3DJ4A

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Bifunctional protein glmU
publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 161
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dj4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dj4A01
4G3SA 4IHHA 4HOCA 5FU8A 1ZI4A 4B4BA 1FXJA 2RJ7A 4EEMA 1H7TA 2XATA 1O7QA 2VSIA 3TZTA 3I0GA 2QGIA 4AYJA 4EE5A 1KGQA 5IDTA 1KK5A 2I7BA 2VD4A 1R7VA 2O1GA 1GX0A 2TDTA 3OUPA 4DE7A 1LL0A 3EH0A 4G3PA 3TDTA 2ZU7A 3TISA 1ZDFA 1ZI5A 1ZIZA 3F1CA 1WT2A 4HO2A 4HUSA 4BMAA 2XWLA 3F1YA 3R5CA 3U0YA 2NXVA 3OH2A 1JVGA 5E3RA 3IGJA 1ZJ0A 2WLCA 3VBNA 1E5KA 1FR8A 3CKOA 1QREA 4MNDA 4H7OA 4KC1A 4C2SA 4HG6A 3I0JA 1H7LA 4DCLA 2RJ0A 3BFPA 1INIA 3ZLKA 2VXLA 3FSYA 3D98A 2VXMA 4HO9A 1KRVA 2Y4KA 4EEOA 3VBPA 5EJZA 2Q4JA 4FRQA 4NALA 3VBIA 1JYLA 3JUJA 4AA7A 1HJJA 1Z90A 5FTSA 3JTJA 1NQIB 1TW5A 4HCQA 1S4PA 2AH9A 3OU9A 2FYCB 5ADXU 3BXYA 1VZXA 3I0FA 3HSQA 2I5EA 5C48A 1R7UA 3BCVA 2WEEA 4IHFA 3Q4SA 5J49A 2WLDA 3VNPA 3IOIA 1ZI1A 3TV0A 1VH3A 2CU2A 4CJBA 1HM8A 1TW1A 1WSZA 5FU0A 5L6VA 5C38A 2VHEA 3OTZA 1KRUA 1GX4A 3EG4A 2YC3A 1QRMA 4Y7FA 1KGTA 1FO9A 1WT1A 3MQGA 2D0JA 1ZHJA 4MYBA 3BRKX 4KPXA 3QVBA 1KHRA 2D7RA 2BO8A 4ZDQA 3RMVA 1HM0A 2WLGA 1V67A 4EA9A 3KWCA 4NANA 1VGZA 2Y6PA 4EE3A 4E6UA 5CMIA 1O0RA 3I3XA 3V0LA 3CKJA 1FGXA 5C8RA 3POLA 4Y6UA 2RIXA 3ZF8A 1VH1A 4HO4A 1FXOA 3SXAA 4Y7VA 4J18A 1H4CA 2JCKA 5ADXV 2Z86A 3FS8A 3R0SA 2UX8A 3CKNA 3TWDA 4Y62A 1NF5B 1JYKA 1G95A 1MR9A 1GQCA 2JCJA 2Y7AA 1R81A 4FCUA 4D0TA 1S80A 2AECA 1QGSA 1MC3A 4IRQA 3U0XA 4J09A 3DJ4A 1KQAA 4GBPA 4EAAA 4FCEA 3TIOA 5BXCA 4HO0A 1FZWA 3KWDA 3D8VA 1NKHB 3FSXA 1QG8A 4R36A 2X60A 4FRBA 2RITA 2IC7A 3GVDA 4E75A 3Q7UA 2RJ6A 2O1FA 3DHOA 4B2XA 5FV9A 2O1HA 