3DJ4A

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 161
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dj4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dj4A01
3MC4A 4ISXA 5C38A 2I7BA 3RSBA 1KGQA 1LL2A 4Y6NA 2AM3A 2JCJA 3I0CA 4HO0A 1LZJA 3I0IX 4EEOA 1SS9A 1WT2A 3FTTA 3CKVA 1ZJ2A 5C4EA 5L6VA 3OKRA 5ADXV 4Y62A 2VSHA 1ZJ0A 4MFGA 3HJJA 3USRA 3NZ2A 3TISA 5AFUU 1HJJA 3EH0A 2YQHA 4B3UA 1FRWA 3GVDA 1FOAA 2BO4A 4FROA 2D7IA 4EE5A 2ZU9A 2NXVA 3IOIA 1G93A 1WVCA 2A8WA 3IOJA 3JUKA 4KXOA 2E3DA 3SXDA 4CJ8A 4FRBA 4NALA 2RJ0A 5U2KA 2FKOA 3HSQA 1H5RA 1ON6A 1ZI3A 3I3XA 1I52A 1QREA 4KNRA 4B4GA 5IDSA 3D98A 2OI6A 5AJNA 1LZ0A 4LW6A 1JYLA 3PKPA 1QRGA 4AA7A 3V8YA 1THJA 4B2XA 5DG3A 1H7FA 1VGZA 3HL3A 3R0SA 5FTVA 1VH3A 2YQJA 1PZYB 4JD0A 1K4VA 4DDZA 2FY7A 3U2WA 1O7QA 1V82A 3SPTA 2Y4KA 3O3PA 3R1WA 1G1LA 3SRTA 1INIA 4KT7A 2APCA 2YQSA 3BXYA 3R5CA 3D8VA 1OQMB 4N6BA 3TWDA 3CKOA 2WVLA 4HO4A 4P00A 3USQA 3SX3A 2O1HA 2RJ4A 3V91A 2IU8A 1JYKA 4GBPA 4B4BA 2X5ZA 3MQGA 1KHRA 1FGXA 5HS2A 5EJZA 1TDTA 1GQ9A 3VBNA 3OH4A 1OCXA 1JV1A 4N6AA 5AJPA 1S4PA 1XHDA 3DUVA 2WLGA 1IIMA 3I0GA 3U2VA 3D5NA 1KWSA 4M4KA 4FCUA 2RIYA 1XZ6A 3EEVA 3ST8A 1WSZA 3U2TA 4UEGA 2DPWA 5CMGX 2AH9A 3Q80A 2OEGA 2XWLA 2JCKA 1ZI4A 4IHFA 1H3MA 3R3RA 4EVWA 4J09A 1FWYA 4B42A 2QGIA 2Z87A 1H4DA 1VZXA 2QIAA 4E6TA 1H4CA 1WT3A 3CKQA 5FUHA 2ICYA 1QGQA 1R80A 5E3QA 1TZFA 2AQ9A 2O1GA 1ZIZA 5CQLX 5CQPA 5C47A 4HO6A 1ZCUA 2Y4LA 5F42A 3BSYA 4MYOA 1H5RB 2X60A 3KWEA 2OI5A 1VM8A 4ASJA 3BSSA 2YQCA 1J2ZA 1SSTA 3KWDA 4EE4A 1KRRA 4G3SA 5E3PA 3V0OA 2FFUA 1O0RA 2P6WA 4NAKA 3PKQA 5FTSA 4Y7TA 1QRMA 4AYLA 5C3BA 5CMIA 1MP4A 1NWGB 4M99A 2VXLA 3U0XA 1KRUA 5CMJA 4G3QA 2NPOA 1IINA 1KQAA 3TV0A 1NQIB 4EA9A 2Q4JA 3V90A 5DDVA 1VZTA 4HURA 2IC7A 1ZCVA 4ZDQA 5C49A 4HUSA 1R7TA 4CJCA 1LVWA 1YROB 2JCLA 3T57A 4ARWA 2WLCA 4FRPA 3F1YA 1HM0A 5DDTA 1S80A 2MZBA 3IXCA 3MQHA 3P47A 1H5TA 1HJLA 4XWIA 5J49A 3TK8A 2V0HA 1V83A 5C8RA 2QIVX 3SXGA 1NHEB 1KK6A 5AFUV 2VFZA 4AAWA 2ICXA 3BCVA 2W0WA 3C8VA 1G8OA 1O23B 1TW1A 4P02A 4EE3A 4M98A 5C4BA 2D7RA 1R7XA 1MC3A 1WT1A 5FU8A 1KK5A 1W77A 2PGYA 1SSMA 3V0NA 3ZLKA 2AECA 1R7YA 1FXJA 4FRMA 3CKJA 4M2BA 5CQMX 2IUAA 5C3AA 1VGUA 5C3DA 1QRLA 4K6RA 4KC2A 2ZU7A 1R7UA 4EAAA 1QQ0A 1VGWA 4Y63A 5C48A 2JF2A 4M9CA 4AYJA 1SSQA 4IHGA 2FYDB 2UX8A 3BFPA 2IU9A 3LW6A 2RJ5A 2RJ7A 3EE5A 5CMFX 3EG4A 3VBIA 1FO9A 2O1FA 3R3IA 4HO8A 1VPAA 2JCOA 4IRPA 3I0HA 3JUJA 3VBMA 4MZUA 3BRKX 2Y4JA 3JTJA 3I0JA 1FGGA 1KGTA 3U2UA 4Y7FA 3R2WA 4BMAA 3VBKA 4G3PA 4DECA 1R82A 4KC1A 2YESA 1ZI5A 3OTZA 3I0DA 3IOHA 1H5SA 1H7GA 2CU2A 2WLDA 1MRLA 3IGJA 4M2AA 1H4EA 2V0LA 4FRAA 3V0QA 1FXOA 2RJ9A 5EJ1A 4EEAA 1TVYA 2XMEA 1TW5A 2RJ1A 4Y6UA 4IHHA 3ZGFA 4EABA 2FYAA 1H7LA 1GWVA 3I0KA 3FOQA 2XWMA 3GOSA 1MP3A 1MP5A 1H5TB 4D0TA 3SX7A 1OMZA 3SX5A 2VHEA 3QVBA 4HO2A 4IRQA 1T3DA 1ZHJA 1W57A 1JVGA 3TQDA 1G97A 2A8UA 2P2OA 3SXBA 2XATA 2VS3A 3PNNA 1KK4A 2Y6PA 3E25A 4HOCA 3V0LA 1FG5N 1ZCTA 3OH0A 4MYBA 4FRQA 2E8BA 1G0RA 3Q1XA 1O7OA 2RJ6A 1HV9A 4M28A 1PZTA 2AGDA 1LZ7A 4G87A 3Q7UA 5DEMA 4E6UA 5I1FA 3K8DA 3GUEA 2WGZA 1YP4A 3SXCA 1FZWA 1H7QA 3U0YA 4D11A 1LL0A 1H7HA 2AESA 2FFVA 4HCQA 1MR9A 1QWJA 5BXCA 3F1XA 4FRLA 2FYCB 3OH2A 2D0JA 4EA7A 2YCMA 4HO9A 5JQQA 1G3LA 5FYEA 2V0IA 2W0VA 3DJ4A 3JQYA 1LZIA 3VBLA 4KPXA 1H7EA 3SX8A 4Y7VA 1QRFA 2RIJA 1E5KA 1ZJPA 4NAIA 5EIYA 1Z90A 3OC9A 1H5SB 3OTMA 2WLFA 4R37A 1INJA 1XHBA 1V67A 1YP3A 4KC4A 1G2VA 1VZUA 3CU0A 4B5BA 3PMOA 3BSWA 3CJ8A 1EYRA 5ADXU 4KNXA 2Y4MA 2V0KA 5FV9A 3R5DA 3V8ZA 5C4DA 3OW5A 3T7NA 2YC3A 1ZCYA 2VD4A 3VBPA 4E79A 3OAMA 5E3RA 1S4OA 2PGVA 4N69A 3ZLLA 4R7PA 2JF3A 2GGOA 4AC3A 4FRDA 4FRHA 2WAWA 4J18A 2XWNA 4EEGA 4HZCA 4KRVA 1GX0A 3F1CA 5CQOA 2BO6A 3R5AA 2WLEA 3VNPA 2YC5A 3I0LA 3KWCA 1VGTA 1LXAA 3FWWA 2X65A 3RMWA 3FSXA 3OH1A 3KIAA 5C36A 5CMHA 1FR9A 2Y7AA 3V0MA 1LL3A 4JISA 3P1BA 2P73A 2VXMA 4NANA 2BO7A 4N27A 3V0PA 5C4CA 1HM8A 3FSBA 3NGWA 4FCEA 4MNDA 4BQHA 2RIXA 1G95A 2I5KA 2VSIA 2QKXA 4LW3A 2BO8A 5DEPA 4EGGA 1GX4A 2Z86A 3R8YA 2QH5A 1NKHB 5C1HA 1G23A 1ZDGA 2AE7A 2WEEA 2XMHA 5CQNX 5C4FA 3E26A 1H7TA 3N9WA 2PX7A 4CVHA 4HG6A 3RMVA 3FSYA 3U2XA 2ZU8A 3ZF8A 4E1KA 3OGZA 1H5SC 3ECTA 1HM9A 4H7OA 4DCLA 1MR7A 1JVDA 3ZGGA 4B4MA 2WE9A 1VH1A 3Q4SA 2P72A 3CKNA 2I5EA 2TDTA 2PA4A 1W55A 3DK5A 4E75A 2FYBA 4CJBA 4D0ZA 2V0JA 3OU9A 2AM5A 4YS8A 5FU0A 3I0FA 1FO8A 2RJ8A 1FR8A 4D48A 1ZJ3A 1WT0A 1EZIA 2GGQA 2AM4A 2RIZA 3TZTA 4KPZA 1ON8A 3FSCA 1GA8A 1NMMB 4Y7UA 1OMXA 5IDTA 5C1GA 1QG8A 2WVMA 3POLA 4ECMA 2RITA 3I3AA 1V84A 4DE7A 1G9RA 2OI7A 5L6SA 2OEFA 3T7OA 1H5SD 1KRVA 1S4NA 4FREA 1V3WA 3T7MA 1ZJOA 5C1LA 4R36A 4L41C 2VS4A 2WVKA 1NF5B 4Y7GA 3V4EA 4ASYA 1YP2A 3VBJA 3SXAA 5IFYA 3R5BA 3TDTA 4FQWA 4EA8A 4Y64A 1QGSA 4C2SA 3I0EA 1ZDFA 4EEMA 4D11C 1GQCA 2X5SA 3K8EA 4B2WA 1R7VA 3OH3A 3CGXA 3SXEA 1ZI1A 4Y9XA 4KQLA 4HO5A 4EQYA 2VS5A 1JV3A 1VICA 3DHOA 3OUPA 1ZJ1A 5AJOA 1XATA 3TIOA 4HO3A 1GWWA 3FS8A 4HZDA 1R81A
