 3LW6A 4ISXA 5C4FA 3FOQA 4CJCA 4CJBA 5J49A 2MZBA 1H7FA 3KWCA 3EEVA 2RIZA 3CKJA 3OH2A 4G87A 4N6AA 4HOCA 4KC1A 4E79A 5C47A 3IGJA 3TQDA 4FRHA 2E8BA 1VICA 2FYAA 3CKNA 3BSWA 2WVKA 5DEMA 3Q7UA 3U2WA 1H5TA 4NAIA 4FRPA 1ZIZA 4IRQA 1QRMA 5IDTA 2FY7A 1FOAA 2YQSA 2WVLA 4B4MA 2RJ0A 1VH1A 3JQYA 1LZ7A 3T7MA 1JVDA 1ZCUA 1HM9A 3Q4SA 3RMWA 2XWMA 1ON6A 4AYJA 3I0LA 4ZDQA 4B42A 4E1KA 2YCMA 4EEGA 2WE9A 4HCQA 5I1FA 3IXCA 5C49A 4M98A 1H4DA 1KHRA 1VGUA 1V67A 4Y7UA 4Y7FA 4EAAA 3V0QA 1V3WA 1W57A 4UEGA 3SX3A 4CJ8A 4EEMA 3K8EA 4P02A 1G95A 1G9RA 2X60A 5L6VA 4M28A 4KPZA 1R7VA 3ZLLA 3R5BA 4Y63A 3R1WA 1KQAA 5AJPA 1KWSA 4Y6NA 2WGZA 2YESA 3QVBA 5DEPA 1TW1A 1S4NA 2JCKA 2TDTA 5DDVA 2VXLA 2VS5A 3OU9A 5CMHA 1ZI5A 1ZDFA 3BRKX 2AESA 5AFUV 2VSHA 1S4PA 3T7OA 3FSYA 4KNXA 2PA4A 2QGIA 2AH9A 1SS9A 1W55A 5IDSA 1LL3A 3V0PA 2RJ4A 3DK5A 3DJ4A 2OEFA 1KGQA 3IOJA 1GQCA 2AQ9A 3V0MA 1H5SC 3R5CA 3U0XA 2YC5A 1HM0A 1FO9A 5AFUU 2VFZA 2RIXA 2ZU8A 3VBPA 1QREA 4GBPA 2XMEA 2XATA 3PKPA 2RITA 2W0WA 4B4BA 1KK6A 5DG3A 2QIVX 4M2BA 4B5BA 1S4OA 4Y7TA 4EQYA 4KT7A 2FYCB 1H7QA 4FRDA 1R7UA 2Z86A 4ECMA 1LVWA 1H5RA 2ZU7A 3BSSA 3EH0A 3I3XA 4Y6UA 3BCVA 2OEGA 3OGZA 1FR9A 5AJNA 1IINA 5C4DA 2RJ9A 2Q4JA 3VBIA 2RJ6A 3D5NA 3PKQA 1YP2A 3OKRA 1H7EA 2QIAA 5HS2A 1O23B 2PGYA 4AYLA 3VBLA 3KWEA 1ZJOA 3OC9A 3JUJA 4HO3A 3PMOA 1ZI3A 4IRPA 4Y62A 2JF3A 3V0LA 4KPXA 4K6RA 4M2AA 1VZXA 1QG8A 3OH1A 1G8OA 2VD4A 3DUVA 1H7HA 1XHDA 1GX4A 1NWGB 4B3UA 2O1GA 4R7PA 3T7NA 5FTSA 2AE7A 3R5DA 1V83A 1W77A 5L6SA 3EE5A 3CKVA 1WT3A 3ZGGA 5C36A 1V84A 3I0JA 3FTTA 4HG6A 1SSTA 1INIA 1H5TB 1QRLA 2D7IA 1FR8A 1YROB 1GWVA 3I0EA 3SX8A 3F1XA 3KIAA 3I3AA 3R0SA 1TZFA 4FRMA 5E3QA 3R3IA 1WSZA 5CQOA 3P47A 4HURA 4MFGA 5EJ1A 4EE5A 3I0DA 5CMGX 4YS8A 1KK5A 3C8VA 1NHEB 1ZI1A 2JCJA 3HJJA 2O1FA 3BFPA 1MR7A 4EA7A 2A8WA 3O3PA 1GWWA 5CQPA 1FXOA 5C4CA 4CVHA 4FRAA 3SXGA 5IFYA 1MRLA 2VHEA 1G23A 3ECTA 2YQJA 1HJLA 1HV9A 5ADXU 2WLFA 1G1LA 1R7TA 5C8RA 1R82A 4ASJA 2PX7A 1O7OA 4EA9A 2JF2A 5C1LA 5C4BA 5C3DA 1ZI4A 2RJ8A 2FFUA 1FWYA 1VH3A 3JTJA 4NALA 3V4EA 3POLA 2JCOA 2Y7AA 2XWLA 5CMJA 1ZJ1A 3OAMA 3SX7A 3V8YA 3U0YA 1FZWA 1ZJ0A 2WLEA 2P6WA 2FFVA 4L41C 4XWIA 2RJ7A 2A8UA 2VS3A 3TK8A 1QWJA 1FG5N 3V0OA 3TWDA 5FYEA 2RIYA 1XATA 1SSQA 1G3LA 2ICYA 4IHFA 5CQLX 4G3QA 5JQQA 1ZCYA 4D48A 1OCXA 4BMAA 1FGXA 3ZLKA 2ICXA 4HO5A 1FO8A 3GVDA 3USRA 3E25A 4P00A 2BO7A 2WLGA 4MYBA 3V0NA 4M9CA 2AGDA 3OUPA 4EVWA 2FKOA 1FGGA 2Z87A 3D98A 2OI6A 1S80A 5C1HA 1KRRA 3VBJA 5C48A 5C4EA 4HUSA 1GX0A 2VSIA 5FU8A 1VM8A 5CQNX 3VBMA 1H5SA 3BXYA 4EA8A 4FCUA 2Y6PA 2OI5A 5C38A 3U2TA 4FRQA 4KQLA 3FSCA 3OH3A 3U2VA 3U2UA 1ZHJA 3OW5A 5CMFX 3KWDA 5CMIA 4DECA 4Y7GA 3RMVA 4HO9A 4HO0A 2YC3A 3SPTA 1PZTA 1TW5A 1YP4A 4R36A 3CKQA 4JD0A 4ASYA 4ARWA 3IOHA 1LXAA 1OMZA 1H7LA 3SXDA 3GUEA 1ZCVA 3R8YA 1LZ0A 3Q1XA 4AA7A 4J09A 2QH5A 3VBNA 2RIJA 3VNPA 1NQIB 4HO8A 3F1CA 4KC4A 3HSQA 3OTMA 1NMMB 1G0RA 2PGVA 4KRVA 4D11C 4HZCA 2YQHA 4DDZA 3OH4A 4Y64A 3P1BA 1OMXA 3ZF8A 1KRVA 2JCLA 1NF5B 2AM5A 4D11A 3FSXA 4KXOA 2P2OA 1G97A 4FREA 1MC3A 5FUHA 2FYDB 3CU0A 4N6BA 4BQHA 3N9WA 3R2WA 3V90A 5C3AA 1KRUA 3FSBA 2OI7A
chains in the Genus database with same CATH superfamily
4HO6A 1SSMA 1JVGA 2XMHA 3T57A 1E5KA 2V0HA 3U2XA 5ADXV 2V0KA 4LW3A 4B4GA 1H4CA 2Y4KA 3K8DA 4HO4A 2NXVA 2J0BA 3OH0A 1EZIA 4MNDA 1PZYB 3E26A 1G2VA 4KNRA 4M99A 1MP4A 4D0TA 1MR9A 4MYOA 3ZGFA 1MP3A 2ZU9A 3GQAA 1O7QA 2GGQA 2BO8A 2O1HA 1H5SD 3R5AA 1ZCTA 4N69A 2UX8A 3SXBA 1QRFA 2DPWA 3CKOA 4NANA 1JYKA 5AJOA 1G93A 2V0JA 3FS8A 3I0HA 2VS4A 4IHHA 2WLDA 1R81A 5E3PA 4FRLA 5EJZA 3Q80A 3EG4A 1LZIA 4E6TA 3TZTA 3BSYA 5FU0A 5BXCA 5D92A 2X5ZA 4FCEA 2P73A 1R7YA 1QQ0A 4DCLA 3MC4A 3F1YA 2BO4A 4NAKA 1VPAA 1QGQA 2WEEA 3OTZA 4J18A 1ZJ3A 1WT1A 1QGSA 1VGZA 1JV1A 4B2WA 1R7XA 1WT2A 3SXCA 2WAWA 2XWNA 3V8ZA 4DE7A 1INJA 5FTVA 1T3DA 3SX5A 4D0ZA 2AM4A 2IUAA 3MQHA 1VZTA 2E3DA 1OQMB 5C3BA 1GA8A 3I0FA 2D7RA 1THJA 1HJJA 2APCA 3HL3A 5U2KA 1WVCA 3SXEA 5FV9A 4EGGA 1H3MA 4Y9XA 2IU9A 1JV3A 1MP5A 3CGXA 4AC3A 3TIOA 1IIMA 3CJ8A 2X5SA 1LZJA 4R37A 1J2ZA 2W0VA 2QKXA 4N27A 1H5SB 4EE4A 3FWWA 1QRGA 2RJ5A 4E75A 2X65A 3TDTA 3I0IX 5E3RA 1ZJ2A 2D0JA 2GGOA 4EEOA 4Q7CA 3D8VA 4Y7VA 2I7BA 1YP3A 1H5RB 5C1GA 3I0GA 1I52A 4EE3A 3MQGA 4AAWA 3SRTA 1EYRA 3TV0A 4EABA 4HZDA 2Y4LA 4EEAA 4B2XA 3DHOA 1HM8A 1O0RA 2VXMA 4FRBA 4G3SA 1VGWA 2RJ1A 3R3RA 3GQ7A 2V0LA 