3DJ4A

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
469
structure length
462
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 161
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dj4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dj4A01
3V0QA 3ZLLA 4FRQA 5FTSA 3VBPA 1G23A 1LL0A 1XHBA 2OEGA 4FCUA 4CJBA 2RJ8A 3CJ8A 5FUHA 3SX3A 4EABA 1WVCA 2BO7A 2FYDB 2BO8A 5C1HA 3TIOA 1QREA 2WEEA 4M99A 1QG8A 3OH4A 5EIYA 1TVYA 3BSSA 1IINA 1MP5A 2ICXA 2RJ5A 2V0IA 4FRAA 2NPOA 1R80A 1ZI4A 2X65A 1YP2A 3V4EA 2I5EA 1LL2A 5U2KA 5EJ1A 3PKQA 1SSMA 3TWDA 1ON8A 2RJ1A 5C1GA 3I0CA 3IOIA 3F1XA 3SXGA 1HJLA 1QGSA 2JF3A 3BXYA 2WE9A 1G97A 5DDTA 3EG4A 5CQMX 1FWYA 4NALA 3FOQA 4AYLA 5CQLX 2W0VA 3I0FA 3RSBA 3VBLA 1ZIZA 4HZDA 1GX0A 5EJZA 1WSZA 4HZCA 1OQMB 5AJOA 4B42A 2FYBA 2FKOA 4NAIA 3HJJA 1FZWA 4DE7A 4BQHA 1LZIA 1XATA 3E26A 2A8UA 4ZDQA 1SS9A 2YQJA 4JD0A 4Y62A 4E75A 1MP4A 2AM3A 1XZ6A 3FWWA 3JQYA 2PGYA 4FRPA 4B3UA 1O0RA 4KNRA 1FR8A 2VS4A 2WLDA 3OH2A 5L6VA 4AYJA 1VGZA 4LW3A 1FR9A 1KGQA 3MC4A 4EE3A 2O1FA 5C4CA 5AFUV 3MQGA 4UEGA 4EAAA 5C1LA 1H7FA 3SXBA 3TV0A 3R5BA 5FU8A 3JUJA 1MRLA 1H7GA 2WLEA 2AECA 1QRLA 1R7YA 3NGWA 4FRMA 2ICYA 3T7OA 4Y6NA 5C3DA 1OMXA 1ZI1A 4EEOA 2I5KA 4AC3A 4Y64A 1XHDA 3V91A 3D98A 3TQDA 1KWSA 2RIZA 5I1FA 1VPAA 1K4VA 5C4DA 2FYCB 4KC2A 1PZYB 1KGTA 2VSHA 4E6UA 1JYLA 3OW5A 3K8EA 4KT7A 3TK8A 2ZU9A 3ZLKA 1WT0A 2FYAA 2GGQA 2IC7A 5CMIA 4ASJA 2WLGA 5C48A 1ZCUA 3DUVA 3R0SA 1MR7A 3SXCA 3I0IX 4HUSA 3IOHA 4Y7GA 2IUAA 3CKQA 1GWWA 3HSQA 1JVGA 2RJ0A 1R7XA 1QGQA 1G95A 3T57A 2JCKA 3OH0A 3P1BA 4FRDA 2IU8A 3FTTA 5AJPA 2MZBA 1VICA 1G2VA 3V0LA 3FSBA 1QRFA 2WVLA 2QKXA 3BSYA 4EVWA 4N27A 5ADXV 3I0EA 5E3PA 2WAWA 4DECA 1H5SB 3U2WA 4HO2A 2P72A 2FY7A 1KK6A 2AE7A 1H4EA 1LZJA 2QH5A 4EEAA 2OEFA 1KRUA 5C47A 3V0NA 2JF2A 1MP3A 1INIA 4IHHA 1ZJPA 3I0KA 5C3AA 3IOJA 3EEVA 4EA7A 4J18A 4R36A 2APCA 2DPWA 3CKOA 5CMGX 4H7OA 1H3MA 1KRVA 4B4MA 4P02A 3I0JA 3LW6A 2Z86A 5CQOA 3F1YA 2VFZA 2ZU7A 1KQAA 1QWJA 1V3WA 1QRMA 1ZJOA 3TISA 2XWNA 4Y9XA 4Y63A 2D7RA 3BCVA 3D8VA 3R5CA 3OC9A 5C8RA 1G3LA 1YP4A 2QGIA 1ZJ2A 1NHEB 1NKHB 2VS3A 3I0DA 5C38A 1W55A 2WVMA 2PX7A 1TW5A 5FYEA 4EEGA 4NAKA 4M2AA 2P2OA 3R5AA 2ZU8A 1R7TA 1FXOA 1EZIA 1QQ0A 2WVKA 3IXCA 2RJ9A 4FRHA 3T7NA 3KWCA 5C4FA 2XWMA 1S4NA 1VGUA 2OI7A 2RITA 1G8OA 1NQIB 4P00A 2CU2A 3OH3A 1KHRA 1HM0A 1ON6A 4MZUA 2P6WA 3VNPA 4ECMA 4IHGA 3PKPA 4KC4A 1KK5A 1NMMB 2Y7AA 4KQLA 4N6AA 2VS5A 1LZ7A 5IDSA 4M2BA 3DJ4A 4KNXA 4HO6A 1VGTA 4FREA 3OTMA 4B4GA 3V0MA 1W77A 2VHEA 3GVDA 1R81A 1FOAA 3SX5A 4FROA 2I7BA 4KC1A 3USRA 3ECTA 3V0OA 2YQCA 4R37A 2QIVX 1JV1A 2YESA 4YS8A 1ZCYA 3CKJA 3ZF8A 2OI5A 3I3AA 3OUPA 1MC3A 1H4CA 2BO4A 3Q1XA 1O7OA 1G9RA 1H5RB 1LL3A 1H7EA 4E1KA 3Q7UA 4HO4A 1KK4A 4KRVA 1GQ9A 3FSYA 2V0KA 1VH3A 2XMHA 1WT2A 3Q80A 1VM8A 3O3PA 3SXAA 1VZUA 3TDTA 1HV9A 2Z87A 3CU0A 1THJA 3U2UA 4D48A 3F1CA 3RMWA 1GWVA 1HM8A 1V82A 5CMHA 4MNDA 4IRQA 1H5SC 2RIXA 1LVWA 1INJA 3CKVA 3U2TA 4EA9A 3POLA 2FFUA 5C36A 1OMZA 2Y6PA 3I0HA 2AGDA 3R5DA 2AESA 3KIAA 5DG3A 4ARWA 3R8YA 3C8VA 4D0ZA 4BMAA 2Y4LA 4AAWA 1HJJA 4HO8A 1VZTA 3N9WA 2JCOA 2RJ6A 2Y4JA 5JQQA 4MYOA 1H4DA 1LXAA 5AJNA 1H7HA 1KRRA 1G1LA 2YC3A 1V84A 2VD4A 5IDTA 1T3DA 4DCLA 1O7QA 3PNNA 4M98A 3I0GA 4HO9A 4R7PA 3QVBA 4D11C 3DK5A 1TZFA 1VGWA 1TDTA 2AH9A 3TZTA 4GBPA 2XMEA 3OAMA 4DDZA 4FRLA 2V0JA 4EE4A 2Y4KA 2X5SA 4EQYA 1YROB 1FRWA 3OKRA 4E6TA 3E25A 1MR9A 2FFVA 4HO3A 3CGXA 3T7MA 2NXVA 1VH1A 3P47A 1WT1A 2GGOA 3VBJA 1FGXA 1R7UA 4E79A 1ZI5A 1H5SD 4M4KA 5DEMA 5C4EA 2VSIA 4HURA 4XWIA 4B2WA 2IU9A 1TW1A 5DDVA 1G0RA 2QIAA 1NF5B 2AM5A 4EEMA 4MFGA 3R3RA 3NZ2A 2RIYA 4FRBA 2P73A 4N6BA 2AM4A 3SX7A 3BFPA 2Y4MA 1FO8A 2TDTA 1S80A 1ZDGA 3IGJA 1H5TA 4IRPA 1S4PA 1G93A 3JUKA 5AFUU 2BO6A 4AA7A 4J09A 3FSXA 1VZXA 1ZCVA 4G87A 2PA4A 3CKNA 3KWDA 1GX4A 1V67A 4M9CA 1YP3A 1W57A 3RMVA 4Y7FA 1JYKA 1ZJ1A 5FV9A 3MQHA 2YC5A 3PMOA 4Y7VA 5CQNX 5J49A 4JISA 1SSQA 4B2XA 2OI6A 3SXDA 4CJCA 3U0XA 1H5SA 2PGVA 3DHOA 2AQ9A 1ZDFA 4N69A 4FCEA 5F42A 4L41C 1HM9A 4HG6A 1Z90A 4IHFA 3ZGFA 4C2SA 4M28A 5HS2A 3I0LA 2D7IA 1V83A 2Q4JA 2WLCA 2RIJA 1ZI3A 1H7TA 4G3PA 1ZJ0A 4EA8A 3VBIA 5C49A 2RJ7A 3EE5A 2XWLA 5FU0A 3V8YA 1R7VA 3VBMA 4HOCA 4B5BA 1GA8A 1R82A 3OH1A 3SRTA 1FO9A 2UX8A 3OGZA 3SXEA 5E3RA 3VBNA 3V0PA 4G3SA 5CQPA 1GQCA 3FSCA 1LZ0A 5FTVA 2V0LA 4D11A 1ZHJA 1ZJ3A 2WGZA 3GOSA 2RJ4A 5DEPA 2YQHA 5ADXU 1O23B 4MYBA 1QRGA 1J2ZA 2JCJA 4HO0A 4CJ8A 1PZTA 1H7LA 3ZGGA 2JCLA 3V8ZA 4KPZA 1I52A 1JV3A 2O1HA 1FXJA 5CMJA 3GUEA 3U2VA 2A8WA 3R2WA 2V0HA 1IIMA 3U2XA 5C3BA 2X5ZA 3ST8A 4D0TA 2O1GA 3FS8A 2YQSA 3KWEA 1H7QA 1SSTA 5C4BA 2X60A 1JVDA 1E5KA 1EYRA 4K6RA 4NANA 4KPXA 1S4OA 3BRKX 3OU9A 4HO5A 4EGGA 5E3QA 4HCQA 2XATA 2WLFA 4B4BA 4FQWA 4Y6UA 3U0YA 1ZCTA 1OCXA 3JTJA 2YCMA 1H5TB 4Y7TA 3EH0A 1FGGA 3D5NA 5L6SA 3USQA 4ASYA 1FG5N 3SPTA 4G3QA 3HL3A 4LW6A 3SX8A 2E3DA 3Q4SA 3K8DA 3I3XA 4ISXA 3R1WA 2VXMA 3R3IA 5CMFX 2W0WA 1H5RA 2E8BA 3VBKA 5IFYA 2D0JA 4EE5A 3V90A 4KXOA 4Y7UA 2VXLA 3OTZA 1NWGB 4CVHA 3BSWA 5BXCA 1WT3A
