3DJ4A

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 161
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dj4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dj4A01
1MR9A 2AQ9A 3EH0A 5CMJA 3PNNA 2RJ6A 2PGYA 1KRUA 5ADXU 3OH3A 4B2XA 4Y63A 1YP4A 4E6UA 4N6AA 1VH3A 5U2KA 3D8VA 2WVKA 2WGZA 1VGTA 1ZI4A 4FREA 5C4BA 1QGSA 3RMVA 2JCKA 4J18A 4ZDQA 4FRMA 5JQQA 3CGXA 1QGQA 4Y6UA 4N69A 1S4PA 1VZXA 1THJA 4DE7A 2IC7A 3R3IA 3KWDA 1V84A 1WT2A 3FSXA 3SXAA 3K8EA 4LW3A 3E26A 3U2XA 5FU8A 1XATA 4CJBA 3TDTA 3FTTA 3SXCA 3IXCA 3CKQA 1XHDA 1SS9A 2P73A 2RIYA 3IOIA 4FRQA 5CMFX 3V8YA 3SXBA 5C1GA 2Y6PA 2X5ZA 5C4DA 4KNRA 3U0YA 4EAAA 4R37A 1QWJA 2FFVA 3BRKX 3NZ2A 1ZJ0A 2BO7A 2RIXA 1INIA 1G23A 2YC3A 2QH5A 1H7EA 3TK8A 2NPOA 2P2OA 1V82A 2WVMA 4Y6NA 3V4EA 4AC3A 3GOSA 1HV9A 4AYLA 3I0LA 4NANA 3USRA 2ZU8A 5C8RA 3HJJA 2JF3A 1PZTA 1Z90A 3OU9A 2RJ7A 5L6VA 3V0MA 3Q4SA 1H4DA 3TISA 2QKXA 5F42A 1H7FA 2APCA 2XWMA 1ZCUA 2RIZA 3GUEA 1G93A 1R80A 1VGZA 4KC2A 2TDTA 4NAKA 2BO8A 5C1LA 5E3QA 3U2UA 2E3DA 4D0TA 2ICXA 2XWLA 2PGVA 3DK5A 4M9CA 5E3RA 2WLDA 1ZI1A 3P1BA 3ZF8A 5CQPA 4EE5A 4AAWA 2JCLA 4Y7GA 1QRGA 4E1KA 1H7GA 4Y7TA 3HSQA 3USQA 1H5TB 2VD4A 3TV0A 1JYKA 1ON6A 1QQ0A 3ST8A 2YQHA 3CKOA 1H5TA 1NKHB 5CQLX 4Y7UA 1G8OA 5DEMA 2Y4MA 5C3BA 4KT7A 4B2WA 2RJ4A 3I0EA 1GA8A 1LL2A 2Z86A 3EE5A 3KWEA 2WE9A 1MP3A 5FTVA 3SXGA 4BQHA 1KQAA 2CU2A 3OTZA 1NWGB 3T7MA 1SSQA 1S80A 1H4EA 1ZCVA 4C2SA 2MZBA 1FWYA 3OGZA 4HO8A 4ASYA 4IHGA 2WLFA 2AM3A 3JQYA 2IU9A 1MP5A 1O7QA 1S4NA 2RJ0A 1VGWA 1FG5N 5EJ1A 1WT3A 1ZI5A 1G2VA 1H4CA 4IHFA 3FWWA 1MP4A 3SPTA 4EGGA 4M4KA 5CMIA 4B4BA 5C4CA 2WLEA 2O1GA 4JD0A 4HO2A 3TWDA 4HG6A 4K6RA 5DEPA 4KQLA 4P00A 3Q1XA 1NF5B 1KGTA 2V0JA 1H5SB 1R82A 2Y4KA 3D5NA 2VS3A 2AECA 2RITA 1J2ZA 4Y62A 1FGGA 4E75A 4M28A 1VGUA 5FUHA 3E25A 1TDTA 1H7QA 1QRLA 2RIJA 2GGOA 2W0VA 4M2BA 4FRDA 2W0WA 1W55A 4EA7A 1ZJ3A 3I0JA 3CKJA 4G87A 2VS5A 4KPXA 3JUJA 4ISXA 1GWWA 4IRPA 1G97A 5L6SA 1H5SD 1PZYB 4MYOA 4EABA 1GWVA 4HO9A 3OUPA 1R7TA 2XMEA 3R5AA 1LZIA 1INJA 2YCMA 4HUSA 5FYEA 1R81A 1IINA 1FZWA 1LVWA 2X60A 3FSBA 1FOAA 4ECMA 3OH4A 4B42A 1GX0A 2XMHA 2QIVX 4BMAA 1V83A 2Y4JA 3V0PA 1QREA 4B3UA 3CJ8A 5CMHA 2UX8A 1S4OA 3R0SA 4N27A 3BSYA 4UEGA 1ZJ1A 5C38A 4D0ZA 2OEFA 2VHEA 4FQWA 2ZU7A 3SX8A 4NAIA 2Q4JA 1GQCA 5C4FA 1O23B 5C3DA 2JF2A 2D0JA 3FS8A 4HCQA 5IFYA 3R1WA 1H7TA 1NQIB 2D7RA 1EZIA 2ICYA 2YQJA 4Y7VA 1H5SC 4FRPA 1OMZA 3D98A 1QG8A 4FRHA 3F1CA 4M98A 3N9WA 3SX7A 4EE4A 4KNXA 1FO9A 3FOQA 1LL3A 1KK5A 2WEEA 2VXLA 3P47A 4NALA 5DDVA 1SSTA 3BXYA 3ZGFA 5IDSA 4D48A 3OC9A 5CQNX 3POLA 1IIMA 2VXMA 3VBIA 1E5KA 1FRWA 3I0GA 4CJCA 3OW5A 5AJOA 1FR8A 4E6TA 3BFPA 1JV3A 2A8UA 4HO6A 2AM4A 1LZJA 3T7OA 2ZU9A 3OH2A 1ZDGA 3I3AA 5FV9A 4MZUA 2V0IA 4MYBA 2WAWA 4AYJA 3Q80A 1H3MA 1TW1A 3OH0A 4EVWA 1OMXA 3V0OA 3U2VA 1ZJOA 1TZFA 1JVGA 3I0FA 2FFUA 4G3SA 1H7HA 1O7OA 2VSHA 3EEVA 3VBPA 1KRVA 1JV1A 1KK4A 5J49A 4HOCA 2D7IA 5C1HA 1YP2A 1ZJPA 3KIAA 1T3DA 3V90A 2JCOA 1WVCA 1OCXA 3O3PA 5AFUV 2WLGA 4EE3A 3BSWA 4MNDA 3RMWA 4D11C 1R7XA 2QIAA 3GVDA 2FYDB 4E79A 5C47A 3DHOA 2NXVA 4IHHA 4ASJA 1HM8A 1VZUA 1NHEB 2Z87A 5FTSA 1VZTA 2I5EA 3PMOA 3OH1A 1ZCYA 4ARWA 5EIYA 1KK6A 3I3XA 1KGQA 3ZGGA 4M99A 5CQOA 4IRQA 1H5SA 4EA9A 3U0XA 4EEAA 3SX3A 1ZJ2A 2FY7A 1VM8A 2BO6A 2YC5A 2Y4LA 4FRBA 5ADXV 1XHBA 1LZ0A 1K4VA 3SRTA 1VH1A 1V67A 1WSZA 4GBPA 3I0DA 1KHRA 3VNPA 3ZLKA 3CKVA 3VBKA 1H5RB 4FROA 1ZDFA 2WLCA 3MQGA 3R3RA 4EA8A 1KWSA 1VICA 2BO4A 2AM5A 1TW5A 5C49A 4HO4A 1HJLA 1FXOA 1TVYA 3VBJA 2FYBA 4HZCA 1HM9A 2YQSA 1YP3A 1W77A 1MR7A 3CU0A 5C36A 4B4GA 4L41C 3R5DA 1EYRA 1H7LA 5C4EA 5CMGX 1G0RA 4DDZA 4DECA 2A8WA 3NGWA 2I7BA 5CQMX 2X65A 2VFZA 1NMMB 4YS8A 2RJ8A 3K8DA 1LZ7A 1WT0A 1VPAA 3QVBA 4JISA 4B5BA 2VS4A 5BXCA 4EEOA 2X5SA 1YROB 1ZHJA 3V0QA 4D11A 1ZI3A 1R7YA 1GX4A 4HO3A 1G1LA 4KC4A 4FCEA 3U2TA 2P6WA 3V8ZA 3FSYA 1JYLA 3C8VA 4Y64A 1G9RA 3SXEA 2OI6A 5AJNA 3BSSA 2PX7A 2OI5A 3OKRA 2VSIA 2FYCB 1I52A 1FO8A 4AA7A 1GQ9A 5E3PA 1SSMA 4H7OA 4EQYA 2AGDA 4HO0A 1MRLA 3I0IX 5I1FA 3VBNA 2IU8A 3MC4A 2RJ5A 2XATA 2AE7A 2AESA 2O1FA 2XWNA 1HJJA 3Q7UA 4CVHA 3TQDA 4XWIA 3KWCA 2FKOA 2FYAA 2P72A 3BCVA 4KXOA 3R8YA 4FCUA 3TZTA 4FRLA 3OTMA 3EG4A 3I0KA 5HS2A 5C48A 1FR9A 3I0CA 4HURA 4HO5A 3MQHA 2AH9A 4R7PA 1LL0A 2V0HA 5AJPA 2RJ9A 4Y7FA 2QGIA 1QRFA 1FXJA 3I0HA 3PKPA 4FRAA 3T7NA 2V0KA 2DPWA 4Y9XA 3DUVA 4G3PA 3V0NA 2YESA 2WVLA 2RJ1A 1HM0A 1XZ6A 1JVDA 1MC3A 2V0LA 4DCLA 4J09A 3SXDA 4EEGA 2JCJA 2E8BA 4P02A 4B4MA 1KRRA 2YQCA 5IDTA 2PA4A 2I5KA 1FGXA 3IGJA 3PKQA 3IOJA 4CJ8A 3F1XA 4MFGA 2O1HA 3LW6A 5FU0A 3R5BA 4KPZA 3JUKA 3VBMA 3JTJA 4R36A 3VBLA 3OAMA 4EEMA 5AFUU 4M2AA 1O0RA 2GGQA 5DG3A 1G95A 3FSCA 3T57A 3R2WA 3RSBA 4HZDA 3ECTA 1ZCTA 4KC1A 5DDTA 2OEGA 1ZIZA 5C3AA 5EJZA 1V3WA 3DJ4A 4LW6A 1R7VA 3U2WA 1WT1A 2IUAA 3TIOA 1QRMA 1LXAA 1ON8A 1OQMB 1H5RA 1R7UA 3V91A 3SX5A 4N6BA 4G3QA 3F1YA 4KRVA 3R5CA 1G3LA 1W57A 2OI7A 2Y7AA 3CKNA 3HL3A 3IOHA 3V0LA 3ZLLA