1FRWA 4FROA 3IOIA 3I0KA 1EWWA 1XHBA 5DDTA 4MIXA 3I0CA 5F42A 4E6UA 4G3PA 1NKHB 1LL2A 2YQCA 1XZ6A 3RSBA 3SXAA 1TDTA 2WVMA 3JUKA 2FYBA 2IU8A 1VGTA 1H7TA 4KC2A 2I5EA 3TISA 1K4VA 1H7GA 1FXJA 3GOSA 2NPOA 5EIYA 4MZUA 3USQA 1GQ9A 4HO2A 1LL0A 5CQMX 1VZUA 2Y4MA 1WT0A 1KGTA 3ST8A 2I5KA 2IC7A 1H4EA 1V82A 2Y4JA 1ZJPA 4LW6A 1JYLA 2AECA 4JISA 1ON8A 2BO6A 2AM3A 1ZDGA 4H7OA 4IHGA 1R80A 3NZ2A 2P72A 2CU2A 2WLCA 4FQWA 3PNNA 3NGWA 4C2SA 1TVYA 2V0IA 4M4KA 1KK4A 3VBKA 3V91A 1Z90A 3LW6A 1M8NA 4ISXA 5C4FA 3FOQA 4CJCA 4CJBA 5J49A 2MZBA 1H7FA 3KWCA 3EEVA 2RIZA 3OH2A 3CKJA 4G87A 4N6AA 4HOCA 4KC1A 4E79A 5C47A 3IGJA 3TQDA 4FRHA 2E8BA 1VICA 2FYAA 3CKNA 3BSWA 2WVKA 5DEMA 3Q7UA 3U2WA 1H5TA 4NAIA 4FRPA 1ZIZA 4IRQA 1QRMA 5IDTA 2FY7A 1FOAA 2YQSA 2WVLA 4B4MA 2RJ0A 1VH1A 3JQYA 1LZ7A 3T7MA 1JVDA 1ZCUA 1HM9A 3Q4SA 3RMWA 2XWMA 1ON6A 4AYJA 3I0LA 4ZDQA 4B42A 5D91A 4E1KA 2YCMA 4EEGA 2WE9A 4HCQA 5I1FA 3IXCA 5C49A 4M98A 1H4DA 1KHRA 1VGUA 1V67A 4Y7UA 4Y7FA 4EAAA 3V0QA 1V3WA 1W57A 4UEGA 3SX3A 4CJ8A 4EEMA 3K8EA 4P02A 1G95A 1G9RA 2X60A 5L6VA 4M28A 4KPZA 1R7VA 3ZLLA 3R5BA 4Y63A 3R1WA 1KQAA 5AJPA 1KWSA 4Y6NA 2WGZA 2YESA 3QVBA 5DEPA 2VK9A 1TW1A 1S4NA 2JCKA 2TDTA 5DDVA 3GQ9A 2VXLA 2VS5A 3OU9A 5CMHA 1ZI5A 1ZDFA 3BRKX 2AESA 5AFUV 2VSHA 1S4PA 3T7OA 3FSYA 4KNXA 2PA4A 2QGIA 2AH9A 1SS9A 1W55A 5IDSA 1LL3A 3V0PA 4O6NA 2RJ4A 3DK5A 3DJ4A 2OEFA 1KGQA 3IOJA 1GQCA 2AQ9A 3V0MA 1H5SC 3R5CA 3U0XA 2YC5A 1HM0A 1FO9A 5AFUU 2VFZA 2RIXA 2ZU8A 3VBPA 1QREA 4GBPA 2XMEA 2XATA 3PKPA 2RITA 2W0WA 4B4BA 1KK6A 5DG3A 2QIVX 4M2BA 4B5BA 1S4OA 4Y7TA 4EQYA 4KT7A 2FYCB 1H7QA 4FRDA 1R7UA 2Z86A 4ECMA 1LVWA 1H5RA 2ZU7A 3BSSA 3EH0A 3I3XA 4Y6UA 3BCVA 2OEGA 3OGZA 1FR9A 5AJNA 1IINA 5C4DA 2RJ9A 2Q4JA 3VBIA 2RJ6A 3D5NA 3PKQA 1YP2A 3OKRA 1H7EA 2QIAA 5HS2A 1O23B 2PGYA 4AYLA 3VBLA 3KWEA 1ZJOA 3OC9A 3JUJA 4HO3A 3PMOA 1ZI3A 4IRPA 4Y62A 2JF3A 3V0LA 4KPXA 4K6RA 4M2AA 1VZXA 3OH1A 1QG8A 1G8OA 2VD4A 3DUVA 1H7HA 1XHDA 1GX4A 1NWGB 4B3UA 2O1GA 4R7PA 3T7NA 5FTSA 2AE7A 3R5DA 1V83A 1W77A 5L6SA 3EE5A 3CKVA 1WT3A 3ZGGA 5C36A 1V84A 3I0JA 3FTTA 4HG6A 1SSTA 1INIA 1H5TB 1QRLA 2D7IA 1FR8A 1YROB 1GWVA 3I0EA 3SX8A 3F1XA 3KIAA 3I3AA 3R0SA 1TZFA 4FRMA 5E3QA 3R3IA 1WSZA 5CQOA 3P47A 4HURA 4MFGA 5EJ1A 4EE5A 3I0DA 5CMGX 4YS8A 1KK5A 3C8VA 1NHEB 1ZI1A 2JCJA 3HJJA 2O1FA 3BFPA 1MR7A 4EA7A 2A8WA 3O3PA 1GWWA 5CQPA 1FXOA 5C4CA 4CVHA 4FRAA 3SXGA 5IFYA 1MRLA 2VHEA 1G23A 3ECTA 2YQJA 1HJLA 1HV9A 5ADXU 2WLFA 1G1LA 1R7TA 5C8RA 1Z2FA 1R82A 4ASJA 2PX7A 1O7OA 4EA9A 2JF2A 5C1LA 5C4BA 5C3DA 1ZI4A 2RJ8A 2FFUA 1FWYA 1VH3A 3JTJA 4NALA 3V4EA 3POLA 2JCOA 2Y7AA 2XWLA 5CMJA 1ZJ1A 3OAMA 3SX7A 3V8YA 3GQ8A 3U0YA 1FZWA 1ZJ0A 2WLEA 2P6WA 2FFVA 4L41C 4XWIA 2RJ7A 2A8UA 2VS3A 3TK8A 1QWJA 1FG5N 3V0OA 3TWDA 5FYEA 4FIYA 2RIYA 1XATA 1SSQA 1G3LA 2ICYA 4IHFA 5CQLX 4G3QA 5JQQA 1ZCYA 4D48A 1OCXA 4BMAA 1FGXA 3ZLKA 2ICXA 4HO5A 1FO8A 3GVDA 3USRA 3E25A 4P00A 2BO7A 2WLGA 4MYBA 3V0NA 4M9CA 2AGDA 3OUPA 4EVWA 2FKOA 1FGGA 2Z87A 3D98A 2OI6A 1S80A 5C1HA 1KRRA 3VBJA 5C48A 5C4EA 4HUSA 1N4IA 1GX0A 2VSIA 5FU8A 1VM8A 5CQNX 3VBMA 1H5SA 3BXYA 4EA8A 2C0NA 4FCUA 2Y6PA 2OI5A 5C38A 3U2TA 4FRQA 4KQLA 3FSCA 3OH3A 3U2VA 3U2UA 1ZHJA 3OW5A 5CMFX 3KWDA 5CMIA 4DECA 4Y7GA 3RMVA 4HO9A 4HO0A 2YC3A 3SPTA 1PZTA 1TW5A 1YP4A 4R36A 3CKQA 4JD0A 4ASYA 4ARWA 3IOHA 1LXAA 1OMZA 1H7LA 3SXDA 3GUEA 1ZCVA 3R8YA 1LZ0A 3Q1XA 4AA7A 4J09A 2QH5A 3VBNA 2RIJA 3VNPA 1NQIB 4FIXA 4HO8A 3F1CA 4KC4A 3HSQA 3OTMA 1NMMB 1G0RA 2PGVA 4KRVA 4D11C 4HZCA 2YQHA 4DDZA 3SUCA 3OH4A 4O6MA 4Y64A 3P1BA 1OMXA 3ZF8A 1KRVA 2JCLA 1NF5B 2AM5A 4D11A 3FSXA 4KXOA 2P2OA 1G97A 4FREA 1MC3A 5FUHA 2FYDB 3CU0A 2J0AA 4N6BA 4BQHA 3N9WA 3R2WA 3V90A 5C3AA 1KRUA 1L0SA 3FSBA 2OI7A
chains in the Genus database with same CATH topology