1LXAA 3Q1XA 3I0HA 1OMXA 5CQOA 1TVYA 2P6WA 1VGWA 2FFVA 1H7QA 3ZGGA 4FRMA 2W0VA 3OGZA 1YROB 1LZJA 1FG5N 1LL3A 4EABA 1R80A 1QGQA 5HS2A 2Z87A 1WT0A 2YQHA 1QRGA 5CQLX 1G97A 1KK6A 5CQMX 2RJ9A 4EEAA 3BSSA 3CGXA 1QRLA 1G8OA 1FR9A 2WE9A 2WGZA 1PZYB 4KC2A 5C36A 3FOQA 2VFZA 3OKRA 4KPZA 1H5TA 5AFUU 3T7MA 1R7YA 2QIVX 1GWVA 3CKVA 4BQHA 4KRVA 2RJ5A 2ICYA 1SS9A 4N27A 1V3WA 1EZIA 2WVKA 3USRA 3R2WA 1OCXA 5DG3A 3Q80A 4M2AA 2E3DA 1LZ7A 5DDVA 1FOAA 1QRFA 3OTMA 3P47A 1GQ9A 3U2VA 3SXCA 5C4BA 5C3AA 2AM3A 4CJCA 3OH3A 4B42A 3JQYA 3SX5A 1R7TA 4ASJA 1ZDGA 3RSBA 1S4OA 3V8ZA 4CJ8A 3P1BA 2WLEA 3CJ8A 3FTTA 1G9RA 2ZU9A 4EA7A 1QQ0A 4Y9XA 1H5SA 1O7OA 1KWSA 3VBMA 1WT3A 2PA4A 3EE5A 1JV1A 2IU9A 4E1KA 2P73A 4Y6NA 1O23B 1ON8A 1HV9A 4B2WA 4DDZA 1HM9A 3OH0A 3R5AA 4HZDA 5CMJA 1H7GA 1MP5A 3R1WA 1ZI3A 1K4VA 1VICA 1H7FA 4B5BA 4D48A 4ISXA 3R3RA 3GUEA 3SPTA 3V0QA 3OW5A 4HZCA 5AFUV 4KNXA 2WVMA 1H5SD 2XWMA 5AJOA 4ASYA 4EQYA 1VZUA 1JVDA 3I0CA 1H5TB 2RIYA 3PKQA 3FWWA 1YP3A 2YQSA 2XWNA 2V0HA 3TQDA 1LZIA 4HO8A 4MFGA 4B4MA 4FRDA 2OEFA 4D0ZA 3E26A 5CMGX 1MP3A 2D7IA 4KC4A 3JUKA 4D11A 2APCA 1MP4A 1T3DA 5EJ1A 4UEGA 1G0RA 2JF3A 3ZGFA 4B3UA 3OAMA 3DUVA 3K8DA 3PNNA 2V0IA 1G93A 3ST8A 1H7EA 2QH5A 2A8WA 1H4EA 1H5RA 3E25A 2JCLA 5FUHA 4Y64A 4XWIA 4KQLA 3V0PA 3CKQA 4FQWA 4ECMA 5CQNX 2E8BA 3VBKA 1SSQA 2ICXA 3V4EA 1W57A 2W0WA 1XZ6A 4IHGA 5C1GA 2OI5A 4JISA 5FYEA 5AJNA 5C47A 3I0DA 4FRHA 3KWEA 3I3AA 2DPWA 1I52A 1INJA 2VSHA 1VGTA 1G2VA 3BSYA 3C8VA 1H3MA 4E79A 3MQHA 3SX3A 2AESA 4G3QA 1VZTA 5C1LA 2IUAA 5DDTA 1HJLA 1NMMB 3SXDA 3N9WA 4P00A 3O3PA 3T7NA 1W77A 5C4CA 1OMZA 3DK5A 3U2UA 3HJJA 4L41C 4AYLA 1PZTA 2V0LA 4EVWA 3U2XA 3HL3A 4E6TA 4FRPA 5U2KA 3GOSA 4FRLA 1JV3A 1VPAA 2YESA 4HURA 2WVLA 1QWJA 2MZBA 