chains in the Genus database with same CATH superfamily
1MR9A 2AQ9A 3EH0A 5CMJA 3PNNA 2RJ6A 2PGYA 1KRUA 5ADXU 3OH3A 4B2XA 4Y63A 1YP4A 4E6UA 4N6AA 1VH3A 5U2KA 3D8VA 2WVKA 2WGZA 1VGTA 1ZI4A 4FREA 5C4BA 1QGSA 3RMVA 2JCKA 4O6NA 4J18A 4ZDQA 4FRMA 5JQQA 3CGXA 1QGQA 4Y6UA 4N69A 1S4PA 1VZXA 1THJA 4DE7A 2IC7A 3R3IA 3GQ9A 3KWDA 1V84A 1WT2A 3FSXA 3SXAA 3K8EA 4LW3A 3E26A 3U2XA 5FU8A 1XATA 4CJBA 3TDTA 3FTTA 3SXCA 3IXCA 3CKQA 1XHDA 1SS9A 2P73A 2RIYA 3IOIA 4FRQA 5CMFX 3V8YA 3SXBA 5C1GA 2Y6PA 2X5ZA 5C4DA 4KNRA 3U0YA 4EAAA 4R37A 1QWJA 3GQAA 2FFVA 1EWWA 3BRKX 3NZ2A 1ZJ0A 2BO7A 2RIXA 1INIA 1G23A 2YC3A 2QH5A 1H7EA 3TK8A 2NPOA 2P2OA 3GQ7A 1V82A 2WVMA 5D92A 4Y6NA 3V4EA 4AC3A 3GOSA 1HV9A 4AYLA 3I0LA 4NANA 3USRA 2ZU8A 5C8RA 3HJJA 2JF3A 1PZTA 1Z90A 3OU9A 2RJ7A 5L6VA 3V0MA 3Q4SA 1H4DA 3TISA 2QKXA 5F42A 1H7FA 2APCA 2XWMA 1ZCUA 2RIZA 3GUEA 1G93A 1R80A 1VGZA 4KC2A 2TDTA 4NAKA 2BO8A 5C1LA 5E3QA 3U2UA 2E3DA 4D0TA 2ICXA 2XWLA 2PGVA 3DK5A 4M9CA 2C0NA 5E3RA 2WLDA 1ZI1A 4MIXA 3P1BA 3ZF8A 5CQPA 4EE5A 4AAWA 2JCLA 4Y7GA 1QRGA 4E1KA 1H7GA 4Y7TA 3HSQA 3USQA 1N4IA 1H5TB 2VD4A 3TV0A 1JYKA 1ON6A 1QQ0A 3ST8A 2YQHA 3CKOA 1H5TA 1NKHB 5CQLX 4Y7UA 1G8OA 5DEMA 2Y4MA 5C3BA 4KT7A 4B2WA 4FIYA 2RJ4A 3I0EA 1GA8A 1LL2A 2Z86A 3EE5A 3KWEA 2WE9A 1MP3A 5FTVA 3SXGA 4BQHA 1KQAA 2CU2A 3OTZA 1NWGB 3T7MA 1SSQA 1S80A 1H4EA 1ZCVA 4C2SA 2MZBA 1FWYA 3OGZA 4HO8A 1M8NA 4ASYA 4IHGA 2WLFA 2AM3A 3JQYA 2IU9A 1MP5A 1O7QA 1S4NA 2RJ0A 1VGWA 1FG5N 5EJ1A 1WT3A 1ZI5A 1G2VA 1H4CA 4IHFA 3FWWA 1MP4A 3SPTA 4EGGA 4M4KA 5CMIA 4B4BA 5C4CA 2WLEA 2O1GA 4JD0A 4HO2A 3TWDA 4HG6A 4K6RA 5DEPA 4KQLA 4P00A 3Q1XA 1NF5B 1KGTA 2V0JA 1H5SB 1R82A 2Y4KA 3D5NA 2VS3A 2AECA 2RITA 1J2ZA 4Y62A 1FGGA 4E75A 4M28A 1VGUA 5FUHA 3E25A 1TDTA 1H7QA 1QRLA 2RIJA 2GGOA 2W0VA 4M2BA 4FRDA 2W0WA 1W55A 4EA7A 1ZJ3A 3I0JA 3CKJA 4G87A 2VS5A 4KPXA 3JUJA 4ISXA 1GWWA 4IRPA 1G97A 5L6SA 1H5SD 1PZYB 4MYOA 4EABA 1GWVA 4HO9A 3OUPA 1R7TA 2XMEA 3R5AA 1LZIA 1INJA 2YCMA 4HUSA 5FYEA 1R81A 1IINA 1FZWA 1LVWA 2X60A 3FSBA 1FOAA 4ECMA 3OH4A 4B42A 1GX0A 2XMHA 2QIVX 4BMAA 1V83A 2Y4JA 3V0PA 1QREA 4B3UA 3CJ8A 5CMHA 2UX8A 1S4OA 3R0SA 4N27A 3BSYA 4UEGA 1ZJ1A 5C38A 4D0ZA 2OEFA 2VHEA 4FQWA 2ZU7A 3SX8A 4NAIA 2Q4JA 1GQCA 5C4FA 1O23B 5C3DA 2JF2A 2D0JA 3FS8A 4HCQA 5IFYA 3R1WA 1H7TA 1NQIB 2D7RA 1EZIA 2ICYA 2YQJA 4Y7VA 1H5SC 4FRPA 1OMZA 3D98A 1QG8A 4FRHA 3F1CA 4M98A 3N9WA 3SX7A 4EE4A 4KNXA 1L0SA 1FO9A 3FOQA 1LL3A 1KK5A 2WEEA 2VXLA 3P47A 4NALA 5DDVA 1SSTA 3BXYA 3ZGFA 5IDSA 4D48A 3OC9A 5CQNX 3POLA 1IIMA 2VXMA 3VBIA 1E5KA 1FRWA 3I0GA 4CJCA 3OW5A 5AJOA 1FR8A 4E6TA 3BFPA 1JV3A 2A8UA 4HO6A 2AM4A 1LZJA 3T7OA 2ZU9A 3OH2A 1ZDGA 3I3AA 5FV9A 4MZUA 2V0IA 4MYBA 2WAWA 4AYJA 3Q80A 1H3MA 1TW1A 3OH0A 4EVWA 1OMXA 3V0OA 3U2VA 1ZJOA 1TZFA 1JVGA 3I0FA 4FIXA 2FFUA 4G3SA 1H7HA 1O7OA 2VSHA 3EEVA 3VBPA 1KRVA 1JV1A 1KK4A 5J49A 4HOCA 2D7IA 5C1HA 1YP2A 1ZJPA 3KIAA 1T3DA 3V90A 2JCOA 1WVCA 1OCXA 3O3PA 5AFUV 2WLGA 4EE3A 3BSWA 4MNDA 3RMWA 4D11C 1R7XA 2QIAA 3GVDA 2FYDB 4E79A 5C47A 3DHOA 1Z2FA 2NXVA 4IHHA 4ASJA 1HM8A 1VZUA 1NHEB 2Z87A 5FTSA 1VZTA 2I5EA 3PMOA 3OH1A 1ZCYA 4ARWA 5EIYA 1KK6A 3I3XA 1KGQA 3ZGGA 4M99A 5CQOA 4IRQA 1H5SA 4EA9A 3U0XA 4EEAA 3SX3A 1ZJ2A 2FY7A 1VM8A 2BO6A 2YC5A 2Y4LA 4FRBA 5ADXV 1XHBA 1LZ0A 1K4VA 2J0BA 4O6MA 3SRTA 1VH1A 1V67A 1WSZA 4GBPA 3I0DA 1KHRA 3VNPA 3ZLKA 3CKVA 3VBKA 1H5RB 4FROA 1ZDFA 2WLCA 3MQGA 3R3RA 4EA8A 1KWSA 1VICA 2BO4A 2AM5A 1TW5A 5C49A 4HO4A 1HJLA 1FXOA 3SUCA 1TVYA 3VBJA 2FYBA 4HZCA 1HM9A 2YQSA 1YP3A 1W77A 1MR7A 3CU0A 5C36A 4B4GA 4L41C 3R5DA 1EYRA 1H7LA 5C4EA 5CMGX 1G0RA 4DDZA 4DECA 2A8WA 3NGWA 2I7BA 5CQMX 2X65A 2VFZA 4Q7CA 1NMMB 4YS8A 2RJ8A 3K8DA 1LZ7A 1WT0A 1VPAA 3QVBA 4JISA 4B5BA 2VS4A 5BXCA 4EEOA 2X5SA 1YROB 1ZHJA 3V0QA 4D11A 1ZI3A 1R7YA 1GX4A 3GQ8A 4HO3A 5D91A 1G1LA 4KC4A 4FCEA 3U2TA 2P6WA 3V8ZA 3FSYA 1JYLA 3C8VA 4Y64A 1G9RA 3SXEA 2OI6A 5AJNA 3BSSA 2PX7A 2OI5A 3OKRA 2VSIA 2FYCB 1I52A 1FO8A 4AA7A 1GQ9A 5E3PA 1SSMA 4H7OA 4EQYA 2AGDA 4HO0A 1MRLA 3I0IX 5I1FA 3VBNA 2IU8A 3MC4A 2RJ5A 2XATA 2AE7A 2AESA 2O1FA 2XWNA 1HJJA 3Q7UA 4CVHA 3TQDA 4XWIA 3KWCA 2FKOA 2FYAA 2P72A 3BCVA 4KXOA 3R8YA 4FCUA 3TZTA 4FRLA 3OTMA 3EG4A 3I0KA 5HS2A 2J0AA 5C48A 1FR9A 3I0CA 4HURA 