chains in the Genus database with same CATH superfamily
3MC4A 4ISXA 5C38A 2I7BA 3RSBA 1KGQA 1LL2A 4Y6NA 2AM3A 2JCJA 3I0CA 4HO0A 1LZJA 3I0IX 4EEOA 1SS9A 1WT2A 3FTTA 3CKVA 1ZJ2A 5C4EA 5L6VA 3OKRA 5ADXV 4Y62A 2VSHA 1ZJ0A 4MFGA 3HJJA 3USRA 3NZ2A 3TISA 5AFUU 1HJJA 3EH0A 2YQHA 4B3UA 1FRWA 2C0NA 3GVDA 1FOAA 2BO4A 4FROA 2D7IA 4EE5A 2ZU9A 2NXVA 3IOIA 1G93A 2J0AA 1WVCA 2A8WA 3IOJA 3JUKA 4KXOA 2E3DA 3SXDA 4CJ8A 4FRBA 4NALA 2RJ0A 5U2KA 2FKOA 3HSQA 1H5RA 1ON6A 1ZI3A 3I3XA 1I52A 1QREA 4KNRA 4B4GA 5IDSA 3D98A 2OI6A 5AJNA 1LZ0A 4LW6A 1JYLA 3PKPA 1QRGA 4AA7A 3V8YA 1THJA 4B2XA 5DG3A 1H7FA 1VGZA 3HL3A 3R0SA 5FTVA 1VH3A 2YQJA 1PZYB 4JD0A 1K4VA 4DDZA 2FY7A 3U2WA 1O7QA 1V82A 3SPTA 2Y4KA 3O3PA 3R1WA 1G1LA 3SRTA 1INIA 4KT7A 2APCA 2YQSA 3BXYA 3R5CA 3D8VA 1OQMB 4N6BA 3TWDA 3CKOA 2WVLA 4HO4A 4P00A 3USQA 3SX3A 2O1HA 2RJ4A 3V91A 2IU8A 1JYKA 4GBPA 4B4BA 2X5ZA 3MQGA 1KHRA 1FGXA 5HS2A 5EJZA 1TDTA 1GQ9A 3VBNA 3OH4A 1OCXA 1JV1A 4N6AA 5AJPA 1S4PA 1XHDA 3DUVA 2WLGA 1IIMA 3I0GA 3U2VA 3D5NA 1KWSA 4M4KA 4FCUA 2RIYA 1XZ6A 3EEVA 3ST8A 1WSZA 3U2TA 4UEGA 2DPWA 5CMGX 2AH9A 3Q80A 2OEGA 2XWLA 2JCKA 1ZI4A 4IHFA 1H3MA 3R3RA 4EVWA 4J09A 1FWYA 4B42A 2QGIA 2Z87A 1H4DA 1VZXA 3SUCA 2QIAA 4E6TA 1H4CA 1L0SA 1WT3A 3CKQA 5FUHA 2ICYA 1QGQA 1R80A 4FIYA 5E3QA 1TZFA 2AQ9A 2O1GA 4O6MA 1ZIZA 5CQLX 5CQPA 5D91A 5C47A 4HO6A 1ZCUA 2Y4LA 5F42A 3BSYA 4MYOA 1H5RB 2X60A 3KWEA 2OI5A 1VM8A 4ASJA 3BSSA 2YQCA 1J2ZA 1SSTA 3KWDA 4EE4A 1KRRA 4G3SA 5E3PA 3V0OA 2FFUA 4MIXA 1O0RA 2P6WA 4NAKA 3PKQA 5FTSA 4Y7TA 1QRMA 4AYLA 5C3BA 5CMIA 1MP4A 1NWGB 4M99A 2VXLA 3U0XA 1KRUA 5CMJA 4G3QA 2NPOA 1IINA 1KQAA 3TV0A 1NQIB 4EA9A 2Q4JA 3V90A 5DDVA 1VZTA 4HURA 2IC7A 1ZCVA 4ZDQA 5C49A 4HUSA 1R7TA 4CJCA 1LVWA 1YROB 2JCLA 3T57A 4ARWA 2WLCA 4FRPA 3F1YA 1HM0A 5DDTA 1S80A 2MZBA 3IXCA 3MQHA 3P47A 1H5TA 1HJLA 4XWIA 5J49A 3TK8A 2V0HA 1V83A 5C8RA 2QIVX 3SXGA 1NHEB 1KK6A 5AFUV 2VFZA 4AAWA 2ICXA 3BCVA 2W0WA 3C8VA 1G8OA 1O23B 1TW1A 4P02A 4EE3A 4M98A 5C4BA 2D7RA 1R7XA 1MC3A 1WT1A 1EWWA 5FU8A 1KK5A 1W77A 2PGYA 1SSMA 3V0NA 3ZLKA 2AECA 1R7YA 1FXJA 4FRMA 3CKJA 4M2BA 5CQMX 2IUAA 1M8NA 5C3AA 1VGUA 5C3DA 1QRLA 4K6RA 4KC2A 2ZU7A 1R7UA 4EAAA 1QQ0A 1VGWA 4Y63A 5C48A 2JF2A 4M9CA 2VK9A 4AYJA 1SSQA 4IHGA 2FYDB 2UX8A 3BFPA 2IU9A 3LW6A 2RJ5A 2RJ7A 3EE5A 5CMFX 3EG4A 3VBIA 1FO9A 2O1FA 3R3IA 4HO8A 1VPAA 2JCOA 4IRPA 3I0HA 3JUJA 3VBMA 4MZUA 3BRKX 2Y4JA 3JTJA 3I0JA 1FGGA 1KGTA 3U2UA 4Y7FA 3R2WA 4BMAA 3VBKA 4G3PA 4DECA 1R82A 4KC1A 2YESA 1ZI5A 3OTZA 3I0DA 3IOHA 1H5SA 1H7GA 2CU2A 2WLDA 1MRLA 5D92A 3IGJA 4M2AA 1H4EA 2V0LA 4FRAA 3V0QA 1FXOA 2RJ9A 5EJ1A 4EEAA 4O6NA 1TVYA 2XMEA 1TW5A 2J0BA 2RJ1A 4Y6UA 4IHHA 3ZGFA 4EABA 2FYAA 1H7LA 1GWVA 3I0KA 3FOQA 2XWMA 3GOSA 1MP3A 1MP5A 1H5TB 4D0TA 3SX7A 1OMZA 3SX5A 2VHEA 3GQAA 3QVBA 4HO2A 4IRQA 1T3DA 1ZHJA 1W57A 1JVGA 3TQDA 1G97A 2A8UA 2P2OA 3SXBA 2XATA 2VS3A 3PNNA 1KK4A 2Y6PA 3E25A 4HOCA 3V0LA 1FG5N 1ZCTA 3OH0A 4MYBA 4FRQA 2E8BA 1G0RA 3Q1XA 1O7OA 2RJ6A 1HV9A 4M28A 1PZTA 2AGDA 1LZ7A 4G87A 3Q7UA 5DEMA 4E6UA 5I1FA 3K8DA 3GUEA 2WGZA 1YP4A 3SXCA 1FZWA 1H7QA 3U0YA 4D11A 1LL0A 1H7HA 2AESA 2FFVA 4HCQA 1MR9A 1QWJA 5BXCA 3F1XA 4FRLA 2FYCB 3GQ8A 3OH2A 2D0JA 4EA7A 1Z2FA 2YCMA 4HO9A 5JQQA 1G3LA 5FYEA 2V0IA 2W0VA 3DJ4A 3JQYA 1LZIA 3VBLA 4KPXA 1H7EA 3SX8A 4Y7VA 1QRFA 2RIJA 1E5KA 1ZJPA 4NAIA 5EIYA 1Z90A 3GQ7A 3OC9A 1H5SB 3OTMA 2WLFA 4R37A 1INJA 1XHBA 1V67A 1YP3A 4KC4A 1G2VA 1VZUA 3CU0A 4B5BA 3PMOA 3BSWA 3CJ8A 1EYRA 5ADXU 4KNXA 2Y4MA 2V0KA 5FV9A 3R5DA 3V8ZA 5C4DA 3OW5A 3T7NA 2YC3A 1ZCYA 2VD4A 3VBPA 4E79A 3OAMA 5E3RA 1S4OA 2PGVA 4N69A 3ZLLA 4R7PA 2JF3A 2GGOA 4AC3A 4FRDA 4FRHA 2WAWA 4J18A 2XWNA 4EEGA 4HZCA 4KRVA 1GX0A 3F1CA 5CQOA 2BO6A 3R5AA 2WLEA 3VNPA 2YC5A 3I0LA 3KWCA 1VGTA 1LXAA 3FWWA 2X65A 3RMWA 3FSXA 3OH1A 3KIAA 5C36A 5CMHA 1FR9A 2Y7AA 3V0MA 1LL3A 4JISA 3P1BA 2P73A 2VXMA 4NANA 2BO7A 4N27A 3V0PA 5C4CA 1HM8A 3FSBA 3NGWA 4FCEA 4MNDA 4BQHA 2RIXA 1G95A 2I5KA 2VSIA 2QKXA 4LW3A 2BO8A 5DEPA 4EGGA 1GX4A 2Z86A 3R8YA 2QH5A 1NKHB 5C1HA 1G23A 1ZDGA 2AE7A 2WEEA 3GQ9A 2XMHA 5CQNX 5C4FA 3E26A 1H7TA 3N9WA 2PX7A 4CVHA 4HG6A 3RMVA 3FSYA 3U2XA 2ZU8A 3ZF8A 4E1KA 3OGZA 1H5SC 3ECTA 1HM9A 4H7OA 4DCLA 1MR7A 1JVDA 3ZGGA 4B4MA 2WE9A 1VH1A 