4HO6A 1SSMA 1JVGA 2XMHA 3T57A 1E5KA 2V0HA 3U2XA 5ADXV 2V0KA 4LW3A 4B4GA 1H4CA 2Y4KA 3K8DA 4HO4A 2NXVA 2J0BA 3OH0A 1EZIA 4MNDA 1PZYB 3E26A 1G2VA 4KNRA 4M99A 1MP4A 4D0TA 1MR9A 4MYOA 3ZGFA 1MP3A 2ZU9A 1O7QA 2GGQA 2BO8A 2O1HA 1H5SD 3R5AA 1ZCTA 4N69A 2UX8A 3SXBA 1QRFA 2DPWA 3CKOA 4NANA 1JYKA 5AJOA 1G93A 2V0JA 3FS8A 3I0HA 2VS4A 4IHHA 2WLDA 1R81A 5E3PA 4FRLA 5EJZA 3Q80A 3EG4A 1LZIA 4E6TA 3TZTA 3BSYA 5FU0A 5BXCA 5D92A 2X5ZA 4FCEA 2P73A 1R7YA 1QQ0A 4DCLA 3MC4A 3F1YA 2BO4A 4NAKA 1VPAA 1QGQA 2WEEA 3OTZA 4J18A 1ZJ3A 1WT1A 1QGSA 1VGZA 1JV1A 4B2WA 1R7XA 1WT2A 3SXCA 2WAWA 2XWNA 3V8ZA 4DE7A 1INJA 5FTVA 1T3DA 3SX5A 4D0ZA 2AM4A 2IUAA 3MQHA 1VZTA 2E3DA 1OQMB 5C3BA 1GA8A 3I0FA 2D7RA 1THJA 1HJJA 2APCA 3HL3A 5U2KA 1WVCA 3SXEA 5FV9A 4EGGA 1H3MA 4Y9XA 2IU9A 1JV3A 1MP5A 3CGXA 4AC3A 3TIOA 1IIMA 3CJ8A 2X5SA 1LZJA 4R37A 1J2ZA 2W0VA 2QKXA 4N27A 1H5SB 4EE4A 3FWWA 1QRGA 2RJ5A 4E75A 2X65A 3TDTA 3I0IX 5E3RA 1ZJ2A 2D0JA 2GGOA 4EEOA 4Q7CA 3D8VA 4Y7VA 2I7BA 1YP3A 1H5RB 5C1GA 3I0GA 1I52A 4EE3A 3MQGA 4AAWA 3SRTA 1EYRA 3TV0A 4EABA 4HZDA 2Y4LA 4EEAA 4B2XA 3DHOA 1HM8A 1O0RA 2VXMA 4FRBA 4G3SA 1VGWA 2RJ1A 3R3RA 1FRWA 2V0LA 4FROA 3IOIA 3I0KA 5DDTA 1XHBA 4MIXA 3I0CA 5F42A 4E6UA 4G3PA 1NKHB 1LL2A 2YQCA 1XZ6A 3RSBA 3SXAA 1TDTA 2WVMA 3JUKA 2FYBA 2IU8A 1VGTA 1H7TA 4KC2A 2I5EA 3TISA 1K4VA 1H7GA 1FXJA 3GOSA 2NPOA 5EIYA 4MZUA 3USQA 1GQ9A 4HO2A 1LL0A 5CQMX 1VZUA 2Y4MA 1WT0A 1KGTA 3ST8A 2I5KA 2IC7A 1H4EA 1V82A 2Y4JA 1ZJPA 4LW6A 1JYLA 2AECA 4JISA 1ON8A 2BO6A 2AM3A 1ZDGA 4H7OA 4IHGA 1R80A 3NZ2A 2P72A 2CU2A 2WLCA 4FQWA 3PNNA 3NGWA 4C2SA 1TVYA 2V0IA 4M4KA 1KK4A 3VBKA 3V91A 1Z90A 3LW6A 4ISXA 5C4FA 3FOQA 4CJCA 4CJBA 5J49A 2MZBA 1H7FA 3KWCA 3EEVA 2RIZA 3CKJA 3OH2A 4G87A 4N6AA 4HOCA 4KC1A 4E79A 5C47A 3IGJA 3TQDA 4FRHA 2E8BA 1VICA 2FYAA 3CKNA 3BSWA 2WVKA 5DEMA 3Q7UA 3U2WA 1H5TA 4NAIA 4FRPA 1ZIZA 4IRQA 1QRMA 5IDTA 2FY7A 1FOAA 2YQSA 2WVLA 4B4MA 2RJ0A 1VH1A 3JQYA 1LZ7A 3T7MA 1JVDA 1ZCUA 1HM9A 3Q4SA 3RMWA 2XWMA 1ON6A 4AYJA 3I0LA 4ZDQA 4B42A 5D91A 4E1KA 2YCMA 4EEGA 2WE9A 4HCQA 5I1FA 3IXCA 5C49A 4M98A 1H4DA 1KHRA 1VGUA 1V67A 4Y7UA 4Y7FA 4EAAA 3V0QA 1V3WA 1W57A 4UEGA 3SX3A 4CJ8A 4EEMA 3K8EA 4P02A 1G95A 1G9RA 2X60A 5L6VA 4M28A 4KPZA 1R7VA 3ZLLA 3R5BA 4Y63A 3R1WA 1KQAA 5AJPA 1KWSA 4Y6NA 2WGZA 2YESA 3QVBA 5DEPA 2VK9A 1TW1A 1S4NA 2JCKA 2TDTA 5DDVA 2VXLA 2VS5A 3OU9A 5CMHA 1ZI5A 1ZDFA 3BRKX 2AESA 5AFUV 2VSHA 1S4PA 3T7OA 3FSYA 4KNXA 2PA4A 2QGIA 2AH9A 1SS9A 1W55A 5IDSA 1LL3A 3V0PA 4O6NA 2RJ4A 3DK5A 3DJ4A 2OEFA 1KGQA 3IOJA 1GQCA 2AQ9A 3V0MA 1H5SC 3R5CA 3U0XA 2YC5A 1HM0A 1FO9A 5AFUU 2VFZA 2RIXA 2ZU8A 3VBPA 1QREA 4GBPA 2XMEA 2XATA 3PKPA 2RITA 2W0WA 4B4BA 1KK6A 5DG3A 2QIVX 4M2BA 4B5BA 1S4OA 4Y7TA 4EQYA 4KT7A 2FYCB 1H7QA 4FRDA 1R7UA 2Z86A 4ECMA 1LVWA 1H5RA 2ZU7A 3BSSA 3EH0A 3I3XA 4Y6UA 3BCVA 2OEGA 3OGZA 1FR9A 5AJNA 1IINA 5C4DA 2RJ9A 2Q4JA 3VBIA 2RJ6A 3D5NA 3PKQA 1YP2A 3OKRA 1H7EA 2QIAA 5HS2A 1O23B 2PGYA 4AYLA 3VBLA 3KWEA 1ZJOA 3OC9A 3JUJA 4HO3A 3PMOA 1ZI3A 4IRPA 4Y62A 2JF3A 3V0LA 4KPXA 4K6RA 4M2AA 1VZXA 1QG8A 3OH1A 1G8OA 2VD4A 3DUVA 1H7HA 1XHDA 1GX4A 1NWGB 4B3UA 2O1GA 4R7PA 3T7NA 5FTSA 2AE7A 3R5DA 1V83A 1W77A 5L6SA 3EE5A 3CKVA 1WT3A 3ZGGA 5C36A 1V84A 3I0JA 3FTTA 4HG6A 1SSTA 1INIA 1H5TB 1QRLA 2D7IA 1FR8A 1YROB 1GWVA 3I0EA 3SX8A 3F1XA 3KIAA 3I3AA 3R0SA 1TZFA 4FRMA 5E3QA 3R3IA 1WSZA 5CQOA 3P47A 4HURA 4MFGA 5EJ1A 4EE5A 3I0DA 5CMGX 4YS8A 1KK5A 3C8VA 1NHEB 1ZI1A 2JCJA 3HJJA 2O1FA 3BFPA 1MR7A 4EA7A 2A8WA 3O3PA 1GWWA 5CQPA 1FXOA 5C4CA 4CVHA 4FRAA 3SXGA 5IFYA 1MRLA 2VHEA 1G23A 3ECTA 2YQJA 1HJLA 1HV9A 5ADXU 2WLFA 1G1LA 1R7TA 5C8RA 1R82A 4ASJA 2PX7A 1O7OA 4EA9A 2JF2A 5C1LA 5C4BA 5C3DA 1ZI4A 2RJ8A 2FFUA 1FWYA 1VH3A 3JTJA 4NALA 3V4EA 3POLA 2JCOA 2Y7AA 2XWLA 5CMJA 1ZJ1A 3OAMA 3SX7A 3V8YA 3U0YA 1FZWA 1ZJ0A 2WLEA 2P6WA 2FFVA 4L41C 4XWIA 2RJ7A 2A8UA 2VS3A 3TK8A 1QWJA 1FG5N 3V0OA 3TWDA 5FYEA 4FIYA 2RIYA 1XATA 1SSQA 1G3LA 2ICYA 4IHFA 5CQLX 4G3QA 5JQQA 1ZCYA 4D48A 1OCXA 4BMAA 1FGXA 3ZLKA 2ICXA 4HO5A 1FO8A 3GVDA 3USRA 3E25A 4P00A 2BO7A 2WLGA 4MYBA 3V0NA 4M9CA 2AGDA 3OUPA 4EVWA 2FKOA 1FGGA 2Z87A 3D98A 2OI6A 1S80A 5C1HA 1KRRA 3VBJA 5C48A 5C4EA 4HUSA 1GX0A 2VSIA 5FU8A 1VM8A 5CQNX 3VBMA 1H5SA 3BXYA 4EA8A 2C0NA 4FCUA 2Y6PA 2OI5A 5C38A 3U2TA 4FRQA 4KQLA 3FSCA 3OH3A 3U2VA 3U2UA 1ZHJA 3OW5A 5CMFX 3KWDA 5CMIA 4DECA 4Y7GA 3RMVA 4HO9A 4HO0A 2YC3A 3SPTA 1PZTA 1TW5A 1YP4A 4R36A 3CKQA 4JD0A 4ASYA 4ARWA 3IOHA 1LXAA 1OMZA 1H7LA 3SXDA 3GUEA 1ZCVA 3R8YA 1LZ0A 3Q1XA 4AA7A 4J09A 2QH5A 3VBNA 2RIJA 3VNPA 1NQIB 4FIXA 4HO8A 3F1CA 4KC4A 3HSQA 3OTMA 1NMMB 1G0RA 2PGVA 4KRVA 4D11C 4HZCA 2YQHA 4DDZA 3OH4A 4O6MA 4Y64A 3P1BA 1OMXA 3ZF8A 1KRVA 2JCLA 1NF5B 2AM5A 4D11A 3FSXA 4KXOA 2P2OA 1G97A 4FREA 1MC3A 5FUHA 2FYDB 3CU0A 2J0AA 4N6BA 4BQHA 3N9WA 3R2WA 3V90A 5C3AA 1KRUA 3FSBA 2OI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO6 A;  1SSM A;  1JVG A;  2XMH A;  3T57 A;  1E5K A;  2V0H A;  