chains in the Genus database with same CATH superfamily
3V0QA 3ZLLA 4FRQA 5FTSA 3VBPA 1G23A 1LL0A 1XHBA 2OEGA 4FCUA 4CJBA 2RJ8A 3CJ8A 5FUHA 3SX3A 4EABA 1WVCA 2BO7A 2FYDB 4MIXA 2BO8A 5C1HA 3TIOA 1QREA 2WEEA 4M99A 3OH4A 1QG8A 5EIYA 1TVYA 3BSSA 1IINA 1MP5A 2ICXA 2RJ5A 2V0IA 4FRAA 2NPOA 1R80A 1ZI4A 2X65A 4O6NA 1YP2A 3V4EA 2I5EA 1LL2A 5U2KA 5EJ1A 3PKQA 1SSMA 3TWDA 1ON8A 2RJ1A 5C1GA 3I0CA 3IOIA 3F1XA 3SXGA 1HJLA 1QGSA 2JF3A 3BXYA 2WE9A 1G97A 5DDTA 3EG4A 5CQMX 1FWYA 4NALA 3FOQA 4AYLA 5CQLX 2W0VA 3I0FA 3RSBA 3VBLA 1ZIZA 4HZDA 1GX0A 5EJZA 1WSZA 4HZCA 1OQMB 5AJOA 4FIYA 4B42A 2FYBA 2FKOA 4NAIA 3HJJA 1FZWA 4DE7A 4BQHA 1LZIA 1XATA 3E26A 2A8UA 4ZDQA 1SS9A 2YQJA 4JD0A 4Y62A 4E75A 1MP4A 2AM3A 1XZ6A 3FWWA 3JQYA 2PGYA 4FRPA 4B3UA 1O0RA 4KNRA 1FR8A 2VS4A 2WLDA 3OH2A 5L6VA 4AYJA 1VGZA 4LW3A 1FR9A 1KGQA 3MC4A 4EE3A 2O1FA 5C4CA 5AFUV 3MQGA 4UEGA 4EAAA 5C1LA 1N4IA 1H7FA 3SXBA 3TV0A 3R5BA 2VK9A 5FU8A 3JUJA 1MRLA 1H7GA 1Z2FA 2WLEA 2AECA 1QRLA 1R7YA 3NGWA 4FRMA 2ICYA 3T7OA 4Y6NA 5C3DA 1OMXA 1ZI1A 4EEOA 2I5KA 4AC3A 4Y64A 1XHDA 3V91A 3D98A 3TQDA 1KWSA 2RIZA 5I1FA 1VPAA 1K4VA 5C4DA 2FYCB 4KC2A 1PZYB 1KGTA 2VSHA 2C0NA 4E6UA 4FIXA 1JYLA 1L0SA 3OW5A 3K8EA 4KT7A 3TK8A 2ZU9A 3ZLKA 1WT0A 2FYAA 2GGQA 2IC7A 5CMIA 4ASJA 2WLGA 5C48A 1ZCUA 3DUVA 3R0SA 1MR7A 3SXCA 3I0IX 4HUSA 3IOHA 4Y7GA 2IUAA 3CKQA 4Q7CA 1GWWA 3HSQA 1JVGA 2RJ0A 1R7XA 1QGQA 1G95A 3T57A 2JCKA 3OH0A 3P1BA 4FRDA 2IU8A 3FTTA 5AJPA 2MZBA 1VICA 1G2VA 3V0LA 3FSBA 1QRFA 2WVLA 2QKXA 3BSYA 4EVWA 4N27A 5ADXV 3I0EA 4O6MA 5E3PA 2WAWA 2J0AA 4DECA 1H5SB 3U2WA 4HO2A 2P72A 5D91A 2FY7A 1KK6A 2AE7A 1H4EA 1LZJA 2QH5A 4EEAA 2OEFA 1KRUA 5C47A 3V0NA 2JF2A 1MP3A 1INIA 4IHHA 1ZJPA 3I0KA 5C3AA 3IOJA 3EEVA 4EA7A 4J18A 4R36A 2APCA 2DPWA 3CKOA 5CMGX 4H7OA 1H3MA 1KRVA 4B4MA 4P02A 3I0JA 3LW6A 2Z86A 5CQOA 3GQAA 3F1YA 2VFZA 2ZU7A 1KQAA 1QWJA 1V3WA 1QRMA 1ZJOA 3TISA 2XWNA 4Y9XA 4Y63A 2D7RA 3BCVA 3D8VA 3R5CA 3GQ7A 3OC9A 5C8RA 1G3LA 1YP4A 2QGIA 1ZJ2A 1NHEB 1NKHB 2VS3A 3I0DA 5C38A 1W55A 2WVMA 2PX7A 1TW5A 5FYEA 4EEGA 4NAKA 4M2AA 2P2OA 3R5AA 2ZU8A 1R7TA 1FXOA 1EZIA 1QQ0A 2WVKA 3IXCA 2RJ9A 4FRHA 3T7NA 3KWCA 5C4FA 2XWMA 1S4NA 1VGUA 2OI7A 2RITA 1G8OA 1NQIB 4P00A 3OH3A 2CU2A 1KHRA 1HM0A 1ON6A 4MZUA 2P6WA 3VNPA 4ECMA 4IHGA 3PKPA 4KC4A 1KK5A 1NMMB 2Y7AA 4KQLA 4N6AA 2VS5A 1LZ7A 5IDSA 4M2BA 3DJ4A 4KNXA 4HO6A 1VGTA 4FREA 3OTMA 4B4GA 3V0MA 1W77A 2VHEA 3GVDA 1R81A 1FOAA 3SX5A 4FROA 2I7BA 4KC1A 3USRA 3ECTA 3V0OA 2YQCA 4R37A 2QIVX 1JV1A 2YESA 4YS8A 1ZCYA 3CKJA 3ZF8A 2OI5A 3I3AA 3OUPA 1MC3A 1H4CA 2BO4A 3Q1XA 1O7OA 1G9RA 1H5RB 1LL3A 1H7EA 4E1KA 3Q7UA 4HO4A 1KK4A 4KRVA 1GQ9A 3FSYA 2V0KA 1VH3A 2XMHA 3SUCA 1WT2A 3Q80A 1VM8A 3O3PA 3SXAA 1VZUA 3TDTA 1HV9A 2Z87A 3CU0A 1THJA 3U2UA 4D48A 3F1CA 3RMWA 1GWVA 1HM8A 1V82A 5CMHA 3GQ9A 4MNDA 4IRQA 1H5SC 2RIXA 1LVWA 1INJA 3CKVA 3U2TA 4EA9A 3POLA 2FFUA 5C36A 1OMZA 2Y6PA 3I0HA 2AGDA 3R5DA 2AESA 3KIAA 5DG3A 4ARWA 3R8YA 3C8VA 4D0ZA 4BMAA 2Y4LA 4AAWA 1HJJA 4HO8A 1VZTA 3N9WA 2JCOA 2RJ6A 2Y4JA 5JQQA 4MYOA 1H4DA 1LXAA 5AJNA 1H7HA 1KRRA 1G1LA 2YC3A 1V84A 2VD4A 5IDTA 1T3DA 4DCLA 1O7QA 3PNNA 4M98A 3I0GA 4HO9A 4R7PA 1M8NA 3QVBA 4D11C 3DK5A 1TZFA 1VGWA 1TDTA 2AH9A 3TZTA 4GBPA 2XMEA 3OAMA 4DDZA 4FRLA 2V0JA 4EE4A 2Y4KA 2X5SA 4EQYA 1YROB 1FRWA 3OKRA 4E6TA 3E25A 1MR9A 2FFVA 4HO3A 3CGXA 3T7MA 2NXVA 1VH1A 3P47A 1WT1A 2GGOA 3VBJA 1FGXA 1R7UA 4E79A 1ZI5A 1H5SD 2J0BA 5DEMA 4M4KA 5C4EA 2VSIA 4HURA 4XWIA 4B2WA 2IU9A 1TW1A 5DDVA 1G0RA 2QIAA 1NF5B 2AM5A 4EEMA 4MFGA 3R3RA 3NZ2A 2RIYA 4FRBA 2P73A 4N6BA 2AM4A 3SX7A 3BFPA 2Y4MA 1FO8A 2TDTA 1S80A 1ZDGA 3IGJA 1H5TA 4IRPA 1S4PA 1G93A 3JUKA 5AFUU 2BO6A 4AA7A 4J09A 3FSXA 1VZXA 1ZCVA 4G87A 2PA4A 3CKNA 3KWDA 1GX4A 1V67A 4M9CA 1YP3A 1W57A 3RMVA 4Y7FA 1JYKA 1ZJ1A 5FV9A 3MQHA 2YC5A 3PMOA 4Y7VA 5CQNX 5J49A 4JISA 1SSQA 4B2XA 2OI6A 3SXDA 4CJCA 3U0XA 1H5SA 2PGVA 3DHOA 2AQ9A 1ZDFA 4N69A 4FCEA 5F42A 4L41C 1HM9A 4HG6A 1Z90A 4IHFA 3ZGFA 4C2SA 4M28A 5HS2A 3I0LA 2D7IA 1V83A 2Q4JA 2WLCA 2RIJA 1ZI3A 1H7TA 4G3PA 1ZJ0A 4EA8A 3VBIA 5C49A 2RJ7A 3EE5A 1EWWA 2XWLA 5FU0A 3V8YA 1R7VA 3VBMA 4HOCA 4B5BA 1GA8A 3OH1A 1R82A 3SRTA 1FO9A 2UX8A 3OGZA 