3Q4SA 2P72A 3CKNA 2I5EA 2TDTA 2PA4A 1W55A 3DK5A 4E75A 2FYBA 4CJBA 4D0ZA 2V0JA 3OU9A 2AM5A 4YS8A 5FU0A 3I0FA 1FO8A 2RJ8A 4FIXA 1FR8A 4D48A 1ZJ3A 1WT0A 1EZIA 2GGQA 2AM4A 2RIZA 3TZTA 4KPZA 1ON8A 3FSCA 1GA8A 1NMMB 4Y7UA 1OMXA 5IDTA 5C1GA 1QG8A 2WVMA 3POLA 1N4IA 4ECMA 2RITA 3I3AA 1V84A 4DE7A 1G9RA 2OI7A 5L6SA 2OEFA 3T7OA 1H5SD 1KRVA 1S4NA 4FREA 1V3WA 3T7MA 1ZJOA 5C1LA 4R36A 4L41C 2VS4A 2WVKA 1NF5B 4Y7GA 3V4EA 4ASYA 1YP2A 4Q7CA 3VBJA 3SXAA 5IFYA 3R5BA 3TDTA 4FQWA 4EA8A 4Y64A 1QGSA 4C2SA 3I0EA 1ZDFA 4EEMA 4D11C 1GQCA 2X5SA 3K8EA 4B2WA 3OH3A 1R7VA 3CGXA 3SXEA 1ZI1A 4Y9XA 4KQLA 4HO5A 4EQYA 2VS5A 1JV3A 1VICA 3DHOA 3OUPA 1ZJ1A 5AJOA 1XATA 3TIOA 4HO3A 1GWWA 3FS8A 4HZDA 1R81A
chains in the Genus database with same CATH topology
3MC4A 4ISXA 5C38A 2I7BA 3RSBA 1KGQA 1LL2A 4Y6NA 2AM3A 2JCJA 3I0CA 4HO0A 1LZJA 3I0IX 4EEOA 1SS9A 1WT2A 3FTTA 3CKVA 1ZJ2A 5C4EA 5L6VA 3OKRA 5ADXV 4Y62A 2VSHA 1ZJ0A 4MFGA 3HJJA 3USRA 3NZ2A 3TISA 5AFUU 1HJJA 3EH0A 2YQHA 4B3UA 1FRWA 2C0NA 3GVDA 1FOAA 2BO4A 4FROA 2D7IA 4EE5A 2ZU9A 2NXVA 3IOIA 1G93A 2J0AA 1WVCA 2A8WA 3IOJA 3JUKA 4KXOA 2E3DA 3SXDA 4CJ8A 4FRBA 4NALA 2RJ0A 5U2KA 2FKOA 3HSQA 1H5RA 1ON6A 1ZI3A 3I3XA 1I52A 1QREA 4KNRA 4B4GA 5IDSA 3D98A 2OI6A 5AJNA 1LZ0A 4LW6A 1JYLA 3PKPA 1QRGA 4AA7A 3V8YA 1THJA 4B2XA 5DG3A 1H7FA 1VGZA 3HL3A 3R0SA 5FTVA 1VH3A 2YQJA 1PZYB 4JD0A 1K4VA 4DDZA 2FY7A 3U2WA 1O7QA 1V82A 3SPTA 2Y4KA 3O3PA 3R1WA 1G1LA 3SRTA 1INIA 4KT7A 2APCA 2YQSA 3BXYA 3R5CA 3D8VA 1OQMB 4N6BA 3TWDA 3CKOA 2WVLA 4HO4A 4P00A 3USQA 3SX3A 2O1HA 2RJ4A 3V91A 2IU8A 1JYKA 4GBPA 4B4BA 2X5ZA 3MQGA 1KHRA 1FGXA 5HS2A 5EJZA 1TDTA 1GQ9A 3VBNA 3OH4A 1OCXA 1JV1A 4N6AA 5AJPA 1S4PA 1XHDA 3DUVA 2WLGA 1IIMA 3I0GA 3U2VA 3D5NA 1KWSA 4M4KA 4FCUA 2RIYA 1XZ6A 3EEVA 3ST8A 1WSZA 3U2TA 4UEGA 2DPWA 5CMGX 2AH9A 3Q80A 2OEGA 2XWLA 2JCKA 1ZI4A 4IHFA 1H3MA 3R3RA 4EVWA 4J09A 1FWYA 4B42A 2QGIA 2Z87A 1H4DA 1VZXA 2QIAA 4E6TA 1H4CA 1WT3A 3CKQA 5FUHA 2ICYA 1QGQA 1R80A 4FIYA 5E3QA 1TZFA 2AQ9A 2O1GA 4O6MA 1ZIZA 5CQLX 5CQPA 5D91A 5C47A 4HO6A 1ZCUA 2Y4LA 5F42A 3BSYA 4MYOA 1H5RB 2X60A 3KWEA 2OI5A 1VM8A 4ASJA 3BSSA 2YQCA 1J2ZA 1SSTA 3KWDA 4EE4A 1KRRA 4G3SA 5E3PA 3V0OA 2FFUA 4MIXA 1O0RA 2P6WA 4NAKA 3PKQA 5FTSA 4Y7TA 1QRMA 4AYLA 5C3BA 5CMIA 1MP4A 1NWGB 4M99A 2VXLA 3U0XA 1KRUA 5CMJA 4G3QA 2NPOA 1IINA 1KQAA 3TV0A 1NQIB 4EA9A 2Q4JA 3V90A 5DDVA 1VZTA 4HURA 2IC7A 1ZCVA 4ZDQA 5C49A 4HUSA 1R7TA 4CJCA 1LVWA 1YROB 2JCLA 3T57A 4ARWA 2WLCA 4FRPA 3F1YA 1HM0A 5DDTA 1S80A 2MZBA 3IXCA 3MQHA 3P47A 1H5TA 1HJLA 4XWIA 5J49A 3TK8A 2V0HA 1V83A 5C8RA 2QIVX 3SXGA 1NHEB 1KK6A 5AFUV 2VFZA 4AAWA 2ICXA 3BCVA 2W0WA 3C8VA 1G8OA 1O23B 1TW1A 4P02A 4EE3A 4M98A 5C4BA 2D7RA 1R7XA 1MC3A 1WT1A 5FU8A 1KK5A 1W77A 2PGYA 1SSMA 3V0NA 3ZLKA 2AECA 1R7YA 1FXJA 4FRMA 3CKJA 4M2BA 5CQMX 2IUAA 5C3AA 1VGUA 5C3DA 1QRLA 4K6RA 4KC2A 2ZU7A 1R7UA 4EAAA 1QQ0A 1VGWA 4Y63A 5C48A 2JF2A 4M9CA 2VK9A 4AYJA 1SSQA 4IHGA 2FYDB 2UX8A 3BFPA 2IU9A 3LW6A 2RJ5A 2RJ7A 3EE5A 5CMFX 3EG4A 3VBIA 1FO9A 2O1FA 3R3IA 4HO8A 1VPAA 2JCOA 4IRPA 3I0HA 3JUJA 3VBMA 4MZUA 3BRKX 2Y4JA 3JTJA 3I0JA 1FGGA 1KGTA 3U2UA 4Y7FA 3R2WA 4BMAA 3VBKA 4G3PA 4DECA 1R82A 4KC1A 2YESA 1ZI5A 3OTZA 3I0DA 3IOHA 1H5SA 1H7GA 2CU2A 2WLDA 1MRLA 5D92A 3IGJA 4M2AA 1H4EA 2V0LA 4FRAA 3V0QA 1FXOA 2RJ9A 5EJ1A 4EEAA 4O6NA 1TVYA 2XMEA 1TW5A 2J0BA 2RJ1A 4Y6UA 4IHHA 3ZGFA 4EABA 2FYAA 1H7LA 1GWVA 3I0KA 3FOQA 2XWMA 3GOSA 1MP3A 1MP5A 1H5TB 4D0TA 3SX7A 1OMZA 3SX5A 2VHEA 3QVBA 4HO2A 4IRQA 1T3DA 1ZHJA 1W57A 1JVGA 3TQDA 1G97A 2A8UA 2P2OA 3SXBA 2XATA 2VS3A 3PNNA 1KK4A 2Y6PA 3E25A 4HOCA 3V0LA 1FG5N 1ZCTA 3OH0A 4MYBA 4FRQA 2E8BA 1G0RA 3Q1XA 1O7OA 2RJ6A 1HV9A 4M28A 1PZTA 2AGDA 1LZ7A 4G87A 3Q7UA 5DEMA 4E6UA 5I1FA 3K8DA 3GUEA 2WGZA 1YP4A 3SXCA 1FZWA 1H7QA 3U0YA 4D11A 1LL0A 1H7HA 2AESA 2FFVA 4HCQA 1MR9A 1QWJA 5BXCA 3F1XA 4FRLA 2FYCB 3OH2A 2D0JA 4EA7A 2YCMA 4HO9A 5JQQA 1G3LA 5FYEA 2V0IA 2W0VA 3DJ4A 3JQYA 1LZIA 3VBLA 4KPXA 1H7EA 3SX8A 4Y7VA 1QRFA 2RIJA 1E5KA 1ZJPA 4NAIA 5EIYA 1Z90A 3OC9A 1H5SB 3OTMA 2WLFA 4R37A 1INJA 1XHBA 1V67A 1YP3A 4KC4A 1G2VA 1VZUA 3CU0A 4B5BA 3PMOA 3BSWA 3CJ8A 1EYRA 5ADXU 4KNXA 2Y4MA 2V0KA 5FV9A 3R5DA 3V8ZA 5C4DA 3OW5A 3T7NA 2YC3A 1ZCYA 2VD4A 3VBPA 4E79A 3OAMA 5E3RA 1S4OA 2PGVA 4N69A 3ZLLA 4R7PA 2JF3A 2GGOA 4AC3A 4FRDA 4FRHA 2WAWA 4J18A 2XWNA 4EEGA 4HZCA 4KRVA 1GX0A 3F1CA 5CQOA 2BO6A 3R5AA 2WLEA 3VNPA 2YC5A 3I0LA 3KWCA 1VGTA 1LXAA 3FWWA 2X65A 3RMWA 3FSXA 3OH1A 3KIAA 5C36A 5CMHA 1FR9A 2Y7AA 3V0MA 1LL3A 4JISA 3P1BA 2P73A 2VXMA 4NANA 2BO7A 4N27A 3V0PA 5C4CA 1HM8A 3FSBA 3NGWA 4FCEA 