4EE4A 3R3IA 1S4NA 5CMFX 1H5RB 5IFYA 2Y4MA 4LW3A 4Y7UA 2WAWA 1G23A 4HO5A 2OI7A 1G1LA 3SXEA 3R5BA 2A8UA 2YQJA 2BO7A 2RJ8A 1XATA 4KT7A 2PX7A 5CQPA 3D5NA 2RIJA 2BO6A 1YP2A 5FTVA 4P02A 4FRAA 2AE7A 4NAKA 2QIAA 2NPOA 3NZ2A 1MRLA 2WLFA 4N69A 2PGVA 2AGDA 2X65A 2JF2A 1GWWA 2OEGA 4M9CA 2BO4A 3I0KA 3IXCA 3USQA 1H5SC 2FY7A 2JCOA 2P72A 5C49A 2FYDB 1VM8A 4Y7TA 1R82A 3KIAA 1J2ZA 3R5DA 4N6BA 4EGGA 2VS4A 1SSMA 1KRRA 2FYBA 5DEPA 3FSCA 1ZCVA 4R37A 3ZLLA 4IRPA 2X5SA 1THJA 3U2TA 3V0OA 2V0JA 2YCMA 3ECTA 1FWYA 2FYAA 3V0NA 4G87A 1YP4A 1ZCYA 1IINA 3SX7A 3V91A 4HO3A 4D11C 3I0EA 1VGUA 1FRWA 1IIMA 1GA8A 1FGGA 4FREA 1ZJOA 4CVHA 3I0IX 4EEGA 4MYOA 2Y4JA 2AM5A 4M2BA 1H7HA 1XHDA 2X5ZA 3V90A 4KXOA 2RJ1A 2XMEA 3F1XA 2OI6A 4MZUA 3NGWA 4M4KA 3V0MA 3BSWA 5C3BA 3RMWA 4K6RA 1OQMB 3PKPA 2P2OA 3IOHA 2FKOA 4NAIA 4YS8A 2GGOA 1G3LA 4Y7GA 5CMHA 3SXBA 2AQ9A 4M28A 1TDTA 2QKXA 1LVWA 4B4GA 1TZFA 4Y63A 1H5SB 1R7XA 5IDSA 4ARWA 5JQQA 3LW6A 3T57A 4M99A 1WVCA 2VS5A 3SRTA 2YC5A 4FROA 5C1HA 1ZCTA 1LL2A 2PGYA 1EYRA 2RJ4A 5C4EA 1ZJ2A 4N6AA 3SXGA 4KNRA 5E3QA 1NHEB 3OH4A 2I5KA 3OC9A 4HO6A 3VBJA 4R7PA 3K8EA 5L6SA 5F42A 2FFUA 2AM4A 2YQCA 3V8YA 5C4FA 1LZ0A 2ZU8A 1MR7A 3R8YA 2GGQA 5EIYA 3SX8A 3T7OA 2RIZA 3I0LA 1ZJ3A 1ZJPA 2IU8A 4M98A 3MC4A 3VBLA 1KK4A 1ZCUA 4EA8A 1H4DA 3OH1A 3U2WA 5C3DA 5C4DA 3FSBA 4DECA 1FO8A 1SSTA 3TK8A 3EEVA 2VS3A 1V84A 1V82A 5DEMA 3PMOA 4AAWA 2V0KA 1NWGB 1V83A 3IOJA 4LW6A 5AJPA 5E3PA 1XHBA 3CU0A 1ZJ1A 2Y4LA 2XMHA 4AC3A 1ON6A 4JD0A 5I1FA 1W55A
chains in the Genus database with same CATH superfamily