3U2X A;  5ADX V;  2V0K A;  4LW3 A;  4B4G A;  1H4C A;  2Y4K A;  3K8D A;  4HO4 A;  2NXV A;  3OH0 A;  1EZI A;  4MND A;  1PZY B;  3E26 A;  1G2V A;  4KNR A;  4M99 A;  1MP4 A;  4D0T A;  1MR9 A;  4MYO A;  3ZGF A;  1MP3 A;  2ZU9 A;  1O7Q A;  2GGQ A;  2BO8 A;  2O1H A;  1H5S D;  3R5A A;  1ZCT A;  4N69 A;  2UX8 A;  3SXB A;  1QRF A;  2DPW A;  3CKO A;  4NAN A;  1JYK A;  5AJO A;  1G93 A;  2V0J A;  3FS8 A;  3I0H A;  2VS4 A;  4IHH A;  2WLD A;  1R81 A;  5E3P A;  4FRL A;  5EJZ A;  3Q80 A;  3EG4 A;  1LZI A;  4E6T A;  3TZT A;  3BSY A;  5FU0 A;  5BXC A;  2X5Z A;  4FCE A;  2P73 A;  1R7Y A;  1QQ0 A;  4DCL A;  3MC4 A;  3F1Y A;  2BO4 A;  4NAK A;  1VPA A;  1QGQ A;  2WEE A;  3OTZ A;  4J18 A;  1ZJ3 A;  1WT1 A;  1QGS A;  1VGZ A;  1JV1 A;  4B2W A;  1R7X A;  1WT2 A;  3SXC A;  2WAW A;  2XWN A;  3V8Z A;  4DE7 A;  1INJ A;  5FTV A;  1T3D A;  3SX5 A;  4D0Z A;  2AM4 A;  2IUA A;  3MQH A;  1VZT A;  2E3D A;  1OQM B;  5C3B A;  1GA8 A;  3I0F A;  2D7R A;  1THJ A;  1HJJ A;  2APC A;  3HL3 A;  5U2K A;  1WVC A;  3SXE A;  5FV9 A;  4EGG A;  1H3M A;  4Y9X A;  2IU9 A;  1JV3 A;  1MP5 A;  3CGX A;  4AC3 A;  3TIO A;  1IIM A;  3CJ8 A;  2X5S A;  1LZJ A;  4R37 A;  1J2Z A;  2W0V A;  2QKX A;  4N27 A;  1H5S B;  4EE4 A;  3FWW A;  1QRG A;  2RJ5 A;  4E75 A;  2X65 A;  3TDT A;  3I0I X;  5E3R A;  1ZJ2 A;  2D0J A;  2GGO A;  4EEO A;  3D8V A;  4Y7V A;  2I7B A;  1YP3 A;  1H5R B;  5C1G A;  3I0G A;  1I52 A;  4EE3 A;  3MQG A;  4AAW A;  3SRT A;  1EYR A;  3TV0 A;  4EAB A;  4HZD A;  2Y4L A;  4EEA A;  4B2X A;  3DHO A;  1HM8 A;  1O0R A;  2VXM A;  4FRB A;  4G3S A;  1VGW A;  2RJ1 A;  3R3R A;  1FRW A;  2V0L A;  4FRO A;  3IOI A;  3I0K A;  5DDT A;  1XHB A;  3I0C A;  5F42 A;  4E6U A;  4G3P A;  1NKH B;  1LL2 A;  2YQC A;  1XZ6 A;  3RSB A;  3SXA A;  1TDT A;  2WVM A;  3JUK A;  2FYB A;  2IU8 A;  1VGT A;  1H7T A;  4KC2 A;  2I5E A;  3TIS A;  1K4V A;  1H7G A;  1FXJ A;  3GOS A;  2NPO A;  5EIY A;  4MZU A;  3USQ A;  1GQ9 A;  4HO2 A;  1LL0 A;  5CQM X;  1VZU A;  2Y4M A;  1WT0 A;  1KGT A;  3ST8 A;  2I5K A;  2IC7 A;  1H4E A;  1V82 A;  2Y4J A;  1ZJP A;  4LW6 A;  1JYL A;  2AEC A;  4JIS A;  1ON8 A;  2BO6 A;  2AM3 A;  1ZDG A;  4H7O A;  4IHG A;  1R80 A;  3NZ2 A;  2P72 A;  2CU2 A;  2WLC A;  4FQW A;  3PNN A;  3NGW A;  4C2S A;  1TVY A;  2V0I A;  4M4K A;  1KK4 A;  3VBK A;  3V91 A;  1Z90 A;  3LW6 A;  4ISX A;  5C4F A;  3FOQ A;  4CJC A;  4CJB A;  5J49 A;  2MZB A;  1H7F A;  3KWC A;  3EEV A;  2RIZ A;  3CKJ A;  3OH2 A;  4G87 A;  4N6A A;  4HOC A;  4KC1 A;  4E79 A;  5C47 A;  3IGJ A;  3TQD A;  4FRH A;  2E8B A;  1VIC A;  2FYA A;  3CKN A;  3BSW A;  2WVK A;  5DEM A;  3Q7U A;  3U2W A;  1H5T A;  4NAI A;  4FRP A;  1ZIZ A;  4IRQ A;  1QRM A;  5IDT A;  2FY7 A;  1FOA A;  2YQS A;  2WVL A;  4B4M A;  2RJ0 A;  1VH1 A;  3JQY A;  1LZ7 A;  3T7M A;  1JVD A;  1ZCU A;  1HM9 A;  3Q4S A;  3RMW A;  2XWM A;  1ON6 A;  4AYJ A;  3I0L A;  4ZDQ A;  4B42 A;  4E1K A;  2YCM A;  4EEG A;  2WE9 A;  4HCQ A;  5I1F A;  3IXC A;  5C49 A;  4M98 A;  1H4D A;  1KHR A;  1VGU A;  1V67 A;  4Y7U A;  4Y7F A;  4EAA A;  3V0Q A;  1V3W A;  1W57 A;  4UEG A;  3SX3 A;  4CJ8 A;  4EEM A;  3K8E A;  4P02 A;  1G95 A;  1G9R A;  2X60 A;  5L6V A;  4M28 A;  4KPZ A;  1R7V A;  3ZLL A;  3R5B A;  4Y63 A;  3R1W A;  1KQA A;  5AJP A;  1KWS A;  4Y6N A;  2WGZ A;  2YES A;  3QVB A;  5DEP A;  1TW1 A;  1S4N A;  2JCK A;  2TDT A;  5DDV A;  2VXL A;  2VS5 A;  3OU9 A;  5CMH A;  1ZI5 A;  1ZDF A;  3BRK X;  2AES A;  5AFU V;  2VSH A;  1S4P A;  3T7O A;  3FSY A;  4KNX A;  2PA4 A;  2QGI A;  2AH9 A;  1SS9 A;  1W55 A;  5IDS A;  1LL3 A;  3V0P A;  2RJ4 A;  3DK5 A;  3DJ4 A;  2OEF A;  1KGQ A;  3IOJ A;  1GQC A;  2AQ9 A;  3V0M A;  1H5S C;  3R5C A;  3U0X A;  2YC5 A;  1HM0 A;  1FO9 A;  5AFU U;  2VFZ A;  2RIX A;  2ZU8 A;  3VBP A;  1QRE A;  4GBP A;  2XME A;  2XAT A;  3PKP A;  2RIT A;  2W0W A;  4B4B A;  1KK6 A;  5DG3 A;  2QIV X;  4M2B A;  4B5B A;  1S4O A;  4Y7T A;  4EQY A;  4KT7 A;  2FYC B;  1H7Q A;  4FRD A;  1R7U A;  2Z86 A;  4ECM A;  1LVW A;  1H5R A;  2ZU7 A;  3BSS A;  3EH0 A;  3I3X A;  4Y6U A;  3BCV A;  2OEG A;  3OGZ A;  1FR9 A;  5AJN A;  1IIN A;  5C4D A;  2RJ9 A;  2Q4J A;  3VBI A;  2RJ6 A;  3D5N A;  3PKQ A;  1YP2 A;  3OKR A;  1H7E A;  2QIA A;  5HS2 A;  1O23 B;  2PGY A;  4AYL A;  3VBL A;  3KWE A;  1ZJO A;  3OC9 A;  3JUJ A;  4HO3 A;  