4MNDA 4BQHA 2RIXA 1G95A 2I5KA 2VSIA 2QKXA 4LW3A 2BO8A 5DEPA 4EGGA 1GX4A 2Z86A 3R8YA 2QH5A 1NKHB 5C1HA 1G23A 1ZDGA 2AE7A 2WEEA 2XMHA 5CQNX 5C4FA 3E26A 1H7TA 3N9WA 2PX7A 4CVHA 4HG6A 3RMVA 3FSYA 3U2XA 2ZU8A 3ZF8A 4E1KA 3OGZA 1H5SC 3ECTA 1HM9A 4H7OA 4DCLA 1MR7A 1JVDA 3ZGGA 4B4MA 2WE9A 1VH1A 3Q4SA 2P72A 3CKNA 2I5EA 2TDTA 2PA4A 1W55A 3DK5A 4E75A 2FYBA 4CJBA 4D0ZA 2V0JA 3OU9A 2AM5A 4YS8A 5FU0A 3I0FA 1FO8A 2RJ8A 4FIXA 1FR8A 4D48A 1ZJ3A 1WT0A 1EZIA 2GGQA 2AM4A 2RIZA 3TZTA 4KPZA 1ON8A 3FSCA 1GA8A 1NMMB 4Y7UA 1OMXA 5IDTA 5C1GA 1QG8A 2WVMA 3POLA 4ECMA 2RITA 3I3AA 1V84A 4DE7A 1G9RA 2OI7A 5L6SA 2OEFA 3T7OA 1H5SD 1KRVA 1S4NA 4FREA 1V3WA 3T7MA 1ZJOA 5C1LA 4R36A 4L41C 2VS4A 2WVKA 1NF5B 4Y7GA 3V4EA 4ASYA 1YP2A 4Q7CA 3VBJA 3SXAA 5IFYA 3R5BA 3TDTA 4FQWA 4EA8A 4Y64A 1QGSA 4C2SA 3I0EA 1ZDFA 4EEMA 4D11C 1GQCA 2X5SA 3K8EA 4B2WA 1R7VA 3OH3A 3CGXA 3SXEA 1ZI1A 4Y9XA 4KQLA 4HO5A 4EQYA 2VS5A 1JV3A 1VICA 3DHOA 3OUPA 1ZJ1A 5AJOA 1XATA 3TIOA 4HO3A 1GWWA 3FS8A 4HZDA 1R81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC4 A;  4ISX A;  5C38 A;  2I7B A;  3RSB A;  1KGQ A;  1LL2 A;  4Y6N A;  2AM3 A;  2JCJ A;  3I0C A;  4HO0 A;  1LZJ A;  3I0I X;  4EEO A;  1SS9 A;  1WT2 A;  3FTT A;  3CKV A;  1ZJ2 A;  5C4E A;  5L6V A;  3OKR A;  5ADX V;  4Y62 A;  2VSH A;  1ZJ0 A;  4MFG A;  3HJJ A;  3USR A;  3NZ2 A;  3TIS A;  5AFU U;  1HJJ A;  3EH0 A;  2YQH A;  4B3U A;  1FRW A;  3GVD A;  1FOA A;  2BO4 A;  4FRO A;  2D7I A;  4EE5 A;  2ZU9 A;  2NXV A;  3IOI A;  1G93 A;  1WVC A;  2A8W A;  3IOJ A;  3JUK A;  4KXO A;  2E3D A;  3SXD A;  4CJ8 A;  4FRB A;  4NAL A;  2RJ0 A;  5U2K A;  2FKO A;  3HSQ A;  1H5R A;  1ON6 A;  1ZI3 A;  3I3X A;  1I52 A;  1QRE A;  4KNR A;  4B4G A;  5IDS A;  3D98 A;  2OI6 A;  5AJN A;  1LZ0 A;  4LW6 A;  1JYL A;  3PKP A;  1QRG A;  4AA7 A;  3V8Y A;  1THJ A;  4B2X A;  5DG3 A;  1H7F A;  1VGZ A;  3HL3 A;  3R0S A;  5FTV A;  1VH3 A;  2YQJ A;  1PZY B;  4JD0 A;  1K4V A;  4DDZ A;  2FY7 A;  3U2W A;  1O7Q A;  1V82 A;  3SPT A;  2Y4K A;  3O3P A;  3R1W A;  1G1L A;  3SRT A;  1INI A;  4KT7 A;  2APC A;  2YQS A;  3BXY A;  3R5C A;  3D8V A;  1OQM B;  4N6B A;  3TWD A;  3CKO A;  2WVL A;  4HO4 A;  4P00 A;  3USQ A;  3SX3 A;  2O1H A;  2RJ4 A;  3V91 A;  2IU8 A;  1JYK A;  4GBP A;  4B4B A;  2X5Z A;  3MQG A;  1KHR A;  1FGX A;  5HS2 A;  5EJZ A;  1TDT A;  1GQ9 A;  3VBN A;  3OH4 A;  1OCX A;  1JV1 A;  4N6A A;  5AJP A;  1S4P A;  1XHD A;  3DUV A;  2WLG A;  1IIM A;  3I0G A;  3U2V A;  3D5N A;  1KWS A;  4M4K A;  4FCU A;  2RIY A;  1XZ6 A;  3EEV A;  3ST8 A;  1WSZ A;  3U2T A;  4UEG A;  2DPW A;  5CMG X;  2AH9 A;  3Q80 A;  2OEG A;  2XWL A;  2JCK A;  1ZI4 A;  4IHF A;  1H3M A;  3R3R A;  4EVW A;  4J09 A;  1FWY A;  4B42 A;  2QGI A;  2Z87 A;  1H4D A;  1VZX A;  2QIA A;  4E6T A;  1H4C A;  1WT3 A;  3CKQ A;  5FUH A;  2ICY A;  1QGQ A;  1R80 A;  5E3Q A;  1TZF A;  2AQ9 A;  2O1G A;  1ZIZ A;  5CQL X;  5CQP A;  5C47 A;  4HO6 A;  1ZCU A;  2Y4L A;  5F42 A;  3BSY A;  4MYO A;  1H5R B;  2X60 A;  3KWE A;  2OI5 A;  1VM8 A;  4ASJ A;  3BSS A;  2YQC A;  1J2Z A;  1SST A;  3KWD A;  4EE4 A;  1KRR A;  4G3S A;  5E3P A;  3V0O A;  2FFU A;  1O0R A;  2P6W A;  4NAK A;  3PKQ A;  5FTS A;  4Y7T A;  1QRM A;  4AYL A;  5C3B A;  5CMI A;  1MP4 A;  1NWG B;  4M99 A;  2VXL A;  3U0X A;  1KRU A;  5CMJ A;  4G3Q A;  2NPO A;  1IIN A;  1KQA A;  3TV0 A;  1NQI B;  4EA9 A;  2Q4J A;  3V90 A;  5DDV A;  1VZT A;  4HUR A;  2IC7 A;  1ZCV A;  4ZDQ A;  5C49 A;  4HUS A;  1R7T A;  4CJC A;  1LVW A;  1YRO B;  2JCL A;  3T57 A;  4ARW A;  2WLC A;  4FRP A;  3F1Y A;  1HM0 A;  5DDT A;  1S80 A;  2MZB A;  3IXC A;  3MQH A;  3P47 A;  1H5T A;  1HJL A;  4XWI A;  5J49 A;  3TK8 A;  2V0H A;  1V83 A;  5C8R A;  2QIV X;  3SXG A;  1NHE B;  1KK6 A;  5AFU V;  2VFZ A;  4AAW A;  2ICX A;  3BCV A;  2W0W A;  3C8V A;  1G8O A;  1O23 B;  1TW1 A;  4P02 A;  4EE3 A;  4M98 A;  5C4B A;  2D7R A;  1R7X A;  1MC3 A;  1WT1 A;  5FU8 A;  1KK5 A;  1W77 A;  2PGY A;  1SSM A;  3V0N A;  3ZLK A;  2AEC A;  1R7Y A;  1FXJ A;  4FRM A;  3CKJ A;  4M2B A;  5CQM X;  2IUA A;  5C3A A;  1VGU A;  5C3D A;  1QRL A;  4K6R A;  4KC2 A;  2ZU7 A;  1R7U A;  4EAA A;  1QQ0 A;  1VGW A;  4Y63 A;  5C48 A;  2JF2 A;  4M9C A;  4AYJ A;  1SSQ A;  4IHG A;  2FYD B;  2UX8 A;  3BFP A;  2IU9 A;  3LW6 A;  2RJ5 A;  2RJ7 A;  3EE5 A;  5CMF X;  3EG4 A;  3VBI A;  1FO9 A;  2O1F A;  3R3I A;  4HO8 A;  1VPA A;  2JCO A;  4IRP A;  3I0H A;  3JUJ A;  3VBM A;  4MZU A;  3BRK X;  2Y4J A;  3JTJ A;  3I0J A;  1FGG A;  1KGT A;  3U2U A;  4Y7F A;  3R2W A;  4BMA A;  3VBK A;  4G3P A;  