4G3SA 4IHHA 4HOCA 5FU8A 1ZI4A 4B4BA 1FXJA 2RJ7A 4EEMA 1H7TA 2XATA 1O7QA 2VSIA 3TZTA 3I0GA 2QGIA 4AYJA 4EE5A 1KGQA 5IDTA 1KK5A 2I7BA 2VD4A 1R7VA 2O1GA 1GX0A 2TDTA 3OUPA 4DE7A 1LL0A 3EH0A 4G3PA 3TDTA 2ZU7A 3TISA 1ZDFA 1ZI5A 1ZIZA 3F1CA 1WT2A 4HO2A 4HUSA 4BMAA 2XWLA 3F1YA 3R5CA 3U0YA 2NXVA 3OH2A 1JVGA 5E3RA 3IGJA 1ZJ0A 2WLCA 3VBNA 1E5KA 1FR8A 3CKOA 1QREA 4MNDA 4H7OA 4KC1A 4C2SA 4HG6A 3I0JA 1H7LA 4DCLA 2RJ0A 3BFPA 1INIA 3ZLKA 2VXLA 3FSYA 3D98A 2VXMA 4HO9A 1KRVA 2Y4KA 4EEOA 3VBPA 5EJZA 2Q4JA 4FRQA 4NALA 3VBIA 1JYLA 3JUJA 4AA7A 1HJJA 1Z90A 5FTSA 3JTJA 1NQIB 1TW5A 4HCQA 1S4PA 2AH9A 3OU9A 2FYCB 5ADXU 3BXYA 1VZXA 3I0FA 3HSQA 2I5EA 5C48A 1R7UA 3BCVA 2WEEA 4IHFA 3Q4SA 5J49A 2WLDA 3VNPA 3IOIA 1ZI1A 3TV0A 1VH3A 2CU2A 4CJBA 1HM8A 1TW1A 1WSZA 5FU0A 5L6VA 5C38A 1N4IA 2VHEA 3OTZA 1KRUA 1GX4A 3EG4A 2YC3A 1QRMA 4Y7FA 1KGTA 1FO9A 1WT1A 3MQGA 2D0JA 1ZHJA 4MYBA 3BRKX 4KPXA 3QVBA 1KHRA 2D7RA 2BO8A 4ZDQA 3RMVA 1HM0A 2WLGA 1V67A 4EA9A 4Q7CA 3KWCA 4NANA 1VGZA 2Y6PA 4EE3A 4E6UA 5CMIA 1O0RA 3I3XA 3V0LA 3CKJA 1FGXA 5C8RA 3POLA 4Y6UA 2RIXA 3ZF8A 1VH1A 4HO4A 3SUCA 1FXOA 3SXAA 4Y7VA 4J18A 1H4CA 2JCKA 5ADXV 2Z86A 3FS8A 3R0SA 2UX8A 3CKNA 3TWDA 4Y62A 1NF5B 1JYKA 1G95A 1MR9A 1GQCA 2JCJA 2Y7AA 1R81A 4FCUA 4D0TA 1S80A 2AECA 1QGSA 1MC3A 4IRQA 3U0XA 4J09A 3DJ4A 1KQAA 4GBPA 4EAAA 4FCEA 3TIOA 5BXCA 4HO0A 1FZWA 3KWDA 3D8VA 1NKHB 3FSXA 3GQ9A 1QG8A 4R36A 2X60A 4FRBA 2RITA 2IC7A 3GVDA 4E75A 3Q7UA 2RJ6A 2O1FA 3DHOA 4B2XA 5FV9A 2O1HA 1LXAA 3Q1XA 3I0HA 1OMXA 5CQOA 1TVYA 2P6WA 1VGWA 2FFVA 1H7QA 3ZGGA 4FRMA 2W0VA 3OGZA 1YROB 1LZJA 1FG5N 1LL3A 4EABA 1R80A 1QGQA 5HS2A 2Z87A 1WT0A 2YQHA 1QRGA 5CQLX 1G97A 1KK6A 5CQMX 2RJ9A 4EEAA 3BSSA 3CGXA 1QRLA 1G8OA 1FR9A 2WE9A 2WGZA 1PZYB 4KC2A 5C36A 3FOQA 2VFZA 3OKRA 4KPZA 1H5TA 5AFUU 3T7MA 1R7YA 2QIVX 1GWVA 3CKVA 4BQHA 4KRVA 2RJ5A 2ICYA 1SS9A 4N27A 1V3WA 1EZIA 2WVKA 3USRA 3R2WA 1OCXA 5DG3A 3Q80A 4M2AA 