3PMO A;  1ZI3 A;  4IRP A;  4Y62 A;  2JF3 A;  3V0L A;  4KPX A;  4K6R A;  4M2A A;  1VZX A;  1QG8 A;  3OH1 A;  1G8O A;  2VD4 A;  3DUV A;  1H7H A;  1XHD A;  1GX4 A;  1NWG B;  4B3U A;  2O1G A;  4R7P A;  3T7N A;  5FTS A;  2AE7 A;  3R5D A;  1V83 A;  1W77 A;  5L6S A;  3EE5 A;  3CKV A;  1WT3 A;  3ZGG A;  5C36 A;  1V84 A;  3I0J A;  3FTT A;  4HG6 A;  1SST A;  1INI A;  1H5T B;  1QRL A;  2D7I A;  1FR8 A;  1YRO B;  1GWV A;  3I0E A;  3SX8 A;  3F1X A;  3KIA A;  3I3A A;  3R0S A;  1TZF A;  4FRM A;  5E3Q A;  3R3I A;  1WSZ A;  5CQO A;  3P47 A;  4HUR A;  4MFG A;  5EJ1 A;  4EE5 A;  3I0D A;  5CMG X;  4YS8 A;  1KK5 A;  3C8V A;  1NHE B;  1ZI1 A;  2JCJ A;  3HJJ A;  2O1F A;  3BFP A;  1MR7 A;  4EA7 A;  2A8W A;  3O3P A;  1GWW A;  5CQP A;  1FXO A;  5C4C A;  4CVH A;  4FRA A;  3SXG A;  5IFY A;  1MRL A;  2VHE A;  1G23 A;  3ECT A;  2YQJ A;  1HJL A;  1HV9 A;  5ADX U;  2WLF A;  1G1L A;  1R7T A;  5C8R A;  1R82 A;  4ASJ A;  2PX7 A;  1O7O A;  4EA9 A;  2JF2 A;  5C1L A;  5C4B A;  5C3D A;  1ZI4 A;  2RJ8 A;  2FFU A;  1FWY A;  1VH3 A;  3JTJ A;  4NAL A;  3V4E A;  3POL A;  2JCO A;  2Y7A A;  2XWL A;  5CMJ A;  1ZJ1 A;  3OAM A;  3SX7 A;  3V8Y A;  3U0Y A;  1FZW A;  1ZJ0 A;  2WLE A;  2P6W A;  2FFV A;  4L41 C;  4XWI A;  2RJ7 A;  2A8U A;  2VS3 A;  3TK8 A;  1QWJ A;  1FG5 N;  3V0O A;  3TWD A;  5FYE A;  2RIY A;  1XAT A;  1SSQ A;  1G3L A;  2ICY A;  4IHF A;  5CQL X;  4G3Q A;  5JQQ A;  1ZCY A;  4D48 A;  1OCX A;  4BMA A;  1FGX A;  3ZLK A;  2ICX A;  4HO5 A;  1FO8 A;  3GVD A;  3USR A;  3E25 A;  4P00 A;  2BO7 A;  2WLG A;  4MYB A;  3V0N A;  4M9C A;  2AGD A;  3OUP A;  4EVW A;  2FKO A;  1FGG A;  2Z87 A;  3D98 A;  2OI6 A;  1S80 A;  5C1H A;  1KRR A;  3VBJ A;  5C48 A;  5C4E A;  4HUS A;  1GX0 A;  2VSI A;  5FU8 A;  1VM8 A;  5CQN X;  3VBM A;  1H5S A;  3BXY A;  4EA8 A;  4FCU A;  2Y6P A;  2OI5 A;  5C38 A;  3U2T A;  4FRQ A;  4KQL A;  3FSC A;  3OH3 A;  3U2V A;  3U2U A;  1ZHJ A;  3OW5 A;  5CMF X;  3KWD A;  5CMI A;  4DEC A;  4Y7G A;  3RMV A;  4HO9 A;  4HO0 A;  2YC3 A;  3SPT A;  1PZT A;  1TW5 A;  1YP4 A;  4R36 A;  3CKQ A;  4JD0 A;  4ASY A;  4ARW A;  3IOH A;  1LXA A;  1OMZ A;  1H7L A;  3SXD A;  3GUE A;  1ZCV A;  3R8Y A;  1LZ0 A;  3Q1X A;  4AA7 A;  4J09 A;  2QH5 A;  3VBN A;  2RIJ A;  3VNP A;  1NQI B;  4HO8 A;  3F1C A;  4KC4 A;  3HSQ A;  3OTM A;  1NMM B;  1G0R A;  2PGV A;  4KRV A;  4D11 C;  4HZC A;  2YQH A;  4DDZ A;  3OH4 A;  4Y64 A;  3P1B A;  1OMX A;  3ZF8 A;  1KRV A;  2JCL A;  1NF5 B;  2AM5 A;  4D11 A;  3FSX A;  4KXO A;  2P2O A;  1G97 A;  4FRE A;  1MC3 A;  5FUH A;  2FYD B;  3CU0 A;  4N6B A;  4BQH A;  3N9W A;  3R2W A;  3V90 A;  5C3A A;  1KRU A;  3FSB A;  2OI7 A; 
#chains in the Genus database with same CATH topology
 4HO6 A;  1SSM A;  1JVG A;  2XMH A;  3T57 A;  1E5K A;  2V0H A;  3U2X A;  5ADX V;  2V0K A;  4LW3 A;  4B4G A;  1H4C A;  2Y4K A;  3K8D A;  4HO4 A;  2NXV A;  2J0B A;  3OH0 A;  1EZI A;  4MND A;  1PZY B;  3E26 A;  1G2V A;  4KNR A;  4M99 A;  1MP4 A;  4D0T A;  1MR9 A;  4MYO A;  3ZGF A;  1MP3 A;  2ZU9 A;  3GQA A;  1O7Q A;  2GGQ A;  2BO8 A;  2O1H A;  1H5S D;  3R5A A;  1ZCT A;  4N69 A;  2UX8 A;  3SXB A;  1QRF A;  2DPW A;  3CKO A;  4NAN A;  1JYK A;  5AJO A;  1G93 A;  2V0J A;  3FS8 A;  3I0H A;  2VS4 A;  4IHH A;  2WLD A;  1R81 A;  5E3P A;  4FRL A;  5EJZ A;  3Q80 A;  3EG4 A;  1LZI A;  4E6T A;  3TZT A;  3BSY A;  5FU0 A;  5BXC A;  5D92 A;  2X5Z A;  4FCE A;  2P73 A;  1R7Y A;  1QQ0 A;  4DCL A;  3MC4 A;  3F1Y A;  2BO4 A;  4NAK A;  1VPA A;  1QGQ A;  2WEE A;  3OTZ A;  4J18 A;  1ZJ3 A;  1WT1 A;  1QGS A;  1VGZ A;  1JV1 A;  4B2W A;  1R7X A;  1WT2 A;  3SXC A;  2WAW A;  2XWN A;  3V8Z A;  4DE7 A;  1INJ A;  5FTV A;  1T3D A;  3SX5 A;  4D0Z A;  2AM4 A;  2IUA A;  3MQH A;  1VZT A;  2E3D A;  1OQM B;  5C3B A;  1GA8 A;  3I0F A;  2D7R A;  1THJ A;  1HJJ A;  2APC A;  3HL3 A;  5U2K A;  1WVC A;  3SXE A;  5FV9 A;  4EGG A;  1H3M A;  4Y9X A;  2IU9 A;  1JV3 A;  1MP5 A;  3CGX A;  4AC3 A;  3TIO A;  1IIM A;  3CJ8 A;  2X5S A;  1LZJ A;  4R37 A;  1J2Z A;  2W0V A;  2QKX A;  4N27 A;  1H5S B;  4EE4 A;  3FWW A;  1QRG A;  2RJ5 A;  4E75 A;  2X65 A;  3TDT A;  3I0I X;  5E3R A;  1ZJ2 A;  2D0J A;  2GGO A;  4EEO A;  4Q7C A;  3D8V A;  4Y7V A;  2I7B A;  1YP3 A;  1H5R B;  5C1G A;  3I0G A;  1I52 A;  4EE3 A;  3MQG A;  4AAW A;  3SRT A;  1EYR A;  3TV0 