4DEC A;  1R82 A;  4KC1 A;  2YES A;  1ZI5 A;  3OTZ A;  3I0D A;  3IOH A;  1H5S A;  1H7G A;  2CU2 A;  2WLD A;  1MRL A;  3IGJ A;  4M2A A;  1H4E A;  2V0L A;  4FRA A;  3V0Q A;  1FXO A;  2RJ9 A;  5EJ1 A;  4EEA A;  1TVY A;  2XME A;  1TW5 A;  2RJ1 A;  4Y6U A;  4IHH A;  3ZGF A;  4EAB A;  2FYA A;  1H7L A;  1GWV A;  3I0K A;  3FOQ A;  2XWM A;  3GOS A;  1MP3 A;  1MP5 A;  1H5T B;  4D0T A;  3SX7 A;  1OMZ A;  3SX5 A;  2VHE A;  3QVB A;  4HO2 A;  4IRQ A;  1T3D A;  1ZHJ A;  1W57 A;  1JVG A;  3TQD A;  1G97 A;  2A8U A;  2P2O A;  3SXB A;  2XAT A;  2VS3 A;  3PNN A;  1KK4 A;  2Y6P A;  3E25 A;  4HOC A;  3V0L A;  1FG5 N;  1ZCT A;  3OH0 A;  4MYB A;  4FRQ A;  2E8B A;  1G0R A;  3Q1X A;  1O7O A;  2RJ6 A;  1HV9 A;  4M28 A;  1PZT A;  2AGD A;  1LZ7 A;  4G87 A;  3Q7U A;  5DEM A;  4E6U A;  5I1F A;  3K8D A;  3GUE A;  2WGZ A;  1YP4 A;  3SXC A;  1FZW A;  1H7Q A;  3U0Y A;  4D11 A;  1LL0 A;  1H7H A;  2AES A;  2FFV A;  4HCQ A;  1MR9 A;  1QWJ A;  5BXC A;  3F1X A;  4FRL A;  2FYC B;  3OH2 A;  2D0J A;  4EA7 A;  2YCM A;  4HO9 A;  5JQQ A;  1G3L A;  5FYE A;  2V0I A;  2W0V A;  3DJ4 A;  3JQY A;  1LZI A;  3VBL A;  4KPX A;  1H7E A;  3SX8 A;  4Y7V A;  1QRF A;  2RIJ A;  1E5K A;  1ZJP A;  4NAI A;  5EIY A;  1Z90 A;  3OC9 A;  1H5S B;  3OTM A;  2WLF A;  4R37 A;  1INJ A;  1XHB A;  1V67 A;  1YP3 A;  4KC4 A;  1G2V A;  1VZU A;  3CU0 A;  4B5B A;  3PMO A;  3BSW A;  3CJ8 A;  1EYR A;  5ADX U;  4KNX A;  2Y4M A;  2V0K A;  5FV9 A;  3R5D A;  3V8Z A;  5C4D A;  3OW5 A;  3T7N A;  2YC3 A;  1ZCY A;  2VD4 A;  3VBP A;  4E79 A;  3OAM A;  5E3R A;  1S4O A;  2PGV A;  4N69 A;  3ZLL A;  4R7P A;  2JF3 A;  2GGO A;  4AC3 A;  4FRD A;  4FRH A;  2WAW A;  4J18 A;  2XWN A;  4EEG A;  4HZC A;  4KRV A;  1GX0 A;  3F1C A;  5CQO A;  2BO6 A;  3R5A A;  2WLE A;  3VNP A;  2YC5 A;  3I0L A;  3KWC A;  1VGT A;  1LXA A;  3FWW A;  2X65 A;  3RMW A;  3FSX A;  3OH1 A;  3KIA A;  5C36 A;  5CMH A;  1FR9 A;  2Y7A A;  3V0M A;  1LL3 A;  4JIS A;  3P1B A;  2P73 A;  2VXM A;  4NAN A;  2BO7 A;  4N27 A;  3V0P A;  5C4C A;  1HM8 A;  3FSB A;  3NGW A;  4FCE A;  4MND A;  4BQH A;  2RIX A;  1G95 A;  2I5K A;  2VSI A;  2QKX A;  4LW3 A;  2BO8 A;  5DEP A;  4EGG A;  1GX4 A;  2Z86 A;  3R8Y A;  2QH5 A;  1NKH B;  5C1H A;  1G23 A;  1ZDG A;  2AE7 A;  2WEE A;  2XMH A;  5CQN X;  5C4F A;  3E26 A;  1H7T A;  3N9W A;  2PX7 A;  4CVH A;  4HG6 A;  3RMV A;  3FSY A;  3U2X A;  2ZU8 A;  3ZF8 A;  4E1K A;  3OGZ A;  1H5S C;  3ECT A;  1HM9 A;  4H7O A;  4DCL A;  1MR7 A;  1JVD A;  3ZGG A;  4B4M A;  2WE9 A;  1VH1 A;  3Q4S A;  2P72 A;  3CKN A;  2I5E A;  2TDT A;  2PA4 A;  1W55 A;  3DK5 A;  4E75 A;  2FYB A;  4CJB A;  4D0Z A;  2V0J A;  3OU9 A;  2AM5 A;  4YS8 A;  5FU0 A;  3I0F A;  1FO8 A;  2RJ8 A;  1FR8 A;  4D48 A;  1ZJ3 A;  1WT0 A;  1EZI A;  2GGQ A;  2AM4 A;  2RIZ A;  3TZT A;  4KPZ A;  1ON8 A;  3FSC A;  1GA8 A;  1NMM B;  4Y7U A;  1OMX A;  5IDT A;  5C1G A;  1QG8 A;  2WVM A;  3POL A;  4ECM A;  2RIT A;  3I3A A;  1V84 A;  4DE7 A;  1G9R A;  2OI7 A;  5L6S A;  2OEF A;  3T7O A;  1H5S D;  1KRV A;  1S4N A;  4FRE A;  1V3W A;  3T7M A;  1ZJO A;  5C1L A;  4R36 A;  4L41 C;  2VS4 A;  2WVK A;  1NF5 B;  4Y7G A;  3V4E A;  4ASY A;  1YP2 A;  3VBJ A;  3SXA A;  5IFY A;  3R5B A;  3TDT A;  4FQW A;  4EA8 A;  4Y64 A;  1QGS A;  4C2S A;  3I0E A;  1ZDF A;  4EEM A;  4D11 C;  1GQC A;  2X5S A;  3K8E A;  4B2W A;  1R7V A;  3OH3 A;  3CGX A;  3SXE A;  1ZI1 A;  4Y9X A;  4KQL A;  4HO5 A;  4EQY A;  2VS5 A;  1JV3 A;  1VIC A;  3DHO A;  3OUP A;  1ZJ1 A;  5AJO A;  1XAT A;  3TIO A;  4HO3 A;  1GWW A;  3FS8 A;  4HZD A;  1R81 A; 
#chains in the Genus database with same CATH topology
 3MC4 A;  4ISX A;  5C38 A;  2I7B A;  3RSB A;  1KGQ A;  1LL2 A;  4Y6N A;  2AM3 A;  2JCJ A;  3I0C A;  4HO0 A;  1LZJ A;  3I0I X;  4EEO A;  1SS9 A;  1WT2 A;  3FTT A;  3CKV A;  1ZJ2 A;  5C4E A;  5L6V A;  3OKR A;  5ADX V;  4Y62 A;  2VSH A;  1ZJ0 A;  4MFG A;  3HJJ A;  3USR A;  3NZ2 A;  3TIS A;  5AFU U;  1HJJ A;  3EH0 A;  2YQH A;  4B3U A;  1FRW A;  2C0N A;  3GVD A;  1FOA A;  2BO4 A;  4FRO A;  2D7I A;  4EE5 A;  2ZU9 A;  2NXV A;  3IOI A;  1G93 A;  2J0A A;  1WVC A;  2A8W A;  3IOJ A;  3JUK A;  4KXO A;  2E3D A;  3SXD A;  4CJ8 A;  4FRB A;  4NAL A;  2RJ0 A;  5U2K A;  2FKO A;  3HSQ A;  1H5R A;  1ON6 A;  1ZI3 A;  3I3X A;  1I52 A;  1QRE A;  4KNR A;  4B4G A;  5IDS A;  3D98 A;  2OI6 A;  5AJN A;  1LZ0 A;  4LW6 A;  1JYL A;  3PKP A;  1QRG A;  4AA7 A;  3V8Y A;  1THJ A;  4B2X A;  5DG3 A;  1H7F A;  1VGZ A;  3HL3 A;  3R0S A;  5FTV A;  1VH3 A;  2YQJ A;  1PZY B;  4JD0 A;  1K4V A;  4DDZ A;  2FY7 A;  3U2W A;  1O7Q A;  1V82 A;  3SPT A;  2Y4K A;  3O3P A;  3R1W A;  1G1L A;  3SRT A;  1INI A;  4KT7 A;  2APC A;  2YQS A;  3BXY A;  3R5C A;  3D8V A;  1OQM B;  4N6B A;  3TWD A;  3CKO A;  2WVL A;  4HO4 A;  4P00 A;  3USQ A;  3SX3 A;  2O1H A;  2RJ4 A;  3V91 A;  2IU8 A;  1JYK A;  4GBP A;  4B4B A;  2X5Z A;  3MQG A;  1KHR A;  1FGX A;  5HS2 A;  5EJZ A;  1TDT A;  1GQ9 A;  3VBN A;  3OH4 A;  1OCX A;  1JV1 A;  4N6A A;  5AJP A;  1S4P A;  1XHD A;  3DUV A;  2WLG A;  1IIM A;  3I0G A;  3U2V A;  3D5N A;  1KWS A;  4M4K A;  4FCU A;  2RIY A;  1XZ6 A;  3EEV A;  3ST8 A;  1WSZ A;  3U2T A;  4UEG A;  2DPW A;  5CMG X;  2AH9 A;  3Q80 A;  2OEG A;  2XWL A;  2JCK A;  1ZI4 A;  4IHF A;  1H3M A;  3R3R A;  4EVW A;  4J09 A;  1FWY A;  4B42 A;  2QGI A;  2Z87 A;  1H4D A;  1VZX A;  3SUC A;  2QIA A;  4E6T A;  1H4C A;  1L0S A;  1WT3 A;  3CKQ A;  5FUH A;  2ICY A;  1QGQ A;  1R80 A;  4FIY A;  5E3Q A;  1TZF A;  2AQ9 A;  2O1G A;  4O6M A;  1ZIZ A;  5CQL X;  5CQP A;  5D91 A;  5C47 A;  4HO6 A;  1ZCU A;  2Y4L A;  5F42 A;  3BSY A;  4MYO A;  1H5R B;  2X60 A;  3KWE A;  2OI5 A;  1VM8 A;  4ASJ A;  3BSS A;  2YQC A;  1J2Z A;  1SST A;  3KWD A;  4EE4 A;  1KRR A;  4G3S A;  5E3P A;  3V0O A;  2FFU A;  4MIX A;  1O0R A;  2P6W A;  4NAK A;  3PKQ A;  5FTS A;  4Y7T A;  1QRM A;  4AYL A;  5C3B A;  5CMI A;  1MP4 A;  1NWG B;  4M99 A;  2VXL A;  3U0X A;  1KRU A;  5CMJ A;  4G3Q A;  2NPO A;  1IIN A;  1KQA A;  3TV0 A;  1NQI B;  4EA9 A;  2Q4J A;  3V90 A;  5DDV A;  1VZT A;  4HUR A;  2IC7 A;  1ZCV A;  4ZDQ A;  5C49 A;  4HUS A;  1R7T A;  4CJC A;  1LVW A;  1YRO B;  2JCL A;  3T57 A;  4ARW A;  2WLC A;  4FRP A;  3F1Y A;  1HM0 A;  5DDT A;  1S80 A;  2MZB A;  3IXC A;  3MQH A;  3P47 A;  1H5T A;  1HJL A;  4XWI A;  5J49 A;  3TK8 A;  2V0H A;  1V83 A;  5C8R A;  2QIV X;  3SXG A;  1NHE B;  1KK6 A;  5AFU V;  2VFZ A;  4AAW A;  2ICX A;  3BCV A;  2W0W A;  3C8V A;  1G8O A;  1O23 B;  1TW1 A;  4P02 A;  4EE3 A;  4M98 A;  5C4B A;  2D7R A;  1R7X A;  1MC3 A;  1WT1 A;  1EWW A;  5FU8 A;  1KK5 A;  1W77 A;  2PGY A;  1SSM A;  3V0N A;  3ZLK A;  2AEC A;  1R7Y A;  1FXJ A;  4FRM A;  3CKJ A;  4M2B A;  5CQM X;  2IUA A;  1M8N A;  5C3A A;  1VGU A;  5C3D A;  1QRL A;  4K6R A;  4KC2 A;  2ZU7 A;  1R7U A;  4EAA A;  1QQ0 A;  1VGW A;  4Y63 A;  5C48 A;  2JF2 A;  4M9C A;  2VK9 A;  4AYJ A;  1SSQ A;  4IHG A;  2FYD B;  2UX8 A;  3BFP A;  2IU9 A;  3LW6 A;  2RJ5 A;  2RJ7 A;  3EE5 A;  5CMF X;  3EG4 A;  3VBI A;  1FO9 A;  2O1F A;  3R3I A;  4HO8 A;  1VPA A;  2JCO A;  4IRP A;  3I0H A;  3JUJ A;  3VBM A;  4MZU A;  3BRK X;  2Y4J A;  3JTJ A;  3I0J A;  1FGG A;  1KGT A;  3U2U A;  4Y7F A;  3R2W A;  4BMA A;  3VBK A;  4G3P A;  4DEC A;  1R82 A;  4KC1 A;  2YES A;  1ZI5 A;  3OTZ A;  3I0D A;  3IOH A;  1H5S A;  1H7G A;  2CU2 A;  2WLD A;  1MRL A;  5D92 A;  3IGJ A;  4M2A A;  1H4E A;  2V0L A;  4FRA A;  3V0Q A;  1FXO A;  2RJ9 A;  5EJ1 A;  4EEA A;  4O6N A;  1TVY A;  2XME A;  1TW5 A;  2J0B A;  2RJ1 A;  4Y6U A;  4IHH A;  3ZGF A;  4EAB A;  2FYA A;  1H7L A;  1GWV A;  3I0K A;  3FOQ A;  2XWM A;  3GOS A;  1MP3 A;  1MP5 A;  1H5T B;  4D0T A;  3SX7 A;  1OMZ A;  3SX5 A;  2VHE A;  3GQA A;  3QVB A;  4HO2 A;  4IRQ A;  1T3D A;  1ZHJ A;  1W57 A;  1JVG A;  3TQD A;  1G97 A;  2A8U A;  2P2O A;  3SXB A;  2XAT A;  2VS3 A;  3PNN A;  1KK4 A;  2Y6P A;  3E25 A;  4HOC A;  3V0L A;  1FG5 N;  1ZCT A;  3OH0 A;  4MYB A;  4FRQ A;  2E8B A;  1G0R A;  3Q1X A;  1O7O A;  2RJ6 A;  1HV9 A;  4M28 A;  1PZT A;  2AGD A;  1LZ7 A;  4G87 A;  3Q7U A;  5DEM A;  4E6U A;  5I1F A;  3K8D A;  3GUE A;  2WGZ A;  1YP4 A;  3SXC A;  1FZW A;  1H7Q A;  3U0Y A;  4D11 A;  1LL0 A;  1H7H A;  2AES A;  2FFV A;  4HCQ A;  1MR9 A;  1QWJ A;  5BXC A;  3F1X A;  4FRL A;  2FYC B;  3GQ8 A;  3OH2 A;  2D0J A;  4EA7 A;  1Z2F A;  2YCM A;  4HO9 A;  5JQQ A;  1G3L A;  5FYE A;  2V0I A;  2W0V A;  3DJ4 A;  3JQY A;  1LZI A;  3VBL A;  4KPX A;  1H7E A;  3SX8 A;  4Y7V A;  1QRF A;  2RIJ A;  1E5K A;  1ZJP A;  4NAI A;  5EIY A;  1Z90 A;  3GQ7 A;  3OC9 A;  1H5S B;  3OTM A;  2WLF A;  4R37 A;  1INJ A;  1XHB A;  1V67 A;  1YP3 A;  4KC4 A;  1G2V A;  1VZU A;  3CU0 A;  4B5B A;  3PMO A;  3BSW A;  3CJ8 A;  1EYR A;  5ADX U;  4KNX A;  2Y4M A;  2V0K A;  5FV9 A;  3R5D A;  3V8Z A;  5C4D A;  3OW5 A;  3T7N A;  2YC3 A;  1ZCY A;  2VD4 A;  3VBP A;  4E79 A;  3OAM A;  5E3R A;  1S4O A;  2PGV A;  4N69 A;  3ZLL A;  4R7P A;  2JF3 A;  2GGO A;  4AC3 A;  4FRD A;  4FRH A;  2WAW A;  4J18 A;  2XWN A;  4EEG A;  4HZC A;  4KRV A;  1GX0 A;  3F1C A;  5CQO A;  2BO6 A;  3R5A A;  2WLE A;  3VNP A;  2YC5 A;  