5D92A 3SXEA 5E3RA 3VBNA 3V0PA 4G3SA 5CQPA 1GQCA 3FSCA 1LZ0A 5FTVA 2V0LA 4D11A 1ZHJA 1ZJ3A 2WGZA 3GOSA 2RJ4A 5DEPA 2YQHA 3GQ8A 5ADXU 1O23B 4MYBA 1QRGA 1J2ZA 2JCJA 4HO0A 4CJ8A 1PZTA 1H7LA 3ZGGA 2JCLA 3V8ZA 4KPZA 1I52A 1JV3A 2O1HA 1FXJA 5CMJA 3GUEA 3U2VA 2A8WA 3R2WA 2V0HA 1IIMA 3U2XA 5C3BA 2X5ZA 3ST8A 4D0TA 2O1GA 3FS8A 2YQSA 3KWEA 1H7QA 1SSTA 5C4BA 2X60A 1JVDA 1E5KA 1EYRA 4K6RA 4NANA 4KPXA 1S4OA 3BRKX 3OU9A 4HO5A 4EGGA 5E3QA 4HCQA 2XATA 2WLFA 4B4BA 4FQWA 4Y6UA 3U0YA 1ZCTA 1OCXA 3JTJA 2YCMA 1H5TB 4Y7TA 3EH0A 1FGGA 3D5NA 5L6SA 3USQA 4ASYA 1FG5N 3SPTA 4G3QA 3HL3A 4LW6A 3SX8A 2E3DA 3Q4SA 3K8DA 3I3XA 4ISXA 3R1WA 2VXMA 3R3IA 5CMFX 2W0WA 1H5RA 2E8BA 3VBKA 5IFYA 2D0JA 4EE5A 3V90A 4KXOA 4Y7UA 2VXLA 3OTZA 1NWGB 4CVHA 3BSWA 5BXCA 1WT3A
chains in the Genus database with same CATH topology
3V0QA 3ZLLA 4FRQA 5FTSA 3VBPA 1G23A 1LL0A 1XHBA 2OEGA 4FCUA 4CJBA 2RJ8A 3CJ8A 5FUHA 3SX3A 4EABA 1WVCA 2BO7A 2FYDB 4MIXA 2BO8A 5C1HA 3TIOA 1QREA 2WEEA 4M99A 1QG8A 3OH4A 5EIYA 1TVYA 3BSSA 1IINA 1MP5A 2ICXA 2RJ5A 2V0IA 4FRAA 2NPOA 1R80A 1ZI4A 2X65A 4O6NA 1YP2A 3V4EA 2I5EA 1LL2A 5U2KA 5EJ1A 3PKQA 1SSMA 3TWDA 1ON8A 2RJ1A 5C1GA 3I0CA 3IOIA 3F1XA 3SXGA 1HJLA 1QGSA 2JF3A 3BXYA 2WE9A 1G97A 5DDTA 3EG4A 5CQMX 1FWYA 4NALA 3FOQA 4AYLA 5CQLX 2W0VA 3I0FA 3RSBA 3VBLA 1ZIZA 4HZDA 1GX0A 5EJZA 1WSZA 4HZCA 1OQMB 5AJOA 4FIYA 4B42A 2FYBA 2FKOA 4NAIA 3HJJA 1FZWA 4DE7A 4BQHA 1LZIA 1XATA 3E26A 2A8UA 4ZDQA 1SS9A 2YQJA 4JD0A 4Y62A 4E75A 1MP4A 2AM3A 1XZ6A 3FWWA 3JQYA 2PGYA 4FRPA 4B3UA 1O0RA 4KNRA 1FR8A 2VS4A 2WLDA 3OH2A 5L6VA 4AYJA 1VGZA 4LW3A 1FR9A 1KGQA 3MC4A 4EE3A 2O1FA 5C4CA 5AFUV 3MQGA 4UEGA 4EAAA 5C1LA 1H7FA 3SXBA 3TV0A 3R5BA 2VK9A 5FU8A 3JUJA 1MRLA 1H7GA 2WLEA 2AECA 1QRLA 1R7YA 3NGWA 4FRMA 2ICYA 3T7OA 4Y6NA 5C3DA 1OMXA 1ZI1A 4EEOA 2I5KA 4AC3A 4Y64A 1XHDA 3V91A 3D98A 3TQDA 1KWSA 2RIZA 5I1FA 1VPAA 1K4VA 5C4DA 2FYCB 4KC2A 1PZYB 1KGTA 2VSHA 2C0NA 4E6UA 4FIXA 1JYLA 3OW5A 3K8EA 4KT7A 3TK8A 2ZU9A 3ZLKA 1WT0A 2FYAA 2GGQA 2IC7A 5CMIA 4ASJA 2WLGA 5C48A 1ZCUA 3DUVA 3R0SA 1MR7A 3SXCA 3I0IX 4HUSA 3IOHA 4Y7GA 2IUAA 3CKQA 4Q7CA 1GWWA 3HSQA 1JVGA 2RJ0A 1R7XA 1QGQA 1G95A 3T57A 2JCKA 3OH0A 3P1BA 4FRDA 2IU8A 3FTTA 5AJPA 2MZBA 1VICA 1G2VA 3V0LA 3FSBA 1QRFA 2WVLA 2QKXA 3BSYA 4EVWA 4N27A 5ADXV 3I0EA 4O6MA 5E3PA 2WAWA 2J0AA 4DECA 1H5SB 3U2WA 4HO2A 2P72A 5D91A 2FY7A 1KK6A 2AE7A 1H4EA 1LZJA 2QH5A 4EEAA 2OEFA 1KRUA 5C47A 3V0NA 2JF2A 1MP3A 1INIA 4IHHA 1ZJPA 3I0KA 5C3AA 3IOJA 3EEVA 4EA7A 4J18A 4R36A 2APCA 2DPWA 3CKOA 5CMGX 4H7OA 1H3MA 1KRVA 4B4MA 4P02A 3I0JA 3LW6A 2Z86A 5CQOA 3F1YA 2VFZA 2ZU7A 1KQAA 1QWJA 1V3WA 1QRMA 1ZJOA 3TISA 2XWNA 4Y9XA 4Y63A 2D7RA 3BCVA 3D8VA 3R5CA 3OC9A 5C8RA 1G3LA 1YP4A 2QGIA 1ZJ2A 1NHEB 1NKHB 2VS3A 3I0DA 5C38A 1W55A 2WVMA 2PX7A 1TW5A 5FYEA 4EEGA 4NAKA 4M2AA 2P2OA 3R5AA 2ZU8A 1R7TA 1FXOA 1EZIA 1QQ0A 2WVKA 3IXCA 2RJ9A 4FRHA 3T7NA 3KWCA 5C4FA 2XWMA 1S4NA 1VGUA 2OI7A 2RITA 1G8OA 1NQIB 4P00A 2CU2A 3OH3A 1KHRA 1HM0A 1ON6A 4MZUA 2P6WA 3VNPA 4ECMA 4IHGA 3PKPA 4KC4A 1KK5A 1NMMB 2Y7AA 4KQLA 4N6AA 2VS5A 1LZ7A 5IDSA 4M2BA 3DJ4A 4KNXA 4HO6A 1VGTA 4FREA 3OTMA 4B4GA 3V0MA 1W77A 2VHEA 3GVDA 1R81A 1FOAA 3SX5A 4FROA 2I7BA 4KC1A 3USRA 3ECTA 3V0OA 2YQCA 4R37A 2QIVX 1JV1A 2YESA 4YS8A 1ZCYA 3CKJA 3ZF8A 2OI5A 3I3AA 3OUPA 1MC3A 1H4CA 2BO4A 3Q1XA 1O7OA 1G9RA 1H5RB 1LL3A 1H7EA 4E1KA 3Q7UA 4HO4A 1KK4A 4KRVA 1GQ9A 3FSYA 2V0KA 1VH3A 2XMHA 1WT2A 3Q80A 1VM8A 3O3PA 3SXAA 1VZUA 3TDTA 1HV9A 2Z87A 3CU0A 1THJA 3U2UA 4D48A 3F1CA 3RMWA 1GWVA 1HM8A 1V82A 5CMHA 4MNDA 4IRQA 1H5SC 2RIXA 1LVWA 1INJA 3CKVA 3U2TA 4EA9A 3POLA 2FFUA 5C36A 1OMZA 2Y6PA 3I0HA 2AGDA 3R5DA 2AESA 3KIAA 5DG3A 4ARWA 3R8YA 3C8VA 4D0ZA 4BMAA 2Y4LA 4AAWA 1HJJA 4HO8A 1VZTA 3N9WA 2JCOA 2RJ6A 2Y4JA 5JQQA 4MYOA 1H4DA 1LXAA 5AJNA 1H7HA 1KRRA 1G1LA 2YC3A 1V84A 2VD4A 5IDTA 1T3DA 4DCLA 1O7QA 3PNNA 4M98A 3I0GA 4HO9A 4R7PA 3QVBA 4D11C 3DK5A 1TZFA 1VGWA 1TDTA 2AH9A 3TZTA 4GBPA 2XMEA 3OAMA 4DDZA 4FRLA 2V0JA 4EE4A 2Y4KA 2X5SA 4EQYA 1YROB 1FRWA 3OKRA 4E6TA 3E25A 1MR9A 2FFVA 4HO3A 3CGXA 3T7MA 2NXVA 1VH1A 3P47A 1WT1A 2GGOA 3VBJA 1FGXA 1R7UA 4E79A 1ZI5A 1H5SD 2J0BA 5DEMA 4M4KA 5C4EA 2VSIA 4HURA 4XWIA 4B2WA 2IU9A 1TW1A 5DDVA 1G0RA 2QIAA 1NF5B 2AM5A 4EEMA 4MFGA 3R3RA 3NZ2A 2RIYA 4FRBA 2P73A 4N6BA 2AM4A 3SX7A 3BFPA 2Y4MA 1FO8A 2TDTA 1S80A 1ZDGA 3IGJA 1H5TA 4IRPA 1S4PA 1G93A 3JUKA 5AFUU 2BO6A 4AA7A 4J09A 3FSXA 1VZXA 1ZCVA 4G87A 2PA4A 3CKNA 3KWDA 1GX4A 1V67A 4M9CA 1YP3A 1W57A 3RMVA 4Y7FA 1JYKA 1ZJ1A 5FV9A 3MQHA 2YC5A 3PMOA 4Y7VA 5CQNX 5J49A 4JISA 1SSQA 4B2XA 2OI6A 3SXDA 4CJCA 3U0XA 