A;  4EAB A;  4HZD A;  2Y4L A;  4EEA A;  4B2X A;  3DHO A;  1HM8 A;  1O0R A;  2VXM A;  4FRB A;  4G3S A;  1VGW A;  2RJ1 A;  3R3R A;  3GQ7 A;  2V0L A;  1FRW A;  4FRO A;  3IOI A;  3I0K A;  1EWW A;  1XHB A;  5DDT A;  4MIX A;  3I0C A;  5F42 A;  4E6U A;  4G3P A;  1NKH B;  1LL2 A;  2YQC A;  1XZ6 A;  3RSB A;  3SXA A;  1TDT A;  2WVM A;  3JUK A;  2FYB A;  2IU8 A;  1VGT A;  1H7T A;  4KC2 A;  2I5E A;  3TIS A;  1K4V A;  1H7G A;  1FXJ A;  3GOS A;  2NPO A;  5EIY A;  4MZU A;  3USQ A;  1GQ9 A;  4HO2 A;  1LL0 A;  5CQM X;  1VZU A;  2Y4M A;  1WT0 A;  1KGT A;  3ST8 A;  2I5K A;  2IC7 A;  1H4E A;  1V82 A;  2Y4J A;  1ZJP A;  4LW6 A;  1JYL A;  2AEC A;  4JIS A;  1ON8 A;  2BO6 A;  2AM3 A;  1ZDG A;  4H7O A;  4IHG A;  1R80 A;  3NZ2 A;  2P72 A;  2CU2 A;  2WLC A;  4FQW A;  3PNN A;  3NGW A;  4C2S A;  1TVY A;  2V0I A;  4M4K A;  1KK4 A;  3VBK A;  3V91 A;  1Z90 A;  3LW6 A;  1M8N A;  4ISX A;  5C4F A;  3FOQ A;  4CJC A;  4CJB A;  5J49 A;  2MZB A;  1H7F A;  3KWC A;  3EEV A;  2RIZ A;  3OH2 A;  3CKJ A;  4G87 A;  4N6A A;  4HOC A;  4KC1 A;  4E79 A;  5C47 A;  3IGJ A;  3TQD A;  4FRH A;  2E8B A;  1VIC A;  2FYA A;  3CKN A;  3BSW A;  2WVK A;  5DEM A;  3Q7U A;  3U2W A;  1H5T A;  4NAI A;  4FRP A;  1ZIZ A;  4IRQ A;  1QRM A;  5IDT A;  2FY7 A;  1FOA A;  2YQS A;  2WVL A;  4B4M A;  2RJ0 A;  1VH1 A;  3JQY A;  1LZ7 A;  3T7M A;  1JVD A;  1ZCU A;  1HM9 A;  3Q4S A;  3RMW A;  2XWM A;  1ON6 A;  4AYJ A;  3I0L A;  4ZDQ A;  4B42 A;  5D91 A;  4E1K A;  2YCM A;  4EEG A;  2WE9 A;  4HCQ A;  5I1F A;  3IXC A;  5C49 A;  4M98 A;  1H4D A;  1KHR A;  1VGU A;  1V67 A;  4Y7U A;  4Y7F A;  4EAA A;  3V0Q A;  1V3W A;  1W57 A;  4UEG A;  3SX3 A;  4CJ8 A;  4EEM A;  3K8E A;  4P02 A;  1G95 A;  1G9R A;  2X60 A;  5L6V A;  4M28 A;  4KPZ A;  1R7V A;  3ZLL A;  3R5B A;  4Y63 A;  3R1W A;  1KQA A;  5AJP A;  1KWS A;  4Y6N A;  2WGZ A;  2YES A;  3QVB A;  5DEP A;  2VK9 A;  1TW1 A;  1S4N A;  2JCK A;  2TDT A;  5DDV A;  3GQ9 A;  2VXL A;  2VS5 A;  3OU9 A;  5CMH A;  1ZI5 A;  1ZDF A;  3BRK X;  2AES A;  5AFU V;  2VSH A;  1S4P A;  3T7O A;  3FSY A;  4KNX A;  2PA4 A;  2QGI A;  2AH9 A;  1SS9 A;  1W55 A;  5IDS A;  1LL3 A;  3V0P A;  4O6N A;  2RJ4 A;  3DK5 A;  3DJ4 A;  2OEF A;  1KGQ A;  3IOJ A;  1GQC A;  2AQ9 A;  3V0M A;  1H5S C;  3R5C A;  3U0X A;  2YC5 A;  1HM0 A;  1FO9 A;  5AFU U;  2VFZ A;  2RIX A;  2ZU8 A;  3VBP A;  1QRE A;  4GBP A;  2XME A;  2XAT A;  3PKP A;  2RIT A;  2W0W A;  4B4B A;  1KK6 A;  5DG3 A;  2QIV X;  4M2B A;  4B5B A;  1S4O A;  4Y7T A;  4EQY A;  4KT7 A;  2FYC B;  1H7Q A;  4FRD A;  1R7U A;  2Z86 A;  4ECM A;  1LVW A;  1H5R A;  2ZU7 A;  3BSS A;  3EH0 A;  3I3X A;  4Y6U A;  3BCV A;  2OEG A;  3OGZ A;  1FR9 A;  5AJN A;  1IIN A;  5C4D A;  2RJ9 A;  2Q4J A;  3VBI A;  2RJ6 A;  3D5N A;  3PKQ A;  1YP2 A;  3OKR A;  1H7E A;  2QIA A;  5HS2 A;  1O23 B;  2PGY A;  4AYL A;  3VBL A;  3KWE A;  1ZJO A;  3OC9 A;  3JUJ A;  4HO3 A;  3PMO A;  1ZI3 A;  4IRP A;  4Y62 A;  2JF3 A;  3V0L A;  4KPX A;  4K6R A;  4M2A A;  1VZX A;  3OH1 A;  1QG8 A;  1G8O A;  2VD4 A;  3DUV A;  1H7H A;  1XHD A;  1GX4 A;  1NWG B;  4B3U A;  2O1G A;  4R7P A;  3T7N A;  5FTS A;  2AE7 A;  3R5D A;  1V83 A;  1W77 A;  5L6S A;  3EE5 A;  3CKV A;  1WT3 A;  3ZGG A;  5C36 A;  1V84 A;  3I0J A;  3FTT A;  4HG6 A;  1SST A;  1INI A;  1H5T B;  1QRL A;  2D7I A;  1FR8 A;  1YRO B;  1GWV A;  3I0E A;  3SX8 A;  3F1X A;  3KIA A;  3I3A A;  3R0S A;  1TZF A;  4FRM A;  5E3Q A;  3R3I A;  1WSZ A;  5CQO A;  3P47 A;  4HUR A;  4MFG A;  5EJ1 A;  4EE5 A;  3I0D A;  5CMG X;  4YS8 A;  1KK5 A;  3C8V A;  1NHE B;  1ZI1 A;  2JCJ A;  3HJJ A;  2O1F A;  3BFP A;  1MR7 A;  4EA7 A;  2A8W A;  3O3P A;  1GWW A;  5CQP A;  1FXO A;  5C4C A;  4CVH A;  4FRA A;  3SXG A;  5IFY A;  1MRL A;  2VHE A;  1G23 A;  3ECT A;  2YQJ A;  1HJL A;  1HV9 A;  5ADX U;  2WLF A;  1G1L A;  1R7T A;  5C8R A;  1Z2F A;  1R82 A;  4ASJ A;  2PX7 A;  1O7O A;  4EA9 A;  2JF2 A;  5C1L A;  5C4B A;  5C3D A;  1ZI4 A;  2RJ8 A;  2FFU A;  1FWY A;  1VH3 A;  3JTJ A;  4NAL A;  3V4E A;  3POL A;  2JCO A;  2Y7A A;  2XWL A;  5CMJ A;  1ZJ1 A;  3OAM A;  3SX7 A;  3V8Y A;  3GQ8 A;  3U0Y A;  1FZW A;  1ZJ0 A;  2WLE A;  2P6W A;  2FFV A;  4L41 C;  4XWI A;  2RJ7 A;  2A8U A;  2VS3 A;  3TK8 A;  1QWJ A;  1FG5 N;  3V0O A;  3TWD A;  5FYE A;  4FIY A;  2RIY A;  1XAT A;  1SSQ A;  1G3L A;  