4HO5A 3MQHA 2AH9A 4R7PA 1LL0A 2V0HA 5AJPA 2RJ9A 4Y7FA 2QGIA 1QRFA 1FXJA 3I0HA 3PKPA 4FRAA 3T7NA 2V0KA 2DPWA 4Y9XA 3DUVA 4G3PA 2VK9A 3V0NA 2YESA 2WVLA 2RJ1A 1HM0A 1XZ6A 1JVDA 1MC3A 2V0LA 4DCLA 4J09A 3SXDA 4EEGA 2JCJA 2E8BA 4P02A 4B4MA 1KRRA 2YQCA 5IDTA 2PA4A 2I5KA 1FGXA 3IGJA 3PKQA 3IOJA 4CJ8A 3F1XA 4MFGA 2O1HA 3LW6A 5FU0A 3R5BA 4KPZA 3JUKA 3VBMA 3JTJA 4R36A 3VBLA 3OAMA 4EEMA 5AFUU 4M2AA 1O0RA 2GGQA 5DG3A 1G95A 3FSCA 3T57A 3R2WA 3RSBA 4HZDA 3ECTA 1ZCTA 4KC1A 5DDTA 2OEGA 1ZIZA 5C3AA 5EJZA 1V3WA 3DJ4A 4LW6A 1R7VA 3U2WA 1WT1A 2IUAA 3TIOA 1QRMA 1LXAA 1ON8A 1OQMB 1H5RA 1R7UA 3V91A 3SX5A 4N6BA 4G3QA 3F1YA 4KRVA 3R5CA 1G3LA 1W57A 2OI7A 2Y7AA 3CKNA 3HL3A 3IOHA 3V0LA 3ZLLA
chains in the Genus database with same CATH topology
1MR9A 2AQ9A 3EH0A 5CMJA 3PNNA 2RJ6A 2PGYA 1KRUA 5ADXU 3OH3A 4B2XA 4Y63A 1YP4A 4E6UA 4N6AA 1VH3A 5U2KA 3D8VA 2WVKA 2WGZA 1VGTA 1ZI4A 4FREA 5C4BA 1QGSA 3RMVA 2JCKA 4O6NA 4J18A 4ZDQA 4FRMA 5JQQA 3CGXA 1QGQA 4Y6UA 4N69A 1S4PA 1VZXA 1THJA 4DE7A 2IC7A 3R3IA 3KWDA 1V84A 1WT2A 3FSXA 3SXAA 3K8EA 4LW3A 3E26A 3U2XA 5FU8A 1XATA 4CJBA 3TDTA 3FTTA 3SXCA 3IXCA 3CKQA 1XHDA 1SS9A 2P73A 2RIYA 3IOIA 4FRQA 5CMFX 3V8YA 3SXBA 5C1GA 2Y6PA 2X5ZA 5C4DA 4KNRA 3U0YA 4EAAA 4R37A 1QWJA 2FFVA 3BRKX 3NZ2A 1ZJ0A 2BO7A 2RIXA 1INIA 1G23A 2YC3A 2QH5A 1H7EA 3TK8A 2NPOA 2P2OA 1V82A 2WVMA 5D92A 4Y6NA 3V4EA 4AC3A 3GOSA 1HV9A 4AYLA 3I0LA 4NANA 3USRA 2ZU8A 5C8RA 3HJJA 2JF3A 1PZTA 1Z90A 3OU9A 2RJ7A 5L6VA 3V0MA 3Q4SA 1H4DA 3TISA 2QKXA 5F42A 1H7FA 2APCA 2XWMA 1ZCUA 2RIZA 3GUEA 1G93A 1R80A 1VGZA 4KC2A 2TDTA 4NAKA 2BO8A 5C1LA 5E3QA 3U2UA 2E3DA 4D0TA 2ICXA 2XWLA 2PGVA 3DK5A 4M9CA 2C0NA 5E3RA 2WLDA 1ZI1A 4MIXA 3P1BA 3ZF8A 5CQPA 4EE5A 4AAWA 2JCLA 4Y7GA 1QRGA 4E1KA 1H7GA 4Y7TA 3HSQA 3USQA 1H5TB 2VD4A 3TV0A 1JYKA 1ON6A 1QQ0A 3ST8A 2YQHA 3CKOA 1H5TA 1NKHB 5CQLX 4Y7UA 1G8OA 5DEMA 2Y4MA 5C3BA 4KT7A 4B2WA 4FIYA 2RJ4A 3I0EA 1GA8A 1LL2A 2Z86A 3EE5A 3KWEA 2WE9A 1MP3A 5FTVA 3SXGA 4BQHA 1KQAA 2CU2A 3OTZA 1NWGB 3T7MA 1SSQA 1S80A 1H4EA 1ZCVA 4C2SA 2MZBA 1FWYA 3OGZA 4HO8A 4ASYA 4IHGA 2WLFA 2AM3A 3JQYA 2IU9A 1MP5A 1O7QA 1S4NA 2RJ0A 1VGWA 1FG5N 5EJ1A 1WT3A 1ZI5A 1G2VA 1H4CA 4IHFA 3FWWA 1MP4A 3SPTA 4EGGA 4M4KA 5CMIA 4B4BA 5C4CA 2WLEA 2O1GA 4JD0A 4HO2A 3TWDA 4HG6A 4K6RA 5DEPA 4KQLA 4P00A 3Q1XA 1NF5B 1KGTA 2V0JA 1H5SB 1R82A 2Y4KA 3D5NA 2VS3A 2AECA 2RITA 1J2ZA 4Y62A 1FGGA 4E75A 4M28A 1VGUA 5FUHA 3E25A 1TDTA 1H7QA 1QRLA 2RIJA 2GGOA 2W0VA 4M2BA 4FRDA 2W0WA 1W55A 4EA7A 1ZJ3A 3I0JA 3CKJA 4G87A 2VS5A 4KPXA 3JUJA 4ISXA 1GWWA 4IRPA 1G97A 5L6SA 1H5SD 1PZYB 4MYOA 4EABA 1GWVA 4HO9A 3OUPA 1R7TA 2XMEA 3R5AA 1LZIA 1INJA 2YCMA 4HUSA 5FYEA 1R81A 1IINA 1FZWA 1LVWA 2X60A 3FSBA 1FOAA 4ECMA 3OH4A 4B42A 1GX0A 2XMHA 2QIVX 4BMAA 1V83A 2Y4JA 3V0PA 1QREA 4B3UA 3CJ8A 5CMHA 2UX8A 1S4OA 3R0SA 4N27A 3BSYA 4UEGA 1ZJ1A 5C38A 4D0ZA 2OEFA 2VHEA 4FQWA 2ZU7A 3SX8A 4NAIA 2Q4JA 1GQCA 5C4FA 1O23B 5C3DA 2JF2A 2D0JA 3FS8A 4HCQA 5IFYA 3R1WA 1H7TA 1NQIB 2D7RA 1EZIA 2ICYA 2YQJA 4Y7VA 1H5SC 4FRPA 1OMZA 3D98A 1QG8A 4FRHA 3F1CA 4M98A 3N9WA 3SX7A 4EE4A 4KNXA 1FO9A 3FOQA 1LL3A 1KK5A 2WEEA 2VXLA 3P47A 4NALA 5DDVA 1SSTA 3BXYA 3ZGFA 5IDSA 4D48A 3OC9A 5CQNX 3POLA 1IIMA 2VXMA 3VBIA 1E5KA 1FRWA 3I0GA 4CJCA 3OW5A 5AJOA 1FR8A 4E6TA 3BFPA 1JV3A 2A8UA 4HO6A 2AM4A 1LZJA 3T7OA 2ZU9A 3OH2A 1ZDGA 3I3AA 5FV9A 4MZUA 2V0IA 4MYBA 2WAWA 4AYJA 3Q80A 1H3MA 1TW1A 3OH0A 4EVWA 1OMXA 3V0OA 3U2VA 1ZJOA 1TZFA 1JVGA 3I0FA 4FIXA 2FFUA 4G3SA 1H7HA 1O7OA 2VSHA 3EEVA 3VBPA 1KRVA 1JV1A 1KK4A 5J49A 4HOCA 2D7IA 5C1HA 1YP2A 1ZJPA 3KIAA 1T3DA 3V90A 2JCOA 1WVCA 1OCXA 3O3PA 5AFUV 2WLGA 4EE3A 3BSWA 4MNDA 3RMWA 4D11C 1R7XA 2QIAA 3GVDA 2FYDB 4E79A 5C47A 3DHOA 2NXVA 4IHHA 4ASJA 1HM8A 1VZUA 1NHEB 2Z87A 5FTSA 1VZTA 2I5EA 3PMOA 3OH1A 1ZCYA 4ARWA 5EIYA 1KK6A 3I3XA 1KGQA 3ZGGA 4M99A 5CQOA 4IRQA 1H5SA 4EA9A 3U0XA 4EEAA 3SX3A 1ZJ2A 2FY7A 1VM8A 2BO6A 2YC5A 2Y4LA 4FRBA 5ADXV 1XHBA 1LZ0A 1K4VA 2J0BA 4O6MA 3SRTA 1VH1A 1V67A 1WSZA 4GBPA 3I0DA 1KHRA 3VNPA 3ZLKA 3CKVA 3VBKA 1H5RB 4FROA 1ZDFA 2WLCA 3MQGA 3R3RA 4EA8A 1KWSA 1VICA 2BO4A 2AM5A 1TW5A 5C49A 4HO4A 1HJLA 1FXOA 1TVYA 3VBJA 2FYBA 4HZCA 1HM9A 2YQSA 1YP3A 1W77A 1MR7A 3CU0A 5C36A 4B4GA 4L41C 3R5DA 1EYRA 1H7LA 5C4EA 5CMGX 1G0RA 4DDZA 4DECA 2A8WA 3NGWA 2I7BA 5CQMX 2X65A 2VFZA 4Q7CA 1NMMB 4YS8A 2RJ8A 3K8DA 1LZ7A 1WT0A 1VPAA 3QVBA 4JISA 4B5BA 2VS4A 5BXCA 4EEOA 2X5SA 1YROB 1ZHJA 3V0QA 4D11A 1ZI3A 1R7YA 1GX4A 4HO3A 5D91A 1G1LA 4KC4A 4FCEA 3U2TA 2P6WA 3V8ZA 3FSYA 1JYLA 3C8VA 4Y64A 1G9RA 3SXEA 2OI6A 5AJNA 3BSSA 2PX7A 2OI5A 3OKRA 2VSIA 