3I0L A;  3KWC A;  1VGT A;  1LXA A;  3FWW A;  2X65 A;  3RMW A;  3FSX A;  3OH1 A;  3KIA A;  5C36 A;  5CMH A;  1FR9 A;  2Y7A A;  3V0M A;  1LL3 A;  4JIS A;  3P1B A;  2P73 A;  2VXM A;  4NAN A;  2BO7 A;  4N27 A;  3V0P A;  5C4C A;  1HM8 A;  3FSB A;  3NGW A;  4FCE A;  4MND A;  4BQH A;  2RIX A;  1G95 A;  2I5K A;  2VSI A;  2QKX A;  4LW3 A;  2BO8 A;  5DEP A;  4EGG A;  1GX4 A;  2Z86 A;  3R8Y A;  2QH5 A;  1NKH B;  5C1H A;  1G23 A;  1ZDG A;  2AE7 A;  2WEE A;  3GQ9 A;  2XMH A;  5CQN X;  5C4F A;  3E26 A;  1H7T A;  3N9W A;  2PX7 A;  4CVH A;  4HG6 A;  3RMV A;  3FSY A;  3U2X A;  2ZU8 A;  3ZF8 A;  4E1K A;  3OGZ A;  1H5S C;  3ECT A;  1HM9 A;  4H7O A;  4DCL A;  1MR7 A;  1JVD A;  3ZGG A;  4B4M A;  2WE9 A;  1VH1 A;  3Q4S A;  2P72 A;  3CKN A;  2I5E A;  2TDT A;  2PA4 A;  1W55 A;  3DK5 A;  4E75 A;  2FYB A;  4CJB A;  4D0Z A;  2V0J A;  3OU9 A;  2AM5 A;  4YS8 A;  5FU0 A;  3I0F A;  1FO8 A;  2RJ8 A;  4FIX A;  1FR8 A;  4D48 A;  1ZJ3 A;  1WT0 A;  1EZI A;  2GGQ A;  2AM4 A;  2RIZ A;  3TZT A;  4KPZ A;  1ON8 A;  3FSC A;  1GA8 A;  1NMM B;  4Y7U A;  1OMX A;  5IDT A;  5C1G A;  1QG8 A;  2WVM A;  3POL A;  1N4I A;  4ECM A;  2RIT A;  3I3A A;  1V84 A;  4DE7 A;  1G9R A;  2OI7 A;  5L6S A;  2OEF A;  3T7O A;  1H5S D;  1KRV A;  1S4N A;  4FRE A;  1V3W A;  3T7M A;  1ZJO A;  5C1L A;  4R36 A;  4L41 C;  2VS4 A;  2WVK A;  1NF5 B;  4Y7G A;  3V4E A;  4ASY A;  1YP2 A;  4Q7C A;  3VBJ A;  3SXA A;  5IFY A;  3R5B A;  3TDT A;  4FQW A;  4EA8 A;  4Y64 A;  1QGS A;  4C2S A;  3I0E A;  1ZDF A;  4EEM A;  4D11 C;  1GQC A;  2X5S A;  3K8E A;  4B2W A;  3OH3 A;  1R7V A;  3CGX A;  3SXE A;  1ZI1 A;  4Y9X A;  4KQL A;  4HO5 A;  4EQY A;  2VS5 A;  1JV3 A;  1VIC A;  3DHO A;  3OUP A;  1ZJ1 A;  5AJO A;  1XAT A;  3TIO A;  4HO3 A;  1GWW A;  3FS8 A;  4HZD A;  1R81 A; 
#chains in the Genus database with same CATH homology
 3MC4 A;  4ISX A;  5C38 A;  2I7B A;  3RSB A;  1KGQ A;  1LL2 A;  4Y6N A;  2AM3 A;  2JCJ A;  3I0C A;  4HO0 A;  1LZJ A;  3I0I X;  4EEO A;  1SS9 A;  1WT2 A;  3FTT A;  3CKV A;  1ZJ2 A;  5C4E A;  5L6V A;  3OKR A;  5ADX V;  4Y62 A;  2VSH A;  1ZJ0 A;  4MFG A;  3HJJ A;  3USR A;  3NZ2 A;  3TIS A;  5AFU U;  1HJJ A;  3EH0 A;  2YQH A;  4B3U A;  1FRW A;  2C0N A;  3GVD A;  1FOA A;  2BO4 A;  4FRO A;  2D7I A;  4EE5 A;  2ZU9 A;  2NXV A;  3IOI A;  1G93 A;  2J0A A;  1WVC A;  2A8W A;  3IOJ A;  3JUK A;  4KXO A;  2E3D A;  3SXD A;  4CJ8 A;  4FRB A;  4NAL A;  2RJ0 A;  5U2K A;  2FKO A;  3HSQ A;  1H5R A;  1ON6 A;  1ZI3 A;  3I3X A;  1I52 A;  1QRE A;  4KNR A;  4B4G A;  5IDS A;  3D98 A;  2OI6 A;  5AJN A;  1LZ0 A;  4LW6 A;  1JYL A;  3PKP A;  1QRG A;  4AA7 A;  3V8Y A;  1THJ A;  4B2X A;  5DG3 A;  1H7F A;  1VGZ A;  3HL3 A;  3R0S A;  5FTV A;  1VH3 A;  2YQJ A;  1PZY B;  4JD0 A;  1K4V A;  4DDZ A;  2FY7 A;  3U2W A;  1O7Q A;  1V82 A;  3SPT A;  2Y4K A;  3O3P A;  3R1W A;  1G1L A;  3SRT A;  1INI A;  4KT7 A;  2APC A;  2YQS A;  3BXY A;  3R5C A;  3D8V A;  1OQM B;  4N6B A;  3TWD A;  3CKO A;  2WVL A;  4HO4 A;  4P00 A;  3USQ A;  3SX3 A;  2O1H A;  2RJ4 A;  3V91 A;  2IU8 A;  1JYK A;  4GBP A;  4B4B A;  2X5Z A;  3MQG A;  1KHR A;  1FGX A;  5HS2 A;  5EJZ A;  1TDT A;  1GQ9 A;  3VBN A;  3OH4 A;  1OCX A;  1JV1 A;  4N6A A;  5AJP A;  1S4P A;  1XHD A;  3DUV A;  2WLG A;  1IIM A;  3I0G A;  3U2V A;  3D5N A;  1KWS A;  4M4K A;  4FCU A;  2RIY A;  1XZ6 A;  3EEV A;  3ST8 A;  1WSZ A;  3U2T A;  4UEG A;  2DPW A;  5CMG X;  2AH9 A;  3Q80 A;  2OEG A;  2XWL A;  2JCK A;  1ZI4 A;  4IHF A;  1H3M A;  3R3R A;  4EVW A;  4J09 A;  1FWY A;  4B42 A;  2QGI A;  2Z87 A;  1H4D A;  1VZX A;  2QIA A;  4E6T A;  1H4C A;  1WT3 A;  3CKQ A;  5FUH A;  2ICY A;  1QGQ A;  1R80 A;  4FIY A;  5E3Q A;  1TZF A;  2AQ9 A;  2O1G A;  4O6M A;  1ZIZ A;  5CQL X;  5CQP A;  5D91 A;  5C47 A;  4HO6 A;  1ZCU A;  2Y4L A;  5F42 A;  3BSY A;  4MYO A;  1H5R B;  2X60 A;  3KWE A;  2OI5 A;  1VM8 A;  4ASJ A;  3BSS A;  2YQC A;  1J2Z A;  1SST A;  3KWD A;  4EE4 A;  1KRR A;  4G3S A;  5E3P A;  3V0O A;  2FFU A;  4MIX A;  1O0R A;  2P6W A;  4NAK A;  3PKQ A;  5FTS A;  4Y7T A;  1QRM A;  4AYL A;  5C3B A;  5CMI A;  1MP4 A;  1NWG B;  4M99 A;  2VXL A;  3U0X A;  1KRU A;  5CMJ A;  4G3Q A;  2NPO A;  1IIN A;  1KQA A;  3TV0 A;  1NQI B;  4EA9 A;  2Q4J A;  3V90 A;  5DDV A;  1VZT A;  4HUR A;  2IC7 A;  1ZCV A;  4ZDQ A;  5C49 A;  4HUS A;  1R7T A;  4CJC A;  1LVW A;  1YRO B;  2JCL A;  3T57 A;  4ARW A;  2WLC A;  4FRP A;  3F1Y A;  1HM0 A;  5DDT A;  1S80 A;  2MZB A;  3IXC A;  3MQH A;  3P47 A;  1H5T A;  1HJL A;  4XWI A;  5J49 A;  3TK8 A;  2V0H A;  