1H5SA 2PGVA 3DHOA 2AQ9A 1ZDFA 4N69A 4FCEA 5F42A 4L41C 1HM9A 4HG6A 1Z90A 4IHFA 3ZGFA 4C2SA 4M28A 5HS2A 3I0LA 2D7IA 1V83A 2Q4JA 2WLCA 2RIJA 1ZI3A 1H7TA 4G3PA 1ZJ0A 4EA8A 3VBIA 5C49A 2RJ7A 3EE5A 2XWLA 5FU0A 3V8YA 1R7VA 3VBMA 4HOCA 4B5BA 1GA8A 1R82A 3OH1A 3SRTA 1FO9A 2UX8A 3OGZA 5D92A 3SXEA 5E3RA 3VBNA 3V0PA 4G3SA 5CQPA 1GQCA 3FSCA 1LZ0A 5FTVA 2V0LA 4D11A 1ZHJA 1ZJ3A 2WGZA 3GOSA 2RJ4A 5DEPA 2YQHA 5ADXU 1O23B 4MYBA 1QRGA 1J2ZA 2JCJA 4HO0A 4CJ8A 1PZTA 1H7LA 3ZGGA 2JCLA 3V8ZA 4KPZA 1I52A 1JV3A 2O1HA 1FXJA 5CMJA 3GUEA 3U2VA 2A8WA 3R2WA 2V0HA 1IIMA 3U2XA 5C3BA 2X5ZA 3ST8A 4D0TA 2O1GA 3FS8A 2YQSA 3KWEA 1H7QA 1SSTA 5C4BA 2X60A 1JVDA 1E5KA 1EYRA 4K6RA 4NANA 4KPXA 1S4OA 3BRKX 3OU9A 4HO5A 4EGGA 5E3QA 4HCQA 2XATA 2WLFA 4B4BA 4FQWA 4Y6UA 3U0YA 1ZCTA 1OCXA 3JTJA 2YCMA 1H5TB 4Y7TA 3EH0A 1FGGA 3D5NA 5L6SA 3USQA 4ASYA 1FG5N 3SPTA 4G3QA 3HL3A 4LW6A 3SX8A 2E3DA 3Q4SA 3K8DA 3I3XA 4ISXA 3R1WA 2VXMA 3R3IA 5CMFX 2W0WA 1H5RA 2E8BA 3VBKA 5IFYA 2D0JA 4EE5A 3V90A 4KXOA 4Y7UA 2VXLA 3OTZA 1NWGB 4CVHA 3BSWA 5BXCA 1WT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0Q A;  3ZLL A;  4FRQ A;  5FTS A;  3VBP A;  1G23 A;  1LL0 A;  1XHB A;  2OEG A;  4FCU A;  4CJB A;  2RJ8 A;  3CJ8 A;  5FUH A;  3SX3 A;  4EAB A;  1WVC A;  2BO7 A;  2FYD B;  2BO8 A;  5C1H A;  3TIO A;  1QRE A;  2WEE A;  4M99 A;  1QG8 A;  3OH4 A;  5EIY A;  1TVY A;  3BSS A;  1IIN A;  1MP5 A;  2ICX A;  2RJ5 A;  2V0I A;  4FRA A;  2NPO A;  1R80 A;  1ZI4 A;  2X65 A;  1YP2 A;  3V4E A;  2I5E A;  1LL2 A;  5U2K A;  5EJ1 A;  3PKQ A;  1SSM A;  3TWD A;  1ON8 A;  2RJ1 A;  5C1G A;  3I0C A;  3IOI A;  3F1X A;  3SXG A;  1HJL A;  1QGS A;  2JF3 A;  3BXY A;  2WE9 A;  1G97 A;  5DDT A;  3EG4 A;  5CQM X;  1FWY A;  4NAL A;  3FOQ A;  4AYL A;  5CQL X;  2W0V A;  3I0F A;  3RSB A;  3VBL A;  1ZIZ A;  4HZD A;  1GX0 A;  5EJZ A;  1WSZ A;  4HZC A;  1OQM B;  5AJO A;  4B42 A;  2FYB A;  2FKO A;  4NAI A;  3HJJ A;  1FZW A;  4DE7 A;  4BQH A;  1LZI A;  1XAT A;  3E26 A;  2A8U A;  4ZDQ A;  1SS9 A;  2YQJ A;  4JD0 A;  4Y62 A;  4E75 A;  1MP4 A;  2AM3 A;  1XZ6 A;  3FWW A;  3JQY A;  2PGY A;  4FRP A;  4B3U A;  1O0R A;  4KNR A;  1FR8 A;  2VS4 A;  2WLD A;  3OH2 A;  5L6V A;  4AYJ A;  1VGZ A;  4LW3 A;  1FR9 A;  1KGQ A;  3MC4 A;  4EE3 A;  2O1F A;  5C4C A;  5AFU V;  3MQG A;  4UEG A;  4EAA A;  5C1L A;  1H7F A;  3SXB A;  3TV0 A;  3R5B A;  5FU8 A;  3JUJ A;  1MRL A;  1H7G A;  2WLE A;  2AEC A;  1QRL A;  1R7Y A;  3NGW A;  4FRM A;  2ICY A;  3T7O A;  4Y6N A;  5C3D A;  1OMX A;  1ZI1 A;  4EEO A;  2I5K A;  4AC3 A;  4Y64 A;  1XHD A;  3V91 A;  3D98 A;  3TQD A;  1KWS A;  2RIZ A;  5I1F A;  1VPA A;  1K4V A;  5C4D A;  2FYC B;  4KC2 A;  1PZY B;  1KGT A;  2VSH A;  4E6U A;  1JYL A;  3OW5 A;  3K8E A;  4KT7 A;  3TK8 A;  2ZU9 A;  3ZLK A;  1WT0 A;  2FYA A;  2GGQ A;  2IC7 A;  5CMI A;  4ASJ A;  2WLG A;  5C48 A;  1ZCU A;  3DUV A;  3R0S A;  1MR7 A;  3SXC A;  3I0I X;  4HUS A;  3IOH A;  4Y7G A;  2IUA A;  3CKQ A;  1GWW A;  3HSQ A;  1JVG A;  2RJ0 A;  1R7X A;  1QGQ A;  1G95 A;  3T57 A;  2JCK A;  3OH0 A;  3P1B A;  4FRD A;  2IU8 A;  3FTT A;  5AJP A;  2MZB A;  1VIC A;  1G2V A;  3V0L A;  3FSB A;  1QRF A;  2WVL A;  2QKX A;  3BSY A;  4EVW A;  4N27 A;  5ADX V;  3I0E A;  5E3P A;  2WAW A;  4DEC A;  1H5S B;  3U2W A;  4HO2 A;  2P72 A;  2FY7 A;  1KK6 A;  2AE7 A;  1H4E A;  1LZJ A;  2QH5 A;  4EEA A;  2OEF A;  1KRU A;  5C47 A;  3V0N A;  2JF2 A;  1MP3 A;  1INI A;  4IHH A;  1ZJP A;  3I0K A;  5C3A A;  3IOJ A;  3EEV A;  4EA7 A;  4J18 A;  4R36 A;  2APC A;  2DPW A;  3CKO A;  5CMG X;  4H7O A;  1H3M A;  1KRV A;  4B4M A;  4P02 A;  3I0J A;  3LW6 A;  2Z86 A;  5CQO A;  3F1Y A;  2VFZ A;  2ZU7 A;  1KQA A;  1QWJ A;  1V3W A;  1QRM A;  1ZJO A;  3TIS A;  2XWN A;  4Y9X A;  4Y63 A;  2D7R A;  3BCV A;  3D8V A;  3R5C A;  3OC9 A;  5C8R A;  1G3L A;  1YP4 A;  2QGI A;  1ZJ2 A;  1NHE B;  1NKH B;  2VS3 A;  3I0D A;  5C38 A;  1W55 A;  2WVM A;  2PX7 A;  1TW5 A;  5FYE A;  4EEG A;  4NAK A;  4M2A A;  2P2O A;  3R5A A;  2ZU8 A;  1R7T A;  1FXO A;  1EZI A;  1QQ0 A;  2WVK A;  3IXC A;  2RJ9 A;  4FRH A;  3T7N A;  3KWC A;  5C4F A;  2XWM A;  1S4N A;  1VGU A;  2OI7 A;  2RIT A;  1G8O A;  1NQI B;  4P00 A;  2CU2 A;  3OH3 A;  1KHR A;  1HM0 A;  1ON6 A;  4MZU A;  2P6W A;  3VNP A;  4ECM A;  4IHG A;  3PKP A;  4KC4 A;  1KK5 A;  1NMM B;  2Y7A A;  4KQL A;  4N6A A;  2VS5 A;  1LZ7 A;  5IDS A;  4M2B A;  3DJ4 A;  4KNX A;  4HO6 A;  1VGT A;  4FRE A;  3OTM A;  4B4G A;  3V0M A;  1W77 A;  2VHE A;  3GVD A;  1R81 A;  1FOA A;  3SX5 A;  4FRO A;  2I7B A;  4KC1 A;  3USR A;  3ECT A;  