2ICY A;  4IHF A;  5CQL X;  4G3Q A;  5JQQ A;  1ZCY A;  4D48 A;  1OCX A;  4BMA A;  1FGX A;  3ZLK A;  2ICX A;  4HO5 A;  1FO8 A;  3GVD A;  3USR A;  3E25 A;  4P00 A;  2BO7 A;  2WLG A;  4MYB A;  3V0N A;  4M9C A;  2AGD A;  3OUP A;  4EVW A;  2FKO A;  1FGG A;  2Z87 A;  3D98 A;  2OI6 A;  1S80 A;  5C1H A;  1KRR A;  3VBJ A;  5C48 A;  5C4E A;  4HUS A;  1N4I A;  1GX0 A;  2VSI A;  5FU8 A;  1VM8 A;  5CQN X;  3VBM A;  1H5S A;  3BXY A;  4EA8 A;  2C0N A;  4FCU A;  2Y6P A;  2OI5 A;  5C38 A;  3U2T A;  4FRQ A;  4KQL A;  3FSC A;  3OH3 A;  3U2V A;  3U2U A;  1ZHJ A;  3OW5 A;  5CMF X;  3KWD A;  5CMI A;  4DEC A;  4Y7G A;  3RMV A;  4HO9 A;  4HO0 A;  2YC3 A;  3SPT A;  1PZT A;  1TW5 A;  1YP4 A;  4R36 A;  3CKQ A;  4JD0 A;  4ASY A;  4ARW A;  3IOH A;  1LXA A;  1OMZ A;  1H7L A;  3SXD A;  3GUE A;  1ZCV A;  3R8Y A;  1LZ0 A;  3Q1X A;  4AA7 A;  4J09 A;  2QH5 A;  3VBN A;  2RIJ A;  3VNP A;  1NQI B;  4FIX A;  4HO8 A;  3F1C A;  4KC4 A;  3HSQ A;  3OTM A;  1NMM B;  1G0R A;  2PGV A;  4KRV A;  4D11 C;  4HZC A;  2YQH A;  4DDZ A;  3SUC A;  3OH4 A;  4O6M A;  4Y64 A;  3P1B A;  1OMX A;  3ZF8 A;  1KRV A;  2JCL A;  1NF5 B;  2AM5 A;  4D11 A;  3FSX A;  4KXO A;  2P2O A;  1G97 A;  4FRE A;  1MC3 A;  5FUH A;  2FYD B;  3CU0 A;  2J0A A;  4N6B A;  4BQH A;  3N9W A;  3R2W A;  3V90 A;  5C3A A;  1KRU A;  1L0S A;  3FSB A;  2OI7 A; 
#chains in the Genus database with same CATH homology
 4HO6 A;  1SSM A;  1JVG A;  2XMH A;  3T57 A;  1E5K A;  2V0H A;  3U2X A;  5ADX V;  2V0K A;  4LW3 A;  4B4G A;  1H4C A;  2Y4K A;  3K8D A;  4HO4 A;  2NXV A;  2J0B A;  3OH0 A;  1EZI A;  4MND A;  1PZY B;  3E26 A;  1G2V A;  4KNR A;  4M99 A;  1MP4 A;  4D0T A;  1MR9 A;  4MYO A;  3ZGF A;  1MP3 A;  2ZU9 A;  1O7Q A;  2GGQ A;  2BO8 A;  2O1H A;  1H5S D;  3R5A A;  1ZCT A;  4N69 A;  2UX8 A;  3SXB A;  1QRF A;  2DPW A;  3CKO A;  4NAN A;  1JYK A;  5AJO A;  1G93 A;  2V0J A;  3FS8 A;  3I0H A;  2VS4 A;  4IHH A;  2WLD A;  1R81 A;  5E3P A;  4FRL A;  5EJZ A;  3Q80 A;  3EG4 A;  1LZI A;  4E6T A;  3TZT A;  3BSY A;  5FU0 A;  5BXC A;  5D92 A;  2X5Z A;  4FCE A;  2P73 A;  1R7Y A;  1QQ0 A;  4DCL A;  3MC4 A;  3F1Y A;  2BO4 A;  4NAK A;  1VPA A;  1QGQ A;  2WEE A;  3OTZ A;  4J18 A;  1ZJ3 A;  1WT1 A;  1QGS A;  1VGZ A;  1JV1 A;  4B2W A;  1R7X A;  1WT2 A;  3SXC A;  2WAW A;  2XWN A;  3V8Z A;  4DE7 A;  1INJ A;  5FTV A;  1T3D A;  3SX5 A;  4D0Z A;  2AM4 A;  2IUA A;  3MQH A;  1VZT A;  2E3D A;  1OQM B;  5C3B A;  1GA8 A;  3I0F A;  2D7R A;  1THJ A;  1HJJ A;  2APC A;  3HL3 A;  5U2K A;  1WVC A;  3SXE A;  5FV9 A;  4EGG A;  1H3M A;  4Y9X A;  2IU9 A;  1JV3 A;  1MP5 A;  3CGX A;  4AC3 A;  3TIO A;  1IIM A;  3CJ8 A;  2X5S A;  1LZJ A;  4R37 A;  1J2Z A;  2W0V A;  2QKX A;  4N27 A;  1H5S B;  4EE4 A;  3FWW A;  1QRG A;  2RJ5 A;  4E75 A;  2X65 A;  3TDT A;  3I0I X;  5E3R A;  1ZJ2 A;  2D0J A;  2GGO A;  4EEO A;  4Q7C A;  3D8V A;  4Y7V A;  2I7B A;  1YP3 A;  1H5R B;  5C1G A;  3I0G A;  1I52 A;  4EE3 A;  3MQG A;  4AAW A;  3SRT A;  1EYR A;  3TV0 A;  4EAB A;  4HZD A;  2Y4L A;  4EEA A;  4B2X A;  3DHO A;  1HM8 A;  1O0R A;  2VXM A;  4FRB A;  4G3S A;  1VGW A;  2RJ1 A;  3R3R A;  1FRW A;  2V0L A;  4FRO A;  3IOI A;  3I0K A;  5DDT A;  1XHB A;  4MIX A;  3I0C A;  5F42 A;  4E6U A;  4G3P A;  1NKH B;  1LL2 A;  2YQC A;  1XZ6 A;  3RSB A;  3SXA A;  1TDT A;  2WVM A;  3JUK A;  2FYB A;  2IU8 A;  1VGT A;  1H7T A;  4KC2 A;  2I5E A;  3TIS A;  1K4V A;  1H7G A;  1FXJ A;  3GOS A;  2NPO A;  5EIY A;  4MZU A;  3USQ A;  1GQ9 A;  4HO2 A;  1LL0 A;  5CQM X;  1VZU A;  2Y4M A;  1WT0 A;  1KGT A;  3ST8 A;  2I5K A;  2IC7 A;  1H4E A;  1V82 A;  2Y4J A;  1ZJP A;  4LW6 A;  1JYL A;  2AEC A;  4JIS A;  1ON8 A;  2BO6 A;  2AM3 A;  1ZDG A;  4H7O A;  4IHG A;  1R80 A;  3NZ2 A;  2P72 A;  2CU2 A;  2WLC A;  4FQW A;  3PNN A;  3NGW A;  4C2S A;  1TVY A;  2V0I A;  4M4K A;  1KK4 A;  3VBK A;  3V91 A;  1Z90 A;  3LW6 A;  4ISX A;  5C4F A;  3FOQ A;  4CJC A;  4CJB A;  5J49 A;  2MZB A;  1H7F A;  3KWC A;  3EEV A;  2RIZ A;  3CKJ A;  3OH2 A;  4G87 A;  4N6A A;  4HOC A;  4KC1 A;  4E79 A;  5C47 A;  3IGJ A;  3TQD A;  4FRH A;  2E8B A;  1VIC A;  2FYA A;  3CKN A;  3BSW A;  2WVK A;  5DEM A;  3Q7U A;  3U2W A;  1H5T A;  4NAI A;  4FRP A;  1ZIZ A;  4IRQ A;  1QRM A;  5IDT A;  2FY7 A;  1FOA A;  2YQS A;  2WVL A;  4B4M A;  2RJ0 A;  1VH1 A;  3JQY A;  1LZ7 A;  