2FYCB 1I52A 1FO8A 4AA7A 1GQ9A 5E3PA 1SSMA 4H7OA 4EQYA 2AGDA 4HO0A 1MRLA 3I0IX 5I1FA 3VBNA 2IU8A 3MC4A 2RJ5A 2XATA 2AE7A 2AESA 2O1FA 2XWNA 1HJJA 3Q7UA 4CVHA 3TQDA 4XWIA 3KWCA 2FKOA 2FYAA 2P72A 3BCVA 4KXOA 3R8YA 4FCUA 3TZTA 4FRLA 3OTMA 3EG4A 3I0KA 5HS2A 2J0AA 5C48A 1FR9A 3I0CA 4HURA 4HO5A 3MQHA 2AH9A 4R7PA 1LL0A 2V0HA 5AJPA 2RJ9A 4Y7FA 2QGIA 1QRFA 1FXJA 3I0HA 3PKPA 4FRAA 3T7NA 2V0KA 2DPWA 4Y9XA 3DUVA 4G3PA 2VK9A 3V0NA 2YESA 2WVLA 2RJ1A 1HM0A 1XZ6A 1JVDA 1MC3A 2V0LA 4DCLA 4J09A 3SXDA 4EEGA 2JCJA 2E8BA 4P02A 4B4MA 1KRRA 2YQCA 5IDTA 2PA4A 2I5KA 1FGXA 3IGJA 3PKQA 3IOJA 4CJ8A 3F1XA 4MFGA 2O1HA 3LW6A 5FU0A 3R5BA 4KPZA 3JUKA 3VBMA 3JTJA 4R36A 3VBLA 3OAMA 4EEMA 5AFUU 4M2AA 1O0RA 2GGQA 5DG3A 1G95A 3FSCA 3T57A 3R2WA 3RSBA 4HZDA 3ECTA 1ZCTA 4KC1A 5DDTA 2OEGA 1ZIZA 5C3AA 5EJZA 1V3WA 3DJ4A 4LW6A 1R7VA 3U2WA 1WT1A 2IUAA 3TIOA 1QRMA 1LXAA 1ON8A 1OQMB 1H5RA 1R7UA 3V91A 3SX5A 4N6BA 4G3QA 3F1YA 4KRVA 3R5CA 1G3LA 1W57A 2OI7A 2Y7AA 3CKNA 3HL3A 3IOHA 3V0LA 3ZLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR9 A;  2AQ9 A;  3EH0 A;  5CMJ A;  3PNN A;  2RJ6 A;  2PGY A;  1KRU A;  5ADX U;  3OH3 A;  4B2X A;  4Y63 A;  1YP4 A;  4E6U A;  4N6A A;  1VH3 A;  5U2K A;  3D8V A;  2WVK A;  2WGZ A;  1VGT A;  1ZI4 A;  4FRE A;  5C4B A;  1QGS A;  3RMV A;  2JCK A;  4J18 A;  4ZDQ A;  4FRM A;  5JQQ A;  3CGX A;  1QGQ A;  4Y6U A;  4N69 A;  1S4P A;  1VZX A;  1THJ A;  4DE7 A;  2IC7 A;  3R3I A;  3KWD A;  1V84 A;  1WT2 A;  3FSX A;  3SXA A;  3K8E A;  4LW3 A;  3E26 A;  3U2X A;  5FU8 A;  1XAT A;  4CJB A;  3TDT A;  3FTT A;  3SXC A;  3IXC A;  3CKQ A;  1XHD A;  1SS9 A;  2P73 A;  2RIY A;  3IOI A;  4FRQ A;  5CMF X;  3V8Y A;  3SXB A;  5C1G A;  2Y6P A;  2X5Z A;  5C4D A;  4KNR A;  3U0Y A;  4EAA A;  4R37 A;  1QWJ A;  2FFV A;  3BRK X;  3NZ2 A;  1ZJ0 A;  2BO7 A;  2RIX A;  1INI A;  1G23 A;  2YC3 A;  2QH5 A;  1H7E A;  3TK8 A;  2NPO A;  2P2O A;  1V82 A;  2WVM A;  4Y6N A;  3V4E A;  4AC3 A;  3GOS A;  1HV9 A;  4AYL A;  3I0L A;  4NAN A;  3USR A;  2ZU8 A;  5C8R A;  3HJJ A;  2JF3 A;  1PZT A;  1Z90 A;  3OU9 A;  2RJ7 A;  5L6V A;  3V0M A;  3Q4S A;  1H4D A;  3TIS A;  2QKX A;  5F42 A;  1H7F A;  2APC A;  2XWM A;  1ZCU A;  2RIZ A;  3GUE A;  1G93 A;  1R80 A;  1VGZ A;  4KC2 A;  2TDT A;  4NAK A;  2BO8 A;  5C1L A;  5E3Q A;  3U2U A;  2E3D A;  4D0T A;  2ICX A;  2XWL A;  2PGV A;  3DK5 A;  4M9C A;  5E3R A;  2WLD A;  1ZI1 A;  3P1B A;  3ZF8 A;  5CQP A;  4EE5 A;  4AAW A;  2JCL A;  4Y7G A;  1QRG A;  4E1K A;  1H7G A;  4Y7T A;  3HSQ A;  3USQ A;  1H5T B;  2VD4 A;  3TV0 A;  1JYK A;  1ON6 A;  1QQ0 A;  3ST8 A;  2YQH A;  3CKO A;  1H5T A;  1NKH B;  5CQL X;  4Y7U A;  1G8O A;  5DEM A;  2Y4M A;  5C3B A;  4KT7 A;  4B2W A;  2RJ4 A;  3I0E A;  1GA8 A;  1LL2 A;  2Z86 A;  3EE5 A;  3KWE A;  2WE9 A;  1MP3 A;  5FTV A;  3SXG A;  4BQH A;  1KQA A;  2CU2 A;  3OTZ A;  1NWG B;  3T7M A;  1SSQ A;  1S80 A;  1H4E A;  1ZCV A;  4C2S A;  2MZB A;  1FWY A;  3OGZ A;  4HO8 A;  4ASY A;  4IHG A;  2WLF A;  2AM3 A;  3JQY A;  2IU9 A;  1MP5 A;  1O7Q A;  1S4N A;  2RJ0 A;  1VGW A;  1FG5 N;  5EJ1 A;  1WT3 A;  1ZI5 A;  1G2V A;  1H4C A;  4IHF A;  3FWW A;  1MP4 A;  3SPT A;  4EGG A;  4M4K A;  5CMI A;  4B4B A;  5C4C A;  2WLE A;  2O1G A;  4JD0 A;  4HO2 A;  3TWD A;  4HG6 A;  4K6R A;  5DEP A;  4KQL A;  4P00 A;  3Q1X A;  1NF5 B;  1KGT A;  2V0J A;  1H5S B;  1R82 A;  2Y4K A;  3D5N A;  2VS3 A;  2AEC A;  2RIT A;  1J2Z A;  4Y62 A;  1FGG A;  4E75 A;  4M28 A;  1VGU A;  5FUH A;  3E25 A;  1TDT A;  1H7Q A;  1QRL A;  2RIJ A;  2GGO A;  2W0V A;  4M2B A;  4FRD A;  2W0W A;  1W55 A;  4EA7 A;  1ZJ3 A;  3I0J A;  3CKJ A;  4G87 A;  2VS5 A;  4KPX A;  3JUJ A;  4ISX A;  1GWW A;  4IRP A;  1G97 A;  5L6S A;  1H5S D;  1PZY B;  4MYO A;  4EAB A;  1GWV A;  4HO9 A;  3OUP A;  1R7T A;  2XME A;  3R5A A;  1LZI A;  1INJ A;  2YCM A;  4HUS A;  5FYE A;  1R81 A;  1IIN A;  1FZW A;  1LVW A;  2X60 A;  3FSB A;  1FOA A;  4ECM A;  3OH4 A;  4B42 A;  1GX0 A;  2XMH A;  2QIV X;  4BMA A;  1V83 A;  2Y4J A;  3V0P A;  1QRE A;  4B3U A;  3CJ8 A;  5CMH A;  2UX8 A;  1S4O A;  3R0S A;  4N27 A;  3BSY A;  4UEG A;  1ZJ1 A;  5C38 A;  4D0Z A;  2OEF A;  2VHE A;  4FQW A;  2ZU7 A;  3SX8 A;  4NAI A;  2Q4J A;  1GQC A;  5C4F A;  1O23 B;  5C3D A;  2JF2 A;  2D0J A;  3FS8 A;  4HCQ A;  5IFY A;  3R1W A;  1H7T A;  1NQI B;  2D7R A;  1EZI A;  2ICY A;  2YQJ A;  4Y7V A;  1H5S C;  4FRP A;  1OMZ A;  3D98 A;  1QG8 A;  4FRH A;  3F1C A;  4M98 A;  3N9W A;  3SX7 A;  4EE4 A;  4KNX A;  1FO9 A;  3FOQ A;  1LL3 A;  1KK5 A;  2WEE A;  2VXL A;  3P47 A;  4NAL A;  