2E3DA 1LZ7A 5DDVA 1FOAA 1QRFA 3OTMA 3P47A 1GQ9A 3U2VA 1EWWA 3SXCA 5C4BA 5C3AA 2AM3A 4CJCA 3OH3A 4MIXA 4B42A 3JQYA 3SX5A 1R7TA 4ASJA 1ZDGA 3RSBA 1S4OA 3V8ZA 4CJ8A 3P1BA 2WLEA 3GQAA 3CJ8A 3FTTA 1G9RA 2ZU9A 4EA7A 1QQ0A 4Y9XA 1H5SA 1O7OA 3VBMA 1KWSA 1WT3A 2PA4A 3EE5A 1JV1A 2IU9A 4E1KA 2P73A 4Y6NA 1O23B 1ON8A 1HV9A 4B2WA 4DDZA 1HM9A 3OH0A 3R5AA 4HZDA 5CMJA 1H7GA 1MP5A 3R1WA 1ZI3A 1K4VA 1VICA 1H7FA 4B5BA 4D48A 4ISXA 3R3RA 3GUEA 3SPTA 3V0QA 3OW5A 4HZCA 5AFUV 4KNXA 2WVMA 1H5SD 2XWMA 5AJOA 4ASYA 4EQYA 1VZUA 1JVDA 3I0CA 1H5TB 2RIYA 3PKQA 3FWWA 1YP3A 2YQSA 2XWNA 4O6NA 2V0HA 3TQDA 1LZIA 4HO8A 4MFGA 4B4MA 4FRDA 2OEFA 4D0ZA 3E26A 5CMGX 1MP3A 2D7IA 4KC4A 3JUKA 4D11A 2APCA 1MP4A 1T3DA 5EJ1A 4UEGA 1G0RA 2JF3A 3ZGFA 4B3UA 3OAMA 3DUVA 3K8DA 3PNNA 2V0IA 1G93A 3ST8A 1H7EA 2QH5A 2A8WA 1H4EA 1H5RA 3E25A 2JCLA 5FUHA 4Y64A 4XWIA 4KQLA 3V0PA 3CKQA 4FQWA 4ECMA 5CQNX 2E8BA 3VBKA 1SSQA 2ICXA 3V4EA 1W57A 2W0WA 1XZ6A 4IHGA 5C1GA 2OI5A 4JISA 5FYEA 5AJNA 5C47A 3I0DA 4FRHA 3KWEA 3I3AA 2DPWA 1I52A 1INJA 5D92A 2VSHA 1VGTA 1G2VA 3BSYA 3C8VA 1H3MA 4E79A 3MQHA 3SX3A 2AESA 4G3QA 1VZTA 5C1LA 2IUAA 5DDTA 1HJLA 1NMMB 3SXDA 3N9WA 4O6MA 4P00A 3O3PA 3T7NA 1W77A 5C4CA 1OMZA 3DK5A 3U2UA 3HJJA 4L41C 4AYLA 1PZTA 2V0LA 4EVWA 3U2XA 3HL3A 4E6TA 4FRPA 5U2KA 3GOSA 4FRLA 1JV3A 1VPAA 2YESA 4HURA 2WVLA 1QWJA 2MZBA 4EE4A 3R3IA 1S4NA 5CMFX 1H5RB 5IFYA 2Y4MA 4LW3A 4Y7UA 2WAWA 1G23A 4FIYA 4FIXA 4HO5A 1Z2FA 1M8NA 2OI7A 1G1LA 3SXEA 3R5BA 2A8UA 2YQJA 2BO7A 2RJ8A 1XATA 4KT7A 2PX7A 5CQPA 3D5NA 2RIJA 2BO6A 1YP2A 5FTVA 4P02A 4FRAA 2AE7A 4NAKA 2QIAA 2NPOA 3NZ2A 1MRLA 2WLFA 4N69A 2PGVA 2AGDA 2X65A 2JF2A 1GWWA 2OEGA 4M9CA 2BO4A 3I0KA 3IXCA 3USQA 1H5SC 3GQ8A 2FY7A 2JCOA 2P72A 5C49A 2FYDB 1VM8A 