3T7M A;  1JVD A;  1ZCU A;  1HM9 A;  3Q4S A;  3RMW A;  2XWM A;  1ON6 A;  4AYJ A;  3I0L A;  4ZDQ A;  4B42 A;  5D91 A;  4E1K A;  2YCM A;  4EEG A;  2WE9 A;  4HCQ A;  5I1F A;  3IXC A;  5C49 A;  4M98 A;  1H4D A;  1KHR A;  1VGU A;  1V67 A;  4Y7U A;  4Y7F A;  4EAA A;  3V0Q A;  1V3W A;  1W57 A;  4UEG A;  3SX3 A;  4CJ8 A;  4EEM A;  3K8E A;  4P02 A;  1G95 A;  1G9R A;  2X60 A;  5L6V A;  4M28 A;  4KPZ A;  1R7V A;  3ZLL A;  3R5B A;  4Y63 A;  3R1W A;  1KQA A;  5AJP A;  1KWS A;  4Y6N A;  2WGZ A;  2YES A;  3QVB A;  5DEP A;  2VK9 A;  1TW1 A;  1S4N A;  2JCK A;  2TDT A;  5DDV A;  2VXL A;  2VS5 A;  3OU9 A;  5CMH A;  1ZI5 A;  1ZDF A;  3BRK X;  2AES A;  5AFU V;  2VSH A;  1S4P A;  3T7O A;  3FSY A;  4KNX A;  2PA4 A;  2QGI A;  2AH9 A;  1SS9 A;  1W55 A;  5IDS A;  1LL3 A;  3V0P A;  4O6N A;  2RJ4 A;  3DK5 A;  3DJ4 A;  2OEF A;  1KGQ A;  3IOJ A;  1GQC A;  2AQ9 A;  3V0M A;  1H5S C;  3R5C A;  3U0X A;  2YC5 A;  1HM0 A;  1FO9 A;  5AFU U;  2VFZ A;  2RIX A;  2ZU8 A;  3VBP A;  1QRE A;  4GBP A;  2XME A;  2XAT A;  3PKP A;  2RIT A;  2W0W A;  4B4B A;  1KK6 A;  5DG3 A;  2QIV X;  4M2B A;  4B5B A;  1S4O A;  4Y7T A;  4EQY A;  4KT7 A;  2FYC B;  1H7Q A;  4FRD A;  1R7U A;  2Z86 A;  4ECM A;  1LVW A;  1H5R A;  2ZU7 A;  3BSS A;  3EH0 A;  3I3X A;  4Y6U A;  3BCV A;  2OEG A;  3OGZ A;  1FR9 A;  5AJN A;  1IIN A;  5C4D A;  2RJ9 A;  2Q4J A;  3VBI A;  2RJ6 A;  3D5N A;  3PKQ A;  1YP2 A;  3OKR A;  1H7E A;  2QIA A;  5HS2 A;  1O23 B;  2PGY A;  4AYL A;  3VBL A;  3KWE A;  1ZJO A;  3OC9 A;  3JUJ A;  4HO3 A;  3PMO A;  1ZI3 A;  4IRP A;  4Y62 A;  2JF3 A;  3V0L A;  4KPX A;  4K6R A;  4M2A A;  1VZX A;  1QG8 A;  3OH1 A;  1G8O A;  2VD4 A;  3DUV A;  1H7H A;  1XHD A;  1GX4 A;  1NWG B;  4B3U A;  2O1G A;  4R7P A;  3T7N A;  5FTS A;  2AE7 A;  3R5D A;  1V83 A;  1W77 A;  5L6S A;  3EE5 A;  3CKV A;  1WT3 A;  3ZGG A;  5C36 A;  1V84 A;  3I0J A;  3FTT A;  4HG6 A;  1SST A;  1INI A;  1H5T B;  1QRL A;  2D7I A;  1FR8 A;  1YRO B;  1GWV A;  3I0E A;  3SX8 A;  3F1X A;  3KIA A;  3I3A A;  3R0S A;  1TZF A;  4FRM A;  5E3Q A;  3R3I A;  1WSZ A;  5CQO A;  3P47 A;  4HUR A;  4MFG A;  5EJ1 A;  4EE5 A;  3I0D A;  5CMG X;  4YS8 A;  1KK5 A;  3C8V A;  1NHE B;  1ZI1 A;  2JCJ A;  3HJJ A;  2O1F A;  3BFP A;  1MR7 A;  4EA7 A;  2A8W A;  3O3P A;  1GWW A;  5CQP A;  1FXO A;  5C4C A;  4CVH A;  4FRA A;  3SXG A;  5IFY A;  1MRL A;  2VHE A;  1G23 A;  3ECT A;  2YQJ A;  1HJL A;  1HV9 A;  5ADX U;  2WLF A;  1G1L A;  1R7T A;  5C8R A;  1R82 A;  4ASJ A;  2PX7 A;  1O7O A;  4EA9 A;  2JF2 A;  5C1L A;  5C4B A;  5C3D A;  1ZI4 A;  2RJ8 A;  2FFU A;  1FWY A;  1VH3 A;  3JTJ A;  4NAL A;  3V4E A;  3POL A;  2JCO A;  2Y7A A;  2XWL A;  5CMJ A;  1ZJ1 A;  3OAM A;  3SX7 A;  3V8Y A;  3U0Y A;  1FZW A;  1ZJ0 A;  2WLE A;  2P6W A;  2FFV A;  4L41 C;  4XWI A;  2RJ7 A;  2A8U A;  2VS3 A;  3TK8 A;  1QWJ A;  1FG5 N;  3V0O A;  3TWD A;  5FYE A;  4FIY A;  2RIY A;  1XAT A;  1SSQ A;  1G3L A;  2ICY A;  4IHF A;  5CQL X;  4G3Q A;  5JQQ A;  1ZCY A;  4D48 A;  1OCX A;  4BMA A;  1FGX A;  3ZLK A;  2ICX A;  4HO5 A;  1FO8 A;  3GVD A;  3USR A;  3E25 A;  4P00 A;  2BO7 A;  2WLG A;  4MYB A;  3V0N A;  4M9C A;  2AGD A;  3OUP A;  4EVW A;  2FKO A;  1FGG A;  2Z87 A;  3D98 A;  2OI6 A;  1S80 A;  5C1H A;  1KRR A;  3VBJ A;  5C48 A;  5C4E A;  4HUS A;  1GX0 A;  2VSI A;  5FU8 A;  1VM8 A;  5CQN X;  3VBM A;  1H5S A;  3BXY A;  4EA8 A;  2C0N A;  4FCU A;  2Y6P A;  2OI5 A;  5C38 A;  3U2T A;  4FRQ A;  4KQL A;  3FSC A;  3OH3 A;  3U2V A;  3U2U A;  1ZHJ A;  3OW5 A;  5CMF X;  3KWD A;  5CMI A;  4DEC A;  4Y7G A;  3RMV A;  4HO9 A;  4HO0 A;  2YC3 A;  3SPT A;  1PZT A;  1TW5 A;  1YP4 A;  4R36 A;  3CKQ A;  4JD0 A;  4ASY A;  4ARW A;  3IOH A;  1LXA A;  1OMZ A;  1H7L A;  3SXD A;  3GUE A;  1ZCV A;  3R8Y A;  1LZ0 A;  3Q1X A;  4AA7 A;  4J09 A;  2QH5 A;  3VBN A;  2RIJ A;  3VNP A;  1NQI B;  4FIX A;  4HO8 A;  3F1C A;  4KC4 A;  3HSQ A;  3OTM A;  1NMM B;  1G0R A;  2PGV A;  4KRV A;  4D11 C;  4HZC A;  2YQH A;  4DDZ A;  3OH4 A;  4O6M A;  4Y64 A;  3P1B A;  1OMX A;  3ZF8 A;  1KRV A;  2JCL A;  1NF5 B;  2AM5 A;  4D11 A;  3FSX A;  4KXO A;  2P2O A;  1G97 A;  4FRE A;  1MC3 A;  5FUH A;  2FYD B;  3CU0 A;  2J0A A;  4N6B A;  4BQH A;  3N9W A;  3R2W A;  3V90 A;  5C3A A;  1KRU A;  3FSB A;  2OI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...