5DDV A;  1SST A;  3BXY A;  3ZGF A;  5IDS A;  4D48 A;  3OC9 A;  5CQN X;  3POL A;  1IIM A;  2VXM A;  3VBI A;  1E5K A;  1FRW A;  3I0G A;  4CJC A;  3OW5 A;  5AJO A;  1FR8 A;  4E6T A;  3BFP A;  1JV3 A;  2A8U A;  4HO6 A;  2AM4 A;  1LZJ A;  3T7O A;  2ZU9 A;  3OH2 A;  1ZDG A;  3I3A A;  5FV9 A;  4MZU A;  2V0I A;  4MYB A;  2WAW A;  4AYJ A;  3Q80 A;  1H3M A;  1TW1 A;  3OH0 A;  4EVW A;  1OMX A;  3V0O A;  3U2V A;  1ZJO A;  1TZF A;  1JVG A;  3I0F A;  2FFU A;  4G3S A;  1H7H A;  1O7O A;  2VSH A;  3EEV A;  3VBP A;  1KRV A;  1JV1 A;  1KK4 A;  5J49 A;  4HOC A;  2D7I A;  5C1H A;  1YP2 A;  1ZJP A;  3KIA A;  1T3D A;  3V90 A;  2JCO A;  1WVC A;  1OCX A;  3O3P A;  5AFU V;  2WLG A;  4EE3 A;  3BSW A;  4MND A;  3RMW A;  4D11 C;  1R7X A;  2QIA A;  3GVD A;  2FYD B;  4E79 A;  5C47 A;  3DHO A;  2NXV A;  4IHH A;  4ASJ A;  1HM8 A;  1VZU A;  1NHE B;  2Z87 A;  5FTS A;  1VZT A;  2I5E A;  3PMO A;  3OH1 A;  1ZCY A;  4ARW A;  5EIY A;  1KK6 A;  3I3X A;  1KGQ A;  3ZGG A;  4M99 A;  5CQO A;  4IRQ A;  1H5S A;  4EA9 A;  3U0X A;  4EEA A;  3SX3 A;  1ZJ2 A;  2FY7 A;  1VM8 A;  2BO6 A;  2YC5 A;  2Y4L A;  4FRB A;  5ADX V;  1XHB A;  1LZ0 A;  1K4V A;  3SRT A;  1VH1 A;  1V67 A;  1WSZ A;  4GBP A;  3I0D A;  1KHR A;  3VNP A;  3ZLK A;  3CKV A;  3VBK A;  1H5R B;  4FRO A;  1ZDF A;  2WLC A;  3MQG A;  3R3R A;  4EA8 A;  1KWS A;  1VIC A;  2BO4 A;  2AM5 A;  1TW5 A;  5C49 A;  4HO4 A;  1HJL A;  1FXO A;  1TVY A;  3VBJ A;  2FYB A;  4HZC A;  1HM9 A;  2YQS A;  1YP3 A;  1W77 A;  1MR7 A;  3CU0 A;  5C36 A;  4B4G A;  4L41 C;  3R5D A;  1EYR A;  1H7L A;  5C4E A;  5CMG X;  1G0R A;  4DDZ A;  4DEC A;  2A8W A;  3NGW A;  2I7B A;  5CQM X;  2X65 A;  2VFZ A;  1NMM B;  4YS8 A;  2RJ8 A;  3K8D A;  1LZ7 A;  1WT0 A;  1VPA A;  3QVB A;  4JIS A;  4B5B A;  2VS4 A;  5BXC A;  4EEO A;  2X5S A;  1YRO B;  1ZHJ A;  3V0Q A;  4D11 A;  1ZI3 A;  1R7Y A;  1GX4 A;  4HO3 A;  1G1L A;  4KC4 A;  4FCE A;  3U2T A;  2P6W A;  3V8Z A;  3FSY A;  1JYL A;  3C8V A;  4Y64 A;  1G9R A;  3SXE A;  2OI6 A;  5AJN A;  3BSS A;  2PX7 A;  2OI5 A;  3OKR A;  2VSI A;  2FYC B;  1I52 A;  1FO8 A;  4AA7 A;  1GQ9 A;  5E3P A;  1SSM A;  4H7O A;  4EQY A;  2AGD A;  4HO0 A;  1MRL A;  3I0I X;  5I1F A;  3VBN A;  2IU8 A;  3MC4 A;  2RJ5 A;  2XAT A;  2AE7 A;  2AES A;  2O1F A;  2XWN A;  1HJJ A;  3Q7U A;  4CVH A;  3TQD A;  4XWI A;  3KWC A;  2FKO A;  2FYA A;  2P72 A;  3BCV A;  4KXO A;  3R8Y A;  4FCU A;  3TZT A;  4FRL A;  3OTM A;  3EG4 A;  3I0K A;  5HS2 A;  5C48 A;  1FR9 A;  3I0C A;  4HUR A;  4HO5 A;  3MQH A;  2AH9 A;  4R7P A;  1LL0 A;  2V0H A;  5AJP A;  2RJ9 A;  4Y7F A;  2QGI A;  1QRF A;  1FXJ A;  3I0H A;  3PKP A;  4FRA A;  3T7N A;  2V0K A;  2DPW A;  4Y9X A;  3DUV A;  4G3P A;  3V0N A;  2YES A;  2WVL A;  2RJ1 A;  1HM0 A;  1XZ6 A;  1JVD A;  1MC3 A;  2V0L A;  4DCL A;  4J09 A;  3SXD A;  4EEG A;  2JCJ A;  2E8B A;  4P02 A;  4B4M A;  1KRR A;  2YQC A;  5IDT A;  2PA4 A;  2I5K A;  1FGX A;  3IGJ A;  3PKQ A;  3IOJ A;  4CJ8 A;  3F1X A;  4MFG A;  2O1H A;  3LW6 A;  5FU0 A;  3R5B A;  4KPZ A;  3JUK A;  3VBM A;  3JTJ A;  4R36 A;  3VBL A;  3OAM A;  4EEM A;  5AFU U;  4M2A A;  1O0R A;  2GGQ A;  5DG3 A;  1G95 A;  3FSC A;  3T57 A;  3R2W A;  3RSB A;  4HZD A;  3ECT A;  1ZCT A;  4KC1 A;  5DDT A;  2OEG A;  1ZIZ A;  5C3A A;  5EJZ A;  1V3W A;  3DJ4 A;  4LW6 A;  1R7V A;  3U2W A;  1WT1 A;  2IUA A;  3TIO A;  1QRM A;  1LXA A;  1ON8 A;  1OQM B;  1H5R A;  1R7U A;  3V91 A;  3SX5 A;  4N6B A;  4G3Q A;  3F1Y A;  4KRV A;  3R5C A;  1G3L A;  1W57 A;  2OI7 A;  2Y7A A;  3CKN A;  3HL3 A;  3IOH A;  3V0L A;  3ZLL A; 
#chains in the Genus database with same CATH topology
 1MR9 A;  2AQ9 A;  3EH0 A;  5CMJ A;  3PNN A;  2RJ6 A;  2PGY A;  1KRU A;  5ADX U;  3OH3 A;  4B2X A;  4Y63 A;  1YP4 A;  4E6U A;  4N6A A;  1VH3 A;  5U2K A;  3D8V A;  2WVK A;  2WGZ A;  1VGT A;  1ZI4 A;  4FRE A;  5C4B A;  1QGS A;  3RMV A;  2JCK A;  4O6N A;  4J18 A;  4ZDQ A;  4FRM A;  5JQQ A;  3CGX A;  1QGQ A;  4Y6U A;  4N69 A;  1S4P A;  1VZX A;  1THJ A;  4DE7 A;  2IC7 A;  3R3I A;  3GQ9 A;  3KWD A;  1V84 A;  1WT2 A;  3FSX A;  3SXA A;  3K8E A;  4LW3 A;  3E26 A;  3U2X A;  5FU8 A;  1XAT A;  4CJB A;  3TDT A;  3FTT A;  3SXC A;  3IXC A;  3CKQ A;  1XHD A;  1SS9 A;  2P73 A;  2RIY A;  3IOI A;  4FRQ A;  5CMF X;  3V8Y A;  3SXB A;  5C1G A;  2Y6P A;  2X5Z A;  5C4D A;  4KNR A;  3U0Y A;  4EAA A;  4R37 A;  1QWJ A;  3GQA A;  2FFV A;  1EWW A;  3BRK X;  3NZ2 A;  1ZJ0 A;  2BO7 A;  2RIX A;  1INI A;  1G23 A;  2YC3 A;  2QH5 A;  1H7E A;  3TK8 A;  2NPO A;  2P2O A;  3GQ7 A;  1V82 A;  2WVM