3V0O A;  2YQC A;  4R37 A;  2QIV X;  1JV1 A;  2YES A;  4YS8 A;  1ZCY A;  3CKJ A;  3ZF8 A;  2OI5 A;  3I3A A;  3OUP A;  1MC3 A;  1H4C A;  2BO4 A;  3Q1X A;  1O7O A;  1G9R A;  1H5R B;  1LL3 A;  1H7E A;  4E1K A;  3Q7U A;  4HO4 A;  1KK4 A;  4KRV A;  1GQ9 A;  3FSY A;  2V0K A;  1VH3 A;  2XMH A;  1WT2 A;  3Q80 A;  1VM8 A;  3O3P A;  3SXA A;  1VZU A;  3TDT A;  1HV9 A;  2Z87 A;  3CU0 A;  1THJ A;  3U2U A;  4D48 A;  3F1C A;  3RMW A;  1GWV A;  1HM8 A;  1V82 A;  5CMH A;  4MND A;  4IRQ A;  1H5S C;  2RIX A;  1LVW A;  1INJ A;  3CKV A;  3U2T A;  4EA9 A;  3POL A;  2FFU A;  5C36 A;  1OMZ A;  2Y6P A;  3I0H A;  2AGD A;  3R5D A;  2AES A;  3KIA A;  5DG3 A;  4ARW A;  3R8Y A;  3C8V A;  4D0Z A;  4BMA A;  2Y4L A;  4AAW A;  1HJJ A;  4HO8 A;  1VZT A;  3N9W A;  2JCO A;  2RJ6 A;  2Y4J A;  5JQQ A;  4MYO A;  1H4D A;  1LXA A;  5AJN A;  1H7H A;  1KRR A;  1G1L A;  2YC3 A;  1V84 A;  2VD4 A;  5IDT A;  1T3D A;  4DCL A;  1O7Q A;  3PNN A;  4M98 A;  3I0G A;  4HO9 A;  4R7P A;  3QVB A;  4D11 C;  3DK5 A;  1TZF A;  1VGW A;  1TDT A;  2AH9 A;  3TZT A;  4GBP A;  2XME A;  3OAM A;  4DDZ A;  4FRL A;  2V0J A;  4EE4 A;  2Y4K A;  2X5S A;  4EQY A;  1YRO B;  1FRW A;  3OKR A;  4E6T A;  3E25 A;  1MR9 A;  2FFV A;  4HO3 A;  3CGX A;  3T7M A;  2NXV A;  1VH1 A;  3P47 A;  1WT1 A;  2GGO A;  3VBJ A;  1FGX A;  1R7U A;  4E79 A;  1ZI5 A;  1H5S D;  4M4K A;  5DEM A;  5C4E A;  2VSI A;  4HUR A;  4XWI A;  4B2W A;  2IU9 A;  1TW1 A;  5DDV A;  1G0R A;  2QIA A;  1NF5 B;  2AM5 A;  4EEM A;  4MFG A;  3R3R A;  3NZ2 A;  2RIY A;  4FRB A;  2P73 A;  4N6B A;  2AM4 A;  3SX7 A;  3BFP A;  2Y4M A;  1FO8 A;  2TDT A;  1S80 A;  1ZDG A;  3IGJ A;  1H5T A;  4IRP A;  1S4P A;  1G93 A;  3JUK A;  5AFU U;  2BO6 A;  4AA7 A;  4J09 A;  3FSX A;  1VZX A;  1ZCV A;  4G87 A;  2PA4 A;  3CKN A;  3KWD A;  1GX4 A;  1V67 A;  4M9C A;  1YP3 A;  1W57 A;  3RMV A;  4Y7F A;  1JYK A;  1ZJ1 A;  5FV9 A;  3MQH A;  2YC5 A;  3PMO A;  4Y7V A;  5CQN X;  5J49 A;  4JIS A;  1SSQ A;  4B2X A;  2OI6 A;  3SXD A;  4CJC A;  3U0X A;  1H5S A;  2PGV A;  3DHO A;  2AQ9 A;  1ZDF A;  4N69 A;  4FCE A;  5F42 A;  4L41 C;  1HM9 A;  4HG6 A;  1Z90 A;  4IHF A;  3ZGF A;  4C2S A;  4M28 A;  5HS2 A;  3I0L A;  2D7I A;  1V83 A;  2Q4J A;  2WLC A;  2RIJ A;  1ZI3 A;  1H7T A;  4G3P A;  1ZJ0 A;  4EA8 A;  3VBI A;  5C49 A;  2RJ7 A;  3EE5 A;  2XWL A;  5FU0 A;  3V8Y A;  1R7V A;  3VBM A;  4HOC A;  4B5B A;  1GA8 A;  1R82 A;  3OH1 A;  3SRT A;  1FO9 A;  2UX8 A;  3OGZ A;  3SXE A;  5E3R A;  3VBN A;  3V0P A;  4G3S A;  5CQP A;  1GQC A;  3FSC A;  1LZ0 A;  5FTV A;  2V0L A;  4D11 A;  1ZHJ A;  1ZJ3 A;  2WGZ A;  3GOS A;  2RJ4 A;  5DEP A;  2YQH A;  5ADX U;  1O23 B;  4MYB A;  1QRG A;  1J2Z A;  2JCJ A;  4HO0 A;  4CJ8 A;  1PZT A;  1H7L A;  3ZGG A;  2JCL A;  3V8Z A;  4KPZ A;  1I52 A;  1JV3 A;  2O1H A;  1FXJ A;  5CMJ A;  3GUE A;  3U2V A;  2A8W A;  3R2W A;  2V0H A;  1IIM A;  3U2X A;  5C3B A;  2X5Z A;  3ST8 A;  4D0T A;  2O1G A;  3FS8 A;  2YQS A;  3KWE A;  1H7Q A;  1SST A;  5C4B A;  2X60 A;  1JVD A;  1E5K A;  1EYR A;  4K6R A;  4NAN A;  4KPX A;  1S4O A;  3BRK X;  3OU9 A;  4HO5 A;  4EGG A;  5E3Q A;  4HCQ A;  2XAT A;  2WLF A;  4B4B A;  4FQW A;  4Y6U A;  3U0Y A;  1ZCT A;  1OCX A;  3JTJ A;  2YCM A;  1H5T B;  4Y7T A;  3EH0 A;  1FGG A;  3D5N A;  5L6S A;  3USQ A;  4ASY A;  1FG5 N;  3SPT A;  4G3Q A;  3HL3 A;  4LW6 A;  3SX8 A;  2E3D A;  3Q4S A;  3K8D A;  3I3X A;  4ISX A;  3R1W A;  2VXM A;  3R3I A;  5CMF X;  2W0W A;  1H5R A;  2E8B A;  3VBK A;  5IFY A;  2D0J A;  4EE5 A;  3V90 A;  4KXO A;  4Y7U A;  2VXL A;  3OTZ A;  1NWG B;  4CVH A;  3BSW A;  5BXC A;  1WT3 A; 
#chains in the Genus database with same CATH topology
 3V0Q A;  3ZLL A;  4FRQ A;  5FTS A;  3VBP A;  1G23 A;  1LL0 A;  1XHB A;  2OEG A;  4FCU A;  4CJB A;  2RJ8 A;  3CJ8 A;  5FUH A;  3SX3 A;  4EAB A;  1WVC A;  2BO7 A;  2FYD B;  4MIX A;  2BO8 A;  5C1H A;  3TIO A;  1QRE A;  2WEE A;  4M99 A;  3OH4 A;  1QG8 A;  5EIY A;  1TVY A;  3BSS A;  1IIN A;  1MP5 A;  2ICX A;  2RJ5 A;  2V0I A;  4FRA A;  2NPO A;  1R80 A;  1ZI4 A;  2X65 A;  4O6N A;  1YP2 A;  3V4E A;  2I5E A;  1LL2 A;  5U2K A;  5EJ1 A;  3PKQ A;  1SSM A;  3TWD A;  1ON8 A;  2RJ1 A;  5C1G A;  3I0C A;  3IOI A;  3F1X A;  3SXG A;  1HJL A;  1QGS A;  2JF3 A;  3BXY A;  2WE9 A;  1G97 A;  5DDT A;  3EG4 A;  5CQM X;  1FWY A;  4NAL A;  3FOQ A;  4AYL A;  5CQL X;  2W0V A;  3I0F A;  3RSB A;  3VBL A;  1ZIZ A;  4HZD A;  1GX0 A;  5EJZ A;  1WSZ A;  4HZC A;  1OQM B;  5AJO A;  4FIY A;  4B42 A;  2FYB A;  2FKO A;  4NAI A;  3HJJ A;  1FZW A;  4DE7 A;  4BQH A;  1LZI A;  1XAT A;  3E26 A;  2A8U A;  4ZDQ A;  1SS9 A;  2YQJ A;  4JD0 A;  4Y62 A;  4E75 A;  1MP4 A;  2AM3 A;  1XZ6 A;  3FWW A;  3JQY A;  2PGY A;  4FRP A;  4B3U A;  1O0R A;  4KNR A;  1FR8 A;  2VS4 A;  2WLD A;  3OH2 A;  5L6V A;  4AYJ A;  1VGZ A;  4LW3 A;  1FR9 A;  1KGQ A;  3MC4 A;  4EE3 A;  2O1F A;  5C4C A;  5AFU V;  3MQG A;  4UEG A;  4EAA A;  5C1L A;  1N4I A;  1H7F A;  3SXB A;  3TV0 A;  3R5B A;  2VK9 A;  5FU8 A;  3JUJ A;  1MRL A;  1H7G A;  1Z2F A;  2WLE A;  2AEC A;  1QRL A;  1R7Y A;  3NGW A;  4FRM A;  2ICY A;  3T7O A;  4Y6N A;  5C3D A;  1OMX A;  1ZI1 A;  4EEO A;  2I5K A;  4AC3 A;  4Y64 A;  1XHD A;  3V91 A;  3D98 A;  3TQD A;  1KWS A;  2RIZ A;  5I1F A;  1VPA A;  1K4V A;  5C4D A;  2FYC B;  4KC2 A;  1PZY B;  1KGT A;  2VSH A;  2C0N A;  4E6U A;  4FIX A;  1JYL A;  1L0S A;  3OW5 A;  3K8E A;  4KT7 A;  3TK8 A;  2ZU9 A;  3ZLK A;  1WT0 A;  2FYA A;  2GGQ A;  2IC7 A;  5CMI A;  4ASJ A;  2WLG A;  5C48 A;  1ZCU A;  3DUV A;  3R0S A;  1MR7 A;  3SXC A;  3I0I X;  4HUS A;  3IOH A;  4Y7G A;  2IUA A;  3CKQ A;  4Q7C A;  1GWW A;  3HSQ A;  1JVG A;  2RJ0 A;  1R7X A;  1QGQ A;  1G95 A;  3T57 A;  2JCK A;  3OH0 A;  3P1B A;  4FRD A;  2IU8 A;  3FTT A;  5AJP A;  2MZB A;  1VIC A;  1G2V A;  3V0L A;  3FSB A;  1QRF A;  2WVL A;  2QKX A;  3BSY A;  4EVW A;  4N27 A;  5ADX V;  3I0E A;  4O6M A;  5E3P A;  2WAW A;  2J0A A;  4DEC A;  1H5S B;  3U2W A;  4HO2 A;  2P72 A;  5D91 A;  2FY7 A;  1KK6 A;  2AE7 A;  1H4E A;  1LZJ A;  2QH5 A;  4EEA A;  2OEF A;  1KRU A;  5C47 A;  3V0N A;  2JF2 A;  1MP3 A;  1INI A;  4IHH A;  1ZJP A;  3I0K A;  5C3A A;  3IOJ A;  3EEV A;  4EA7 A;  4J18 A;  4R36 A;  2APC A;  2DPW A;  3CKO A;  5CMG X;  4H7O A;  1H3M A;  1KRV A;  4B4M A;  4P02 A;  3I0J A;  3LW6 A;  2Z86 A;  5CQO A;  3GQA A;  3F1Y A;  2VFZ A;  2ZU7 A;  1KQA A;  1QWJ A;  1V3W A;  1QRM A;  1ZJO A;  3TIS A;  2XWN A;  4Y9X A;  4Y63 A;  2D7R A;  3BCV A;  3D8V A;  3R5C A;  3GQ7 A;  3OC9 A;  5C8R A;  1G3L A;  1YP4 A;  2QGI A;  1ZJ2 A;  1NHE B;  1NKH B;  2VS3 A;  3I0D A;  5C38 A;  1W55 A;  2WVM A;  2PX7 A;  1TW5 A;  5FYE A;  4EEG A;  4NAK A;  4M2A A;  2P2O A;  3R5A A;  2ZU8 A;  1R7T A;  1FXO A;  1EZI A;  1QQ0 A;  2WVK A;  3IXC A;  2RJ9 A;  4FRH A;  3T7N A;  3KWC A;  5C4F A;  2XWM A;  1S4N A;  1VGU A;  2OI7 A;  2RIT A;  1G8O A;  1NQI B;  4P00 A;  3OH3 A;  2CU2 A;  1KHR A;  1HM0 A;  1ON6 A;  4MZU A;  2P6W A;  3VNP A;  4ECM A;  4IHG A;  3PKP A;  4KC4 A;  1KK5 A;  1NMM B;  2Y7A A;  4KQL A;  4N6A A;  2VS5 A;  1LZ7 A;  5IDS A;  4M2B A;  3DJ4 A;  4KNX A;  4HO6 A;  1VGT A;  4FRE A;  3OTM A;  4B4G A;  3V0M A;  1W77 A;  2VHE A;  3GVD A;  1R81 A;  1FOA A;  3SX5 A;  4FRO A;  2I7B A;  4KC1 A;  3USR A;  3ECT A;  3V0O A;  2YQC A;  4R37 A;  2QIV X;  1JV1 A;  2YES A;  4YS8 A;  1ZCY A;  3CKJ A;  3ZF8 A;  2OI5 A;  3I3A A;  3OUP A;  1MC3 A;  1H4C A;  2BO4 A;  3Q1X A;  1O7O A;  1G9R A;  1H5R B;  1LL3 A;  1H7E A;  4E1K A;  3Q7U A;  4HO4 A;  1KK4 A;  4KRV A;  1GQ9 A;  3FSY A;  2V0K A;  1VH3 A;  2XMH A;  3SUC A;  1WT2 A;  3Q80 A;  1VM8 A;  3O3P A;  3SXA A;  1VZU A;  3TDT A;  1HV9 A;  2Z87 A;  3CU0 A;  1THJ A;  3U2U A;  4D48 A;  3F1C A;  3RMW A;  1GWV A;  1HM8 A;  1V82 A;  5CMH A;  3GQ9 A;  4MND A;  4IRQ A;  1H5S C;  2RIX A;  1LVW A;  1INJ A;  3CKV A;  3U2T A;  4EA9 A;  3POL A;  2FFU A;  5C36 A;  1OMZ A;  2Y6P A;  3I0H A;  2AGD A;  3R5D A;  2AES A;  3KIA A;  5DG3 A;  4ARW A;  3R8Y A;  3C8V A;  4D0Z A;  4BMA A;  2Y4L A;  4AAW A;  1HJJ A;  4HO8 A;  1VZT A;  3N9W A;  2JCO A;  2RJ6 A;  2Y4J A;  5JQQ A;  4MYO A;  1H4D A;  1LXA A;  5AJN A;  1H7H A;  1KRR A;  1G1L A;  2YC3 A;  1V84 A;  2VD4 A;  5IDT A;  1T3D A;  4DCL A;  1O7Q A;  3PNN A;  4M98 A;  3I0G A;  4HO9 A;  4R7P A;  1M8N A;  3QVB A;  4D11 C;  3DK5 A;  1TZF A;  1VGW A;  1TDT A;  2AH9 A;  3TZT A;  4GBP A;  2XME A;  3OAM A;  4DDZ A;  4FRL A;  2V0J A;  4EE4 A;  2Y4K A;  2X5S A;  4EQY A;  1YRO B;  1FRW A;  3OKR A;  4E6T A;  3E25 A;  1MR9 A;  2FFV A;  4HO3 A;  3CGX A;  3T7M A;  2NXV A;  1VH1 A;  3P47 A;  1WT1 A;  2GGO A;  3VBJ A;  1FGX A;  1R7U A;  4E79 A;  1ZI5 A;  1H5S D;  2J0B A;  5DEM A;  4M4K A;  5C4E A;  2VSI A;  4HUR A;  4XWI A;  4B2W A;  2IU9 A;  1TW1 A;  5DDV A;  1G0R A;  2QIA A;  1NF5 B;  2AM5 A;  4EEM A;  4MFG A;  3R3R A;  3NZ2 A;  2RIY A;  4FRB A;  2P73 A;  4N6B A;  2AM4 A;  3SX7 A;  3BFP A;  2Y4M A;  1FO8 A;  2TDT A;  1S80 A;  1ZDG A;  3IGJ A;  1H5T A;  4IRP A;  1S4P A;  1G93 A;  3JUK A;  5AFU U;  2BO6 A;  4AA7 A;  4J09 A;  3FSX A;  1VZX A;  1ZCV A;  4G87 A;  2PA4 A;  3CKN A;  3KWD