4Y7TA 1R82A 3KIAA 1J2ZA 3R5DA 4N6BA 4EGGA 2VS4A 1SSMA 1KRRA 2FYBA 5DEPA 3FSCA 1ZCVA 4R37A 3ZLLA 4IRPA 2X5SA 1THJA 3U2TA 3V0OA 2V0JA 2YCMA 3ECTA 1FWYA 2FYAA 3V0NA 4G87A 1YP4A 1ZCYA 1IINA 3SX7A 3V91A 4HO3A 4D11C 3I0EA 1VGUA 1FRWA 1IIMA 5D91A 1GA8A 1FGGA 4FREA 1ZJOA 4CVHA 3I0IX 4EEGA 4MYOA 2Y4JA 2AM5A 4M2BA 1H7HA 1XHDA 2X5ZA 3V90A 4KXOA 2RJ1A 2XMEA 3F1XA 2OI6A 4MZUA 3NGWA 4M4KA 3V0MA 3BSWA 5C3BA 2J0BA 3RMWA 4K6RA 1OQMB 3PKPA 2P2OA 3IOHA 2FKOA 4NAIA 4YS8A 2GGOA 1G3LA 4Y7GA 5CMHA 3SXBA 2AQ9A 4M28A 1TDTA 2QKXA 1LVWA 4B4GA 1TZFA 4Y63A 1H5SB 1R7XA 5IDSA 4ARWA 5JQQA 3LW6A 3T57A 4M99A 1WVCA 2VS5A 3SRTA 2J0AA 2YC5A 4FROA 5C1HA 1ZCTA 1LL2A 2PGYA 1EYRA 2RJ4A 5C4EA 1ZJ2A 4N6AA 3SXGA 4KNRA 3OH4A 5E3QA 1NHEB 2I5KA 3OC9A 4HO6A 3VBJA 4R7PA 3K8EA 5L6SA 5F42A 2FFUA 2AM4A 2YQCA 3V8YA 5C4FA 1LZ0A 2ZU8A 2C0NA 1MR7A 3R8YA 2GGQA 5EIYA 3SX8A 3T7OA 2RIZA 3I0LA 1ZJ3A 1ZJPA 2IU8A 1L0SA 4M98A 3MC4A 3VBLA 1KK4A 1ZCUA 3OH1A 4EA8A 1H4DA 3U2WA 5C3DA 5C4DA 3FSBA 4DECA 1FO8A 1SSTA 3TK8A 3EEVA 2VS3A 1V84A 1V82A 2VK9A 5DEMA 3PMOA 4AAWA 2V0KA 1NWGB 1V83A 3IOJA 4LW6A 5AJPA 5E3PA 1XHBA 3CU0A 1ZJ1A 2Y4LA 2XMHA 4AC3A 1ON6A 4JD0A 5I1FA 3GQ7A 1W55A
chains in the Genus database with same CATH topology
4G3SA 4IHHA 4HOCA 5FU8A 1ZI4A 4B4BA 1FXJA 2RJ7A 4EEMA 1H7TA 2XATA 1O7QA 2VSIA 3TZTA 3I0GA 2QGIA 4AYJA 4EE5A 1KGQA 5IDTA 1KK5A 2I7BA 2VD4A 1R7VA 2O1GA 1GX0A 2TDTA 3OUPA 4DE7A 1LL0A 3EH0A 4G3PA 3TDTA 2ZU7A 3TISA 1ZDFA 1ZI5A 1ZIZA 3F1CA 1WT2A 4HO2A 4HUSA 4BMAA 2XWLA 3F1YA 3R5CA 3U0YA 2NXVA 3OH2A 1JVGA 5E3RA 3IGJA 1ZJ0A 2WLCA 3VBNA 1E5KA 1FR8A 3CKOA 1QREA 4MNDA 4H7OA 4KC1A 4C2SA 4HG6A 3I0JA 1H7LA 4DCLA 2RJ0A 3BFPA 1INIA 3ZLKA 2VXLA 3FSYA 3D98A 2VXMA 4HO9A 1KRVA 2Y4KA 4EEOA 