A;  5D92 A;  4Y6N A;  3V4E A;  4AC3 A;  3GOS A;  1HV9 A;  4AYL A;  3I0L A;  4NAN A;  3USR A;  2ZU8 A;  5C8R A;  3HJJ A;  2JF3 A;  1PZT A;  1Z90 A;  3OU9 A;  2RJ7 A;  5L6V A;  3V0M A;  3Q4S A;  1H4D A;  3TIS A;  2QKX A;  5F42 A;  1H7F A;  2APC A;  2XWM A;  1ZCU A;  2RIZ A;  3GUE A;  1G93 A;  1R80 A;  1VGZ A;  4KC2 A;  2TDT A;  4NAK A;  2BO8 A;  5C1L A;  5E3Q A;  3U2U A;  2E3D A;  4D0T A;  2ICX A;  2XWL A;  2PGV A;  3DK5 A;  4M9C A;  2C0N A;  5E3R A;  2WLD A;  1ZI1 A;  4MIX A;  3P1B A;  3ZF8 A;  5CQP A;  4EE5 A;  4AAW A;  2JCL A;  4Y7G A;  1QRG A;  4E1K A;  1H7G A;  4Y7T A;  3HSQ A;  3USQ A;  1N4I A;  1H5T B;  2VD4 A;  3TV0 A;  1JYK A;  1ON6 A;  1QQ0 A;  3ST8 A;  2YQH A;  3CKO A;  1H5T A;  1NKH B;  5CQL X;  4Y7U A;  1G8O A;  5DEM A;  2Y4M A;  5C3B A;  4KT7 A;  4B2W A;  4FIY A;  2RJ4 A;  3I0E A;  1GA8 A;  1LL2 A;  2Z86 A;  3EE5 A;  3KWE A;  2WE9 A;  1MP3 A;  5FTV A;  3SXG A;  4BQH A;  1KQA A;  2CU2 A;  3OTZ A;  1NWG B;  3T7M A;  1SSQ A;  1S80 A;  1H4E A;  1ZCV A;  4C2S A;  2MZB A;  1FWY A;  3OGZ A;  4HO8 A;  1M8N A;  4ASY A;  4IHG A;  2WLF A;  2AM3 A;  3JQY A;  2IU9 A;  1MP5 A;  1O7Q A;  1S4N A;  2RJ0 A;  1VGW A;  1FG5 N;  5EJ1 A;  1WT3 A;  1ZI5 A;  1G2V A;  1H4C A;  4IHF A;  3FWW A;  1MP4 A;  3SPT A;  4EGG A;  4M4K A;  5CMI A;  4B4B A;  5C4C A;  2WLE A;  2O1G A;  4JD0 A;  4HO2 A;  3TWD A;  4HG6 A;  4K6R A;  5DEP A;  4KQL A;  4P00 A;  3Q1X A;  1NF5 B;  1KGT A;  2V0J A;  1H5S B;  1R82 A;  2Y4K A;  3D5N A;  2VS3 A;  2AEC A;  2RIT A;  1J2Z A;  4Y62 A;  1FGG A;  4E75 A;  4M28 A;  1VGU A;  5FUH A;  3E25 A;  1TDT A;  1H7Q A;  1QRL A;  2RIJ A;  2GGO A;  2W0V A;  4M2B A;  4FRD A;  2W0W A;  1W55 A;  4EA7 A;  1ZJ3 A;  3I0J A;  3CKJ A;  4G87 A;  2VS5 A;  4KPX A;  3JUJ A;  4ISX A;  1GWW A;  4IRP A;  1G97 A;  5L6S A;  1H5S D;  1PZY B;  4MYO A;  4EAB A;  1GWV A;  4HO9 A;  3OUP A;  1R7T A;  2XME A;  3R5A A;  1LZI A;  1INJ A;  2YCM A;  4HUS A;  5FYE A;  1R81 A;  1IIN A;  1FZW A;  1LVW A;  2X60 A;  3FSB A;  1FOA A;  4ECM A;  3OH4 A;  4B42 A;  1GX0 A;  2XMH A;  2QIV X;  4BMA A;  1V83 A;  2Y4J A;  3V0P A;  1QRE A;  4B3U A;  3CJ8 A;  5CMH A;  2UX8 A;  1S4O A;  3R0S A;  4N27 A;  3BSY A;  4UEG A;  1ZJ1 A;  5C38 A;  4D0Z A;  2OEF A;  2VHE A;  4FQW A;  2ZU7 A;  3SX8 A;  4NAI A;  2Q4J A;  1GQC A;  5C4F A;  1O23 B;  5C3D A;  2JF2 A;  2D0J A;  3FS8 A;  4HCQ A;  5IFY A;  3R1W A;  1H7T A;  1NQI B;  2D7R A;  1EZI A;  2ICY A;  2YQJ A;  4Y7V A;  1H5S C;  4FRP A;  1OMZ A;  3D98 A;  1QG8 A;  4FRH A;  3F1C A;  4M98 A;  3N9W A;  3SX7 A;  4EE4 A;  4KNX A;  1L0S A;  1FO9 A;  3FOQ A;  1LL3 A;  1KK5 A;  2WEE A;  2VXL A;  3P47 A;  4NAL A;  5DDV A;  1SST A;  3BXY A;  3ZGF A;  5IDS A;  4D48 A;  3OC9 A;  5CQN X;  3POL A;  1IIM A;  2VXM A;  3VBI A;  1E5K A;  1FRW A;  3I0G A;  4CJC A;  3OW5 A;  5AJO A;  1FR8 A;  4E6T A;  3BFP A;  1JV3 A;  2A8U A;  4HO6 A;  2AM4 A;  1LZJ A;  3T7O A;  2ZU9 A;  3OH2 A;  1ZDG A;  3I3A A;  5FV9 A;  4MZU A;  2V0I A;  4MYB A;  2WAW A;  4AYJ A;  3Q80 A;  1H3M A;  1TW1 A;  3OH0 A;  4EVW A;  1OMX A;  3V0O A;  3U2V A;  1ZJO A;  1TZF A;  1JVG A;  3I0F A;  4FIX A;  2FFU A;  4G3S A;  1H7H A;  1O7O A;  2VSH A;  3EEV A;  3VBP A;  1KRV A;  1JV1 A;  1KK4 A;  5J49 A;  4HOC A;  2D7I A;  5C1H A;  1YP2 A;  1ZJP A;  3KIA A;  1T3D A;  3V90 A;  2JCO A;  1WVC A;  1OCX A;  3O3P A;  5AFU V;  2WLG A;  4EE3 A;  3BSW A;  4MND A;  3RMW A;  4D11 C;  1R7X A;  2QIA A;  3GVD A;  2FYD B;  4E79 A;  5C47 A;  3DHO A;  1Z2F A;  2NXV A;  4IHH A;  4ASJ A;  1HM8 A;  1VZU A;  1NHE B;  2Z87 A;  5FTS A;  1VZT A;  2I5E A;  3PMO A;  3OH1 A;  1ZCY A;  4ARW A;  5EIY A;  1KK6 A;  3I3X A;  1KGQ A;  3ZGG A;  4M99 A;  5CQO A;  4IRQ A;  1H5S A;  4EA9 A;  3U0X A;  4EEA A;  3SX3 A;  1ZJ2 A;  2FY7 A;  1VM8 A;  2BO6 A;  2YC5 A;  2Y4L A;  4FRB A;  5ADX V;  1XHB A;  1LZ0 A;  1K4V A;  2J0B A;  4O6M A;  3SRT A;  1VH1 A;  1V67 A;  1WSZ A;  4GBP A;  3I0D A;  1KHR A;  3VNP A;  3ZLK A;  3CKV A;  3VBK A;  1H5R B;  4FRO A;  1ZDF A;  2WLC A;  3MQG A;  3R3R A;  4EA8 A;  1KWS A;  1VIC A;  2BO4 A;  2AM5 A;  1TW5 A;  5C49 A;  4HO4 A;  1HJL A;  1FXO A;  3SUC A;  1TVY A;  3VBJ A;  2FYB A;  4HZC A;  1HM9 A;  2YQS A;  1YP3 A;  1W77 A;  1MR7 A;  3CU0 A;  5C36 A;  4B4G A;  4L41 C;  3R5D A;  1EYR A;  1H7L A;  5C4E A;  5CMG X;  1G0R A;  4DDZ A;  4DEC A;  2A8W A;  3NGW A;  2I7B A;  5CQM X;  2X65 A;  2VFZ A;  4Q7C A;  1NMM B;  4YS8 A;  2RJ8 A;  3K8D A;  1LZ7 A;  1WT0 A;  1VPA A;  3QVB A;  4JIS A;  4B5B A;  2VS4 A;  5BXC A;  