A;  1GX4 A;  1V67 A;  4M9C A;  1YP3 A;  1W57 A;  3RMV A;  4Y7F A;  1JYK A;  1ZJ1 A;  5FV9 A;  3MQH A;  2YC5 A;  3PMO A;  4Y7V A;  5CQN X;  5J49 A;  4JIS A;  1SSQ A;  4B2X A;  2OI6 A;  3SXD A;  4CJC A;  3U0X A;  1H5S A;  2PGV A;  3DHO A;  2AQ9 A;  1ZDF A;  4N69 A;  4FCE A;  5F42 A;  4L41 C;  1HM9 A;  4HG6 A;  1Z90 A;  4IHF A;  3ZGF A;  4C2S A;  4M28 A;  5HS2 A;  3I0L A;  2D7I A;  1V83 A;  2Q4J A;  2WLC A;  2RIJ A;  1ZI3 A;  1H7T A;  4G3P A;  1ZJ0 A;  4EA8 A;  3VBI A;  5C49 A;  2RJ7 A;  3EE5 A;  1EWW A;  2XWL A;  5FU0 A;  3V8Y A;  1R7V A;  3VBM A;  4HOC A;  4B5B A;  1GA8 A;  3OH1 A;  1R82 A;  3SRT A;  1FO9 A;  2UX8 A;  3OGZ A;  5D92 A;  3SXE A;  5E3R A;  3VBN A;  3V0P A;  4G3S A;  5CQP A;  1GQC A;  3FSC A;  1LZ0 A;  5FTV A;  2V0L A;  4D11 A;  1ZHJ A;  1ZJ3 A;  2WGZ A;  3GOS A;  2RJ4 A;  5DEP A;  2YQH A;  3GQ8 A;  5ADX U;  1O23 B;  4MYB A;  1QRG A;  1J2Z A;  2JCJ A;  4HO0 A;  4CJ8 A;  1PZT A;  1H7L A;  3ZGG A;  2JCL A;  3V8Z A;  4KPZ A;  1I52 A;  1JV3 A;  2O1H A;  1FXJ A;  5CMJ A;  3GUE A;  3U2V A;  2A8W A;  3R2W A;  2V0H A;  1IIM A;  3U2X A;  5C3B A;  2X5Z A;  3ST8 A;  4D0T A;  2O1G A;  3FS8 A;  2YQS A;  3KWE A;  1H7Q A;  1SST A;  5C4B A;  2X60 A;  1JVD A;  1E5K A;  1EYR A;  4K6R A;  4NAN A;  4KPX A;  1S4O A;  3BRK X;  3OU9 A;  4HO5 A;  4EGG A;  5E3Q A;  4HCQ A;  2XAT A;  2WLF A;  4B4B A;  4FQW A;  4Y6U A;  3U0Y A;  1ZCT A;  1OCX A;  3JTJ A;  2YCM A;  1H5T B;  4Y7T A;  3EH0 A;  1FGG A;  3D5N A;  5L6S A;  3USQ A;  4ASY A;  1FG5 N;  3SPT A;  4G3Q A;  3HL3 A;  4LW6 A;  3SX8 A;  2E3D A;  3Q4S A;  3K8D A;  3I3X A;  4ISX A;  3R1W A;  2VXM A;  3R3I A;  5CMF X;  2W0W A;  1H5R A;  2E8B A;  3VBK A;  5IFY A;  2D0J A;  4EE5 A;  3V90 A;  4KXO A;  4Y7U A;  2VXL A;  3OTZ A;  1NWG B;  4CVH A;  3BSW A;  5BXC A;  1WT3 A; 
#chains in the Genus database with same CATH homology
 3V0Q A;  3ZLL A;  4FRQ A;  5FTS A;  3VBP A;  1G23 A;  1LL0 A;  1XHB A;  2OEG A;  4FCU A;  4CJB A;  2RJ8 A;  3CJ8 A;  5FUH A;  3SX3 A;  4EAB A;  1WVC A;  2BO7 A;  2FYD B;  4MIX A;  2BO8 A;  5C1H A;  3TIO A;  1QRE A;  2WEE A;  4M99 A;  1QG8 A;  3OH4 A;  5EIY A;  1TVY A;  3BSS A;  1IIN A;  1MP5 A;  2ICX A;  2RJ5 A;  2V0I A;  4FRA A;  2NPO A;  1R80 A;  1ZI4 A;  2X65 A;  4O6N A;  1YP2 A;  3V4E A;  2I5E A;  1LL2 A;  5U2K A;  5EJ1 A;  3PKQ A;  1SSM A;  3TWD A;  1ON8 A;  2RJ1 A;  5C1G A;  3I0C A;  3IOI A;  3F1X A;  3SXG A;  1HJL A;  1QGS A;  2JF3 A;  3BXY A;  2WE9 A;  1G97 A;  5DDT A;  3EG4 A;  5CQM X;  1FWY A;  4NAL A;  3FOQ A;  4AYL A;  5CQL X;  2W0V A;  3I0F A;  3RSB A;  3VBL A;  1ZIZ A;  4HZD A;  1GX0 A;  5EJZ A;  1WSZ A;  4HZC A;  1OQM B;  5AJO A;  4FIY A;  4B42 A;  2FYB A;  2FKO A;  4NAI A;  3HJJ A;  1FZW A;  4DE7 A;  4BQH A;  1LZI A;  1XAT A;  3E26 A;  2A8U A;  4ZDQ A;  1SS9 A;  2YQJ A;  4JD0 A;  4Y62 A;  4E75 A;  1MP4 A;  2AM3 A;  1XZ6 A;  3FWW A;  3JQY A;  2PGY A;  4FRP A;  4B3U A;  1O0R A;  4KNR A;  1FR8 A;  2VS4 A;  2WLD A;  3OH2 A;  5L6V A;  4AYJ A;  1VGZ A;  4LW3 A;  1FR9 A;  1KGQ A;  3MC4 A;  4EE3 A;  2O1F A;  5C4C A;  5AFU V;  3MQG A;  4UEG A;  4EAA A;  5C1L A;  1H7F A;  3SXB A;  3TV0 A;  3R5B A;  2VK9 A;  5FU8 A;  3JUJ A;  1MRL A;  1H7G A;  2WLE A;  2AEC A;  1QRL A;  1R7Y A;  3NGW A;  4FRM A;  2ICY A;  3T7O A;  4Y6N A;  5C3D A;  1OMX A;  1ZI1 A;  4EEO A;  2I5K A;  4AC3 A;  4Y64 A;  1XHD A;  3V91 A;  3D98 A;  3TQD A;  1KWS A;  2RIZ A;  5I1F A;  1VPA A;  1K4V A;  5C4D A;  2FYC B;  4KC2 A;  1PZY B;  1KGT A;  2VSH A;  2C0N A;  4E6U A;  4FIX A;  1JYL A;  3OW5 A;  3K8E A;  4KT7 A;  3TK8 A;  2ZU9 A;  3ZLK A;  1WT0 A;  2FYA A;  2GGQ A;  2IC7 A;  5CMI A;  4ASJ A;  2WLG A;  5C48 A;  1ZCU A;  3DUV A;  3R0S A;  1MR7 A;  3SXC A;  3I0I X;  4HUS A;  3IOH A;  4Y7G A;  2IUA A;  3CKQ A;  4Q7C A;  1GWW A;  3HSQ A;  1JVG A;  2RJ0 A;  1R7X A;  1QGQ A;  1G95 A;  3T57 A;  2JCK A;  3OH0 A;  3P1B A;  4FRD A;  2IU8 A;  3FTT A;  5AJP A;  2MZB A;  1VIC A;  1G2V A;  3V0L A;  3FSB A;  1QRF A;  2WVL A;  2QKX A;  3BSY A;  4EVW A;  4N27 A;  5ADX V;  3I0E A;  4O6M A;  5E3P A;  2WAW A;  2J0A A;  4DEC A;  1H5S B;  3U2W A;  4HO2 A;  2P72 A;  5D91 A;  2FY7 A;  1KK6 A;  2AE7 A;  1H4E A;  1LZJ A;  2QH5 A;  4EEA A;  2OEF A;  1KRU A;  5C47 A;  3V0N A;  2JF2 A;  1MP3 A;  1INI A;  4IHH A;  1ZJP A;  3I0K A;  5C3A A;  3IOJ A;  3EEV A;  4EA7 A;  4J18 A;  4R36 A;  2APC A;  2DPW A;  3CKO A;  5CMG X;  4H7O A;  1H3M A;  1KRV A;  4B4M A;  4P02 A;  3I0J A;  3LW6 A;  2Z86 A;  5CQO A;  3F1Y A;  2VFZ A;  2ZU7 A;  1KQA A;  1QWJ A;  