1V83 A;  5C8R A;  2QIV X;  3SXG A;  1NHE B;  1KK6 A;  5AFU V;  2VFZ A;  4AAW A;  2ICX A;  3BCV A;  2W0W A;  3C8V A;  1G8O A;  1O23 B;  1TW1 A;  4P02 A;  4EE3 A;  4M98 A;  5C4B A;  2D7R A;  1R7X A;  1MC3 A;  1WT1 A;  5FU8 A;  1KK5 A;  1W77 A;  2PGY A;  1SSM A;  3V0N A;  3ZLK A;  2AEC A;  1R7Y A;  1FXJ A;  4FRM A;  3CKJ A;  4M2B A;  5CQM X;  2IUA A;  5C3A A;  1VGU A;  5C3D A;  1QRL A;  4K6R A;  4KC2 A;  2ZU7 A;  1R7U A;  4EAA A;  1QQ0 A;  1VGW A;  4Y63 A;  5C48 A;  2JF2 A;  4M9C A;  2VK9 A;  4AYJ A;  1SSQ A;  4IHG A;  2FYD B;  2UX8 A;  3BFP A;  2IU9 A;  3LW6 A;  2RJ5 A;  2RJ7 A;  3EE5 A;  5CMF X;  3EG4 A;  3VBI A;  1FO9 A;  2O1F A;  3R3I A;  4HO8 A;  1VPA A;  2JCO A;  4IRP A;  3I0H A;  3JUJ A;  3VBM A;  4MZU A;  3BRK X;  2Y4J A;  3JTJ A;  3I0J A;  1FGG A;  1KGT A;  3U2U A;  4Y7F A;  3R2W A;  4BMA A;  3VBK A;  4G3P A;  4DEC A;  1R82 A;  4KC1 A;  2YES A;  1ZI5 A;  3OTZ A;  3I0D A;  3IOH A;  1H5S A;  1H7G A;  2CU2 A;  2WLD A;  1MRL A;  5D92 A;  3IGJ A;  4M2A A;  1H4E A;  2V0L A;  4FRA A;  3V0Q A;  1FXO A;  2RJ9 A;  5EJ1 A;  4EEA A;  4O6N A;  1TVY A;  2XME A;  1TW5 A;  2J0B A;  2RJ1 A;  4Y6U A;  4IHH A;  3ZGF A;  4EAB A;  2FYA A;  1H7L A;  1GWV A;  3I0K A;  3FOQ A;  2XWM A;  3GOS A;  1MP3 A;  1MP5 A;  1H5T B;  4D0T A;  3SX7 A;  1OMZ A;  3SX5 A;  2VHE A;  3QVB A;  4HO2 A;  4IRQ A;  1T3D A;  1ZHJ A;  1W57 A;  1JVG A;  3TQD A;  1G97 A;  2A8U A;  2P2O A;  3SXB A;  2XAT A;  2VS3 A;  3PNN A;  1KK4 A;  2Y6P A;  3E25 A;  4HOC A;  3V0L A;  1FG5 N;  1ZCT A;  3OH0 A;  4MYB A;  4FRQ A;  2E8B A;  1G0R A;  3Q1X A;  1O7O A;  2RJ6 A;  1HV9 A;  4M28 A;  1PZT A;  2AGD A;  1LZ7 A;  4G87 A;  3Q7U A;  5DEM A;  4E6U A;  5I1F A;  3K8D A;  3GUE A;  2WGZ A;  1YP4 A;  3SXC A;  1FZW A;  1H7Q A;  3U0Y A;  4D11 A;  1LL0 A;  1H7H A;  2AES A;  2FFV A;  4HCQ A;  1MR9 A;  1QWJ A;  5BXC A;  3F1X A;  4FRL A;  2FYC B;  3OH2 A;  2D0J A;  4EA7 A;  2YCM A;  4HO9 A;  5JQQ A;  1G3L A;  5FYE A;  2V0I A;  2W0V A;  3DJ4 A;  3JQY A;  1LZI A;  3VBL A;  4KPX A;  1H7E A;  3SX8 A;  4Y7V A;  1QRF A;  2RIJ A;  1E5K A;  1ZJP A;  4NAI A;  5EIY A;  1Z90 A;  3OC9 A;  1H5S B;  3OTM A;  2WLF A;  4R37 A;  1INJ A;  1XHB A;  1V67 A;  1YP3 A;  4KC4 A;  1G2V A;  1VZU A;  3CU0 A;  4B5B A;  3PMO A;  3BSW A;  3CJ8 A;  1EYR A;  5ADX U;  4KNX A;  2Y4M A;  2V0K A;  5FV9 A;  3R5D A;  3V8Z A;  5C4D A;  3OW5 A;  3T7N A;  2YC3 A;  1ZCY A;  2VD4 A;  3VBP A;  4E79 A;  3OAM A;  5E3R A;  1S4O A;  2PGV A;  4N69 A;  3ZLL A;  4R7P A;  2JF3 A;  2GGO A;  4AC3 A;  4FRD A;  4FRH A;  2WAW A;  4J18 A;  2XWN A;  4EEG A;  4HZC A;  4KRV A;  1GX0 A;  3F1C A;  5CQO A;  2BO6 A;  3R5A A;  2WLE A;  3VNP A;  2YC5 A;  3I0L A;  3KWC A;  1VGT A;  1LXA A;  3FWW A;  2X65 A;  3RMW A;  3FSX A;  3OH1 A;  3KIA A;  5C36 A;  5CMH A;  1FR9 A;  2Y7A A;  3V0M A;  1LL3 A;  4JIS A;  3P1B A;  2P73 A;  2VXM A;  4NAN A;  2BO7 A;  4N27 A;  3V0P A;  5C4C A;  1HM8 A;  3FSB A;  3NGW A;  4FCE A;  4MND A;  4BQH A;  2RIX A;  1G95 A;  2I5K A;  2VSI A;  2QKX A;  4LW3 A;  2BO8 A;  5DEP A;  4EGG A;  1GX4 A;  2Z86 A;  3R8Y A;  2QH5 A;  1NKH B;  5C1H A;  1G23 A;  1ZDG A;  2AE7 A;  2WEE A;  2XMH A;  5CQN X;  5C4F A;  3E26 A;  1H7T A;  3N9W A;  2PX7 A;  4CVH A;  4HG6 A;  3RMV A;  3FSY A;  3U2X A;  2ZU8 A;  3ZF8 A;  4E1K A;  3OGZ A;  1H5S C;  3ECT A;  1HM9 A;  4H7O A;  4DCL A;  1MR7 A;  1JVD A;  3ZGG A;  4B4M A;  2WE9 A;  1VH1 A;  3Q4S A;  2P72 A;  3CKN A;  2I5E A;  2TDT A;  2PA4 A;  1W55 A;  3DK5 A;  4E75 A;  2FYB A;  4CJB A;  4D0Z A;  2V0J A;  3OU9 A;  2AM5 A;  4YS8 A;  5FU0 A;  3I0F A;  1FO8 A;  2RJ8 A;  4FIX A;  1FR8 A;  4D48 A;  1ZJ3 A;  1WT0 A;  1EZI A;  2GGQ A;  2AM4 A;  2RIZ A;  3TZT A;  4KPZ A;  1ON8 A;  3FSC A;  1GA8 A;  1NMM B;  4Y7U A;  1OMX A;  5IDT A;  5C1G A;  1QG8 A;  2WVM A;  3POL A;  4ECM A;  2RIT A;  3I3A A;  1V84 A;  4DE7 A;  1G9R A;  2OI7 A;  5L6S A;  2OEF A;  3T7O A;  1H5S D;  1KRV A;  1S4N A;  4FRE A;  1V3W A;  3T7M A;  1ZJO A;  5C1L A;  4R36 A;  4L41 C;  2VS4 A;  2WVK A;  1NF5 B;  4Y7G A;  3V4E A;  4ASY A;  1YP2 A;  4Q7C A;  3VBJ A;  3SXA A;  5IFY A;  3R5B A;  3TDT A;  4FQW A;  4EA8 A;  4Y64 A;  1QGS A;  4C2S A;  3I0E A;  1ZDF A;  4EEM A;  4D11 C;  1GQC A;  2X5S A;  3K8E A;  4B2W A;  1R7V A;  3OH3 A;  3CGX A;  3SXE A;  1ZI1 A;  4Y9X A;  4KQL A;  4HO5 A;  4EQY A;  2VS5 A;  1JV3 A;  1VIC A;  3DHO A;  3OUP A;  1ZJ1 A;  5AJO A;  1XAT A;  3TIO A;  4HO3 A;  1GWW A;  3FS8 A;  4HZD A;  1R81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...