4EEO A;  2X5S A;  1YRO B;  1ZHJ A;  3V0Q A;  4D11 A;  1ZI3 A;  1R7Y A;  1GX4 A;  3GQ8 A;  4HO3 A;  5D91 A;  1G1L A;  4KC4 A;  4FCE A;  3U2T A;  2P6W A;  3V8Z A;  3FSY A;  1JYL A;  3C8V A;  4Y64 A;  1G9R A;  3SXE A;  2OI6 A;  5AJN A;  3BSS A;  2PX7 A;  2OI5 A;  3OKR A;  2VSI A;  2FYC B;  1I52 A;  1FO8 A;  4AA7 A;  1GQ9 A;  5E3P A;  1SSM A;  4H7O A;  4EQY A;  2AGD A;  4HO0 A;  1MRL A;  3I0I X;  5I1F A;  3VBN A;  2IU8 A;  3MC4 A;  2RJ5 A;  2XAT A;  2AE7 A;  2AES A;  2O1F A;  2XWN A;  1HJJ A;  3Q7U A;  4CVH A;  3TQD A;  4XWI A;  3KWC A;  2FKO A;  2FYA A;  2P72 A;  3BCV A;  4KXO A;  3R8Y A;  4FCU A;  3TZT A;  4FRL A;  3OTM A;  3EG4 A;  3I0K A;  5HS2 A;  2J0A A;  5C48 A;  1FR9 A;  3I0C A;  4HUR A;  4HO5 A;  3MQH A;  2AH9 A;  4R7P A;  1LL0 A;  2V0H A;  5AJP A;  2RJ9 A;  4Y7F A;  2QGI A;  1QRF A;  1FXJ A;  3I0H A;  3PKP A;  4FRA A;  3T7N A;  2V0K A;  2DPW A;  4Y9X A;  3DUV A;  4G3P A;  2VK9 A;  3V0N A;  2YES A;  2WVL A;  2RJ1 A;  1HM0 A;  1XZ6 A;  1JVD A;  1MC3 A;  2V0L A;  4DCL A;  4J09 A;  3SXD A;  4EEG A;  2JCJ A;  2E8B A;  4P02 A;  4B4M A;  1KRR A;  2YQC A;  5IDT A;  2PA4 A;  2I5K A;  1FGX A;  3IGJ A;  3PKQ A;  3IOJ A;  4CJ8 A;  3F1X A;  4MFG A;  2O1H A;  3LW6 A;  5FU0 A;  3R5B A;  4KPZ A;  3JUK A;  3VBM A;  3JTJ A;  4R36 A;  3VBL A;  3OAM A;  4EEM A;  5AFU U;  4M2A A;  1O0R A;  2GGQ A;  5DG3 A;  1G95 A;  3FSC A;  3T57 A;  3R2W A;  3RSB A;  4HZD A;  3ECT A;  1ZCT A;  4KC1 A;  5DDT A;  2OEG A;  1ZIZ A;  5C3A A;  5EJZ A;  1V3W A;  3DJ4 A;  4LW6 A;  1R7V A;  3U2W A;  1WT1 A;  2IUA A;  3TIO A;  1QRM A;  1LXA A;  1ON8 A;  1OQM B;  1H5R A;  1R7U A;  3V91 A;  3SX5 A;  4N6B A;  4G3Q A;  3F1Y A;  4KRV A;  3R5C A;  1G3L A;  1W57 A;  2OI7 A;  2Y7A A;  3CKN A;  3HL3 A;  3IOH A;  3V0L A;  3ZLL A; 
#chains in the Genus database with same CATH homology
 1MR9 A;  2AQ9 A;  3EH0 A;  5CMJ A;  3PNN A;  2RJ6 A;  2PGY A;  1KRU A;  5ADX U;  3OH3 A;  4B2X A;  4Y63 A;  1YP4 A;  4E6U A;  4N6A A;  1VH3 A;  5U2K A;  3D8V A;  2WVK A;  2WGZ A;  1VGT A;  1ZI4 A;  4FRE A;  5C4B A;  1QGS A;  3RMV A;  2JCK A;  4O6N A;  4J18 A;  4ZDQ A;  4FRM A;  5JQQ A;  3CGX A;  1QGQ A;  4Y6U A;  4N69 A;  1S4P A;  1VZX A;  1THJ A;  4DE7 A;  2IC7 A;  3R3I A;  3KWD A;  1V84 A;  1WT2 A;  3FSX A;  3SXA A;  3K8E A;  4LW3 A;  3E26 A;  3U2X A;  5FU8 A;  1XAT A;  4CJB A;  3TDT A;  3FTT A;  3SXC A;  3IXC A;  3CKQ A;  1XHD A;  1SS9 A;  2P73 A;  2RIY A;  3IOI A;  4FRQ A;  5CMF X;  3V8Y A;  3SXB A;  5C1G A;  2Y6P A;  2X5Z A;  5C4D A;  4KNR A;  3U0Y A;  4EAA A;  4R37 A;  1QWJ A;  2FFV A;  3BRK X;  3NZ2 A;  1ZJ0 A;  2BO7 A;  2RIX A;  1INI A;  1G23 A;  2YC3 A;  2QH5 A;  1H7E A;  3TK8 A;  2NPO A;  2P2O A;  1V82 A;  2WVM A;  5D92 A;  4Y6N A;  3V4E A;  4AC3 A;  3GOS A;  1HV9 A;  4AYL A;  3I0L A;  4NAN A;  3USR A;  2ZU8 A;  5C8R A;  3HJJ A;  2JF3 A;  1PZT A;  1Z90 A;  3OU9 A;  2RJ7 A;  5L6V A;  3V0M A;  3Q4S A;  1H4D A;  3TIS A;  2QKX A;  5F42 A;  1H7F A;  2APC A;  2XWM A;  1ZCU A;  2RIZ A;  3GUE A;  1G93 A;  1R80 A;  1VGZ A;  4KC2 A;  2TDT A;  4NAK A;  2BO8 A;  5C1L A;  5E3Q A;  3U2U A;  2E3D A;  4D0T A;  2ICX A;  2XWL A;  2PGV A;  3DK5 A;  4M9C A;  2C0N A;  5E3R A;  2WLD A;  1ZI1 A;  4MIX A;  3P1B A;  3ZF8 A;  5CQP A;  4EE5 A;  4AAW A;  2JCL A;  4Y7G A;  1QRG A;  4E1K A;  1H7G A;  4Y7T A;  3HSQ A;  3USQ A;  1H5T B;  2VD4 A;  3TV0 A;  1JYK A;  1ON6 A;  1QQ0 A;  3ST8 A;  2YQH A;  3CKO A;  1H5T A;  1NKH B;  5CQL X;  4Y7U A;  1G8O A;  5DEM A;  2Y4M A;  5C3B A;  4KT7 A;  4B2W A;  4FIY A;  2RJ4 A;  3I0E A;  1GA8 A;  1LL2 A;  2Z86 A;  3EE5 A;  3KWE A;  2WE9 A;  1MP3 A;  5FTV A;  3SXG A;  4BQH A;  1KQA A;  2CU2 A;  3OTZ A;  1NWG B;  3T7M A;  1SSQ A;  1S80 A;  1H4E A;  1ZCV A;  4C2S A;  2MZB A;  1FWY A;  3OGZ A;  4HO8 A;  4ASY A;  4IHG A;  2WLF A;  2AM3 A;  3JQY A;  2IU9 A;  1MP5 A;  1O7Q A;  1S4N A;  2RJ0 A;  1VGW A;  1FG5 N;  5EJ1 A;  1WT3 A;  1ZI5 A;  1G2V A;  1H4C A;  4IHF A;  3FWW A;  1MP4 A;  3SPT A;  4EGG A;  4M4K A;  5CMI A;  4B4B A;  5C4C A;  2WLE A;  2O1G A;  4JD0 A;  4HO2 A;  3TWD A;  4HG6 A;  4K6R A;  5DEP A;  4KQL A;  4P00 A;  3Q1X A;  1NF5 B;  1KGT A;  2V0J A;  1H5S B;  1R82 A;  2Y4K A;  3D5N A;  2VS3 A;  2AEC A;  2RIT A;  1J2Z A;  4Y62 A;  1FGG A;  4E75 A;  4M28 A;  1VGU A;  5FUH A;  3E25 A;  1TDT A;  1H7Q A;  1QRL A;  2RIJ A;  2GGO A;  2W0V A;  4M2B A;  4FRD A;  2W0W A;  1W55 A;  4EA7 A;  1ZJ3 A;  3I0J A;  3CKJ A;  4G87 A;  2VS5 A;  4KPX A;  3JUJ A;  4ISX A;  1GWW A;  4IRP A;  1G97 A;  