1V3W A;  1QRM A;  1ZJO A;  3TIS A;  2XWN A;  4Y9X A;  4Y63 A;  2D7R A;  3BCV A;  3D8V A;  3R5C A;  3OC9 A;  5C8R A;  1G3L A;  1YP4 A;  2QGI A;  1ZJ2 A;  1NHE B;  1NKH B;  2VS3 A;  3I0D A;  5C38 A;  1W55 A;  2WVM A;  2PX7 A;  1TW5 A;  5FYE A;  4EEG A;  4NAK A;  4M2A A;  2P2O A;  3R5A A;  2ZU8 A;  1R7T A;  1FXO A;  1EZI A;  1QQ0 A;  2WVK A;  3IXC A;  2RJ9 A;  4FRH A;  3T7N A;  3KWC A;  5C4F A;  2XWM A;  1S4N A;  1VGU A;  2OI7 A;  2RIT A;  1G8O A;  1NQI B;  4P00 A;  2CU2 A;  3OH3 A;  1KHR A;  1HM0 A;  1ON6 A;  4MZU A;  2P6W A;  3VNP A;  4ECM A;  4IHG A;  3PKP A;  4KC4 A;  1KK5 A;  1NMM B;  2Y7A A;  4KQL A;  4N6A A;  2VS5 A;  1LZ7 A;  5IDS A;  4M2B A;  3DJ4 A;  4KNX A;  4HO6 A;  1VGT A;  4FRE A;  3OTM A;  4B4G A;  3V0M A;  1W77 A;  2VHE A;  3GVD A;  1R81 A;  1FOA A;  3SX5 A;  4FRO A;  2I7B A;  4KC1 A;  3USR A;  3ECT A;  3V0O A;  2YQC A;  4R37 A;  2QIV X;  1JV1 A;  2YES A;  4YS8 A;  1ZCY A;  3CKJ A;  3ZF8 A;  2OI5 A;  3I3A A;  3OUP A;  1MC3 A;  1H4C A;  2BO4 A;  3Q1X A;  1O7O A;  1G9R A;  1H5R B;  1LL3 A;  1H7E A;  4E1K A;  3Q7U A;  4HO4 A;  1KK4 A;  4KRV A;  1GQ9 A;  3FSY A;  2V0K A;  1VH3 A;  2XMH A;  1WT2 A;  3Q80 A;  1VM8 A;  3O3P A;  3SXA A;  1VZU A;  3TDT A;  1HV9 A;  2Z87 A;  3CU0 A;  1THJ A;  3U2U A;  4D48 A;  3F1C A;  3RMW A;  1GWV A;  1HM8 A;  1V82 A;  5CMH A;  4MND A;  4IRQ A;  1H5S C;  2RIX A;  1LVW A;  1INJ A;  3CKV A;  3U2T A;  4EA9 A;  3POL A;  2FFU A;  5C36 A;  1OMZ A;  2Y6P A;  3I0H A;  2AGD A;  3R5D A;  2AES A;  3KIA A;  5DG3 A;  4ARW A;  3R8Y A;  3C8V A;  4D0Z A;  4BMA A;  2Y4L A;  4AAW A;  1HJJ A;  4HO8 A;  1VZT A;  3N9W A;  2JCO A;  2RJ6 A;  2Y4J A;  5JQQ A;  4MYO A;  1H4D A;  1LXA A;  5AJN A;  1H7H A;  1KRR A;  1G1L A;  2YC3 A;  1V84 A;  2VD4 A;  5IDT A;  1T3D A;  4DCL A;  1O7Q A;  3PNN A;  4M98 A;  3I0G A;  4HO9 A;  4R7P A;  3QVB A;  4D11 C;  3DK5 A;  1TZF A;  1VGW A;  1TDT A;  2AH9 A;  3TZT A;  4GBP A;  2XME A;  3OAM A;  4DDZ A;  4FRL A;  2V0J A;  4EE4 A;  2Y4K A;  2X5S A;  4EQY A;  1YRO B;  1FRW A;  3OKR A;  4E6T A;  3E25 A;  1MR9 A;  2FFV A;  4HO3 A;  3CGX A;  3T7M A;  2NXV A;  1VH1 A;  3P47 A;  1WT1 A;  2GGO A;  3VBJ A;  1FGX A;  1R7U A;  4E79 A;  1ZI5 A;  1H5S D;  2J0B A;  5DEM A;  4M4K A;  5C4E A;  2VSI A;  4HUR A;  4XWI A;  4B2W A;  2IU9 A;  1TW1 A;  5DDV A;  1G0R A;  2QIA A;  1NF5 B;  2AM5 A;  4EEM A;  4MFG A;  3R3R A;  3NZ2 A;  2RIY A;  4FRB A;  2P73 A;  4N6B A;  2AM4 A;  3SX7 A;  3BFP A;  2Y4M A;  1FO8 A;  2TDT A;  1S80 A;  1ZDG A;  3IGJ A;  1H5T A;  4IRP A;  1S4P A;  1G93 A;  3JUK A;  5AFU U;  2BO6 A;  4AA7 A;  4J09 A;  3FSX A;  1VZX A;  1ZCV A;  4G87 A;  2PA4 A;  3CKN A;  3KWD A;  1GX4 A;  1V67 A;  4M9C A;  1YP3 A;  1W57 A;  3RMV A;  4Y7F A;  1JYK A;  1ZJ1 A;  5FV9 A;  3MQH A;  2YC5 A;  3PMO A;  4Y7V A;  5CQN X;  5J49 A;  4JIS A;  1SSQ A;  4B2X A;  2OI6 A;  3SXD A;  4CJC A;  3U0X A;  1H5S A;  2PGV A;  3DHO A;  2AQ9 A;  1ZDF A;  4N69 A;  4FCE A;  5F42 A;  4L41 C;  1HM9 A;  4HG6 A;  1Z90 A;  4IHF A;  3ZGF A;  4C2S A;  4M28 A;  5HS2 A;  3I0L A;  2D7I A;  1V83 A;  2Q4J A;  2WLC A;  2RIJ A;  1ZI3 A;  1H7T A;  4G3P A;  1ZJ0 A;  4EA8 A;  3VBI A;  5C49 A;  2RJ7 A;  3EE5 A;  2XWL A;  5FU0 A;  3V8Y A;  1R7V A;  3VBM A;  4HOC A;  4B5B A;  1GA8 A;  1R82 A;  3OH1 A;  3SRT A;  1FO9 A;  2UX8 A;  3OGZ A;  5D92 A;  3SXE A;  5E3R A;  3VBN A;  3V0P A;  4G3S A;  5CQP A;  1GQC A;  3FSC A;  1LZ0 A;  5FTV A;  2V0L A;  4D11 A;  1ZHJ A;  1ZJ3 A;  2WGZ A;  3GOS A;  2RJ4 A;  5DEP A;  2YQH A;  5ADX U;  1O23 B;  4MYB A;  1QRG A;  1J2Z A;  2JCJ A;  4HO0 A;  4CJ8 A;  1PZT A;  1H7L A;  3ZGG A;  2JCL A;  3V8Z A;  4KPZ A;  1I52 A;  1JV3 A;  2O1H A;  1FXJ A;  5CMJ A;  3GUE A;  3U2V A;  2A8W A;  3R2W A;  2V0H A;  1IIM A;  3U2X A;  5C3B A;  2X5Z A;  3ST8 A;  4D0T A;  2O1G A;  3FS8 A;  2YQS A;  3KWE A;  1H7Q A;  1SST A;  5C4B A;  2X60 A;  1JVD A;  1E5K A;  1EYR A;  4K6R A;  4NAN A;  4KPX A;  1S4O A;  3BRK X;  3OU9 A;  4HO5 A;  4EGG A;  5E3Q A;  4HCQ A;  2XAT A;  2WLF A;  4B4B A;  4FQW A;  4Y6U A;  3U0Y A;  1ZCT A;  1OCX A;  3JTJ A;  2YCM A;  1H5T B;  4Y7T A;  3EH0 A;  1FGG A;  3D5N A;  5L6S A;  3USQ A;  4ASY A;  1FG5 N;  3SPT A;  4G3Q A;  3HL3 A;  4LW6 A;  3SX8 A;  2E3D A;  3Q4S A;  3K8D A;  3I3X A;  4ISX A;  3R1W A;  2VXM A;  3R3I A;  5CMF X;  2W0W A;  1H5R A;  2E8B A;  3VBK A;  5IFY A;  2D0J A;  4EE5 A;  3V90 A;  4KXO A;  4Y7U A;  2VXL A;  3OTZ A;  1NWG B;  4CVH A;  3BSW A;  5BXC A;  1WT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...