5L6S A;  1H5S D;  1PZY B;  4MYO A;  4EAB A;  1GWV A;  4HO9 A;  3OUP A;  1R7T A;  2XME A;  3R5A A;  1LZI A;  1INJ A;  2YCM A;  4HUS A;  5FYE A;  1R81 A;  1IIN A;  1FZW A;  1LVW A;  2X60 A;  3FSB A;  1FOA A;  4ECM A;  3OH4 A;  4B42 A;  1GX0 A;  2XMH A;  2QIV X;  4BMA A;  1V83 A;  2Y4J A;  3V0P A;  1QRE A;  4B3U A;  3CJ8 A;  5CMH A;  2UX8 A;  1S4O A;  3R0S A;  4N27 A;  3BSY A;  4UEG A;  1ZJ1 A;  5C38 A;  4D0Z A;  2OEF A;  2VHE A;  4FQW A;  2ZU7 A;  3SX8 A;  4NAI A;  2Q4J A;  1GQC A;  5C4F A;  1O23 B;  5C3D A;  2JF2 A;  2D0J A;  3FS8 A;  4HCQ A;  5IFY A;  3R1W A;  1H7T A;  1NQI B;  2D7R A;  1EZI A;  2ICY A;  2YQJ A;  4Y7V A;  1H5S C;  4FRP A;  1OMZ A;  3D98 A;  1QG8 A;  4FRH A;  3F1C A;  4M98 A;  3N9W A;  3SX7 A;  4EE4 A;  4KNX A;  1FO9 A;  3FOQ A;  1LL3 A;  1KK5 A;  2WEE A;  2VXL A;  3P47 A;  4NAL A;  5DDV A;  1SST A;  3BXY A;  3ZGF A;  5IDS A;  4D48 A;  3OC9 A;  5CQN X;  3POL A;  1IIM A;  2VXM A;  3VBI A;  1E5K A;  1FRW A;  3I0G A;  4CJC A;  3OW5 A;  5AJO A;  1FR8 A;  4E6T A;  3BFP A;  1JV3 A;  2A8U A;  4HO6 A;  2AM4 A;  1LZJ A;  3T7O A;  2ZU9 A;  3OH2 A;  1ZDG A;  3I3A A;  5FV9 A;  4MZU A;  2V0I A;  4MYB A;  2WAW A;  4AYJ A;  3Q80 A;  1H3M A;  1TW1 A;  3OH0 A;  4EVW A;  1OMX A;  3V0O A;  3U2V A;  1ZJO A;  1TZF A;  1JVG A;  3I0F A;  4FIX A;  2FFU A;  4G3S A;  1H7H A;  1O7O A;  2VSH A;  3EEV A;  3VBP A;  1KRV A;  1JV1 A;  1KK4 A;  5J49 A;  4HOC A;  2D7I A;  5C1H A;  1YP2 A;  1ZJP A;  3KIA A;  1T3D A;  3V90 A;  2JCO A;  1WVC A;  1OCX A;  3O3P A;  5AFU V;  2WLG A;  4EE3 A;  3BSW A;  4MND A;  3RMW A;  4D11 C;  1R7X A;  2QIA A;  3GVD A;  2FYD B;  4E79 A;  5C47 A;  3DHO A;  2NXV A;  4IHH A;  4ASJ A;  1HM8 A;  1VZU A;  1NHE B;  2Z87 A;  5FTS A;  1VZT A;  2I5E A;  3PMO A;  3OH1 A;  1ZCY A;  4ARW A;  5EIY A;  1KK6 A;  3I3X A;  1KGQ A;  3ZGG A;  4M99 A;  5CQO A;  4IRQ A;  1H5S A;  4EA9 A;  3U0X A;  4EEA A;  3SX3 A;  1ZJ2 A;  2FY7 A;  1VM8 A;  2BO6 A;  2YC5 A;  2Y4L A;  4FRB A;  5ADX V;  1XHB A;  1LZ0 A;  1K4V A;  2J0B A;  4O6M A;  3SRT A;  1VH1 A;  1V67 A;  1WSZ A;  4GBP A;  3I0D A;  1KHR A;  3VNP A;  3ZLK A;  3CKV A;  3VBK A;  1H5R B;  4FRO A;  1ZDF A;  2WLC A;  3MQG A;  3R3R A;  4EA8 A;  1KWS A;  1VIC A;  2BO4 A;  2AM5 A;  1TW5 A;  5C49 A;  4HO4 A;  1HJL A;  1FXO A;  1TVY A;  3VBJ A;  2FYB A;  4HZC A;  1HM9 A;  2YQS A;  1YP3 A;  1W77 A;  1MR7 A;  3CU0 A;  5C36 A;  4B4G A;  4L41 C;  3R5D A;  1EYR A;  1H7L A;  5C4E A;  5CMG X;  1G0R A;  4DDZ A;  4DEC A;  2A8W A;  3NGW A;  2I7B A;  5CQM X;  2X65 A;  2VFZ A;  4Q7C A;  1NMM B;  4YS8 A;  2RJ8 A;  3K8D A;  1LZ7 A;  1WT0 A;  1VPA A;  3QVB A;  4JIS A;  4B5B A;  2VS4 A;  5BXC A;  4EEO A;  2X5S A;  1YRO B;  1ZHJ A;  3V0Q A;  4D11 A;  1ZI3 A;  1R7Y A;  1GX4 A;  4HO3 A;  5D91 A;  1G1L A;  4KC4 A;  4FCE A;  3U2T A;  2P6W A;  3V8Z A;  3FSY A;  1JYL A;  3C8V A;  4Y64 A;  1G9R A;  3SXE A;  2OI6 A;  5AJN A;  3BSS A;  2PX7 A;  2OI5 A;  3OKR A;  2VSI A;  2FYC B;  1I52 A;  1FO8 A;  4AA7 A;  1GQ9 A;  5E3P A;  1SSM A;  4H7O A;  4EQY A;  2AGD A;  4HO0 A;  1MRL A;  3I0I X;  5I1F A;  3VBN A;  2IU8 A;  3MC4 A;  2RJ5 A;  2XAT A;  2AE7 A;  2AES A;  2O1F A;  2XWN A;  1HJJ A;  3Q7U A;  4CVH A;  3TQD A;  4XWI A;  3KWC A;  2FKO A;  2FYA A;  2P72 A;  3BCV A;  4KXO A;  3R8Y A;  4FCU A;  3TZT A;  4FRL A;  3OTM A;  3EG4 A;  3I0K A;  5HS2 A;  2J0A A;  5C48 A;  1FR9 A;  3I0C A;  4HUR A;  4HO5 A;  3MQH A;  2AH9 A;  4R7P A;  1LL0 A;  2V0H A;  5AJP A;  2RJ9 A;  4Y7F A;  2QGI A;  1QRF A;  1FXJ A;  3I0H A;  3PKP A;  4FRA A;  3T7N A;  2V0K A;  2DPW A;  4Y9X A;  3DUV A;  4G3P A;  2VK9 A;  3V0N A;  2YES A;  2WVL A;  2RJ1 A;  1HM0 A;  1XZ6 A;  1JVD A;  1MC3 A;  2V0L A;  4DCL A;  4J09 A;  3SXD A;  4EEG A;  2JCJ A;  2E8B A;  4P02 A;  4B4M A;  1KRR A;  2YQC A;  5IDT A;  2PA4 A;  2I5K A;  1FGX A;  3IGJ A;  3PKQ A;  3IOJ A;  4CJ8 A;  3F1X A;  4MFG A;  2O1H A;  3LW6 A;  5FU0 A;  3R5B A;  4KPZ A;  3JUK A;  3VBM A;  3JTJ A;  4R36 A;  3VBL A;  3OAM A;  4EEM A;  5AFU U;  4M2A A;  1O0R A;  2GGQ A;  5DG3 A;  1G95 A;  3FSC A;  3T57 A;  3R2W A;  3RSB A;  4HZD A;  3ECT A;  1ZCT A;  4KC1 A;  5DDT A;  2OEG A;  1ZIZ A;  5C3A A;  5EJZ A;  1V3W A;  3DJ4 A;  4LW6 A;  1R7V A;  3U2W A;  1WT1 A;  2IUA A;  3TIO A;  1QRM A;  1LXA A;  1ON8 A;  1OQM B;  1H5R A;  1R7U A;  3V91 A;  3SX5 A;  4N6B A;  4G3Q A;  3F1Y A;  4KRV A;  3R5C A;  1G3L A;  1W57 A;  2OI7 A;  2Y7A A;  3CKN A;  3HL3 A;  3IOH A;  3V0L A;  3ZLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...