3VBPA 5EJZA 2Q4JA 4FRQA 4NALA 3VBIA 1JYLA 3JUJA 4AA7A 1HJJA 1Z90A 5FTSA 3JTJA 1NQIB 1TW5A 4HCQA 1S4PA 2AH9A 3OU9A 2FYCB 5ADXU 3BXYA 1VZXA 3I0FA 3HSQA 2I5EA 5C48A 1R7UA 3BCVA 2WEEA 4IHFA 3Q4SA 5J49A 2WLDA 3VNPA 3IOIA 1ZI1A 3TV0A 1VH3A 2CU2A 4CJBA 1HM8A 1TW1A 1WSZA 5FU0A 5L6VA 5C38A 2VHEA 3OTZA 1KRUA 1GX4A 3EG4A 2YC3A 1QRMA 4Y7FA 1KGTA 1FO9A 1WT1A 3MQGA 2D0JA 1ZHJA 4MYBA 3BRKX 4KPXA 3QVBA 1KHRA 2D7RA 2BO8A 4ZDQA 3RMVA 1HM0A 2WLGA 1V67A 4EA9A 4Q7CA 3KWCA 4NANA 1VGZA 2Y6PA 4EE3A 4E6UA 5CMIA 1O0RA 3I3XA 3V0LA 3CKJA 1FGXA 5C8RA 3POLA 4Y6UA 2RIXA 3ZF8A 1VH1A 4HO4A 1FXOA 3SXAA 4Y7VA 4J18A 1H4CA 2JCKA 5ADXV 2Z86A 3FS8A 3R0SA 2UX8A 3CKNA 3TWDA 4Y62A 1NF5B 1JYKA 1G95A 1MR9A 1GQCA 2JCJA 2Y7AA 1R81A 4FCUA 4D0TA 1S80A 2AECA 1QGSA 1MC3A 4IRQA 3U0XA 4J09A 3DJ4A 1KQAA 4GBPA 4EAAA 4FCEA 3TIOA 5BXCA 4HO0A 1FZWA 3KWDA 3D8VA 1NKHB 3FSXA 1QG8A 4R36A 2X60A 4FRBA 2RITA 2IC7A 3GVDA 4E75A 3Q7UA 2RJ6A 2O1FA 3DHOA 4B2XA 5FV9A 2O1HA 1LXAA 3Q1XA 3I0HA 1OMXA 5CQOA 1TVYA 2P6WA 1VGWA 2FFVA 1H7QA 3ZGGA 4FRMA 2W0VA 3OGZA 1YROB 1LZJA 1FG5N 1LL3A 4EABA 1R80A 1QGQA 5HS2A 2Z87A 1WT0A 2YQHA 1QRGA 5CQLX 1G97A 1KK6A 5CQMX 2RJ9A 4EEAA 3BSSA 3CGXA 1QRLA 1G8OA 1FR9A 2WE9A 2WGZA 1PZYB 4KC2A 5C36A 3FOQA 2VFZA 3OKRA 4KPZA 1H5TA 5AFUU 3T7MA 1R7YA 2QIVX 1GWVA 3CKVA 4BQHA 4KRVA 2RJ5A 2ICYA 1SS9A 4N27A 1V3WA 1EZIA 2WVKA 3USRA 3R2WA 1OCXA 5DG3A 3Q80A 4M2AA 2E3DA 1LZ7A 5DDVA 1FOAA 1QRFA 3OTMA 3P47A 1GQ9A 3U2VA 3SXCA 5C4BA 5C3AA 2AM3A 4CJCA 3OH3A 4MIXA 4B42A 3JQYA 3SX5A 1R7TA 4ASJA 1ZDGA 3RSBA 1S4OA 3V8ZA 4CJ8A 3P1BA 2WLEA 3CJ8A 3FTTA 1G9RA 2ZU9A 4EA7A 1QQ0A 4Y9XA 1H5SA 1O7OA 1KWSA 3VBMA 1WT3A 2PA4A 3EE5A 1JV1A 2IU9A 4E1KA 2P73A 4Y6NA 1O23B 1ON8A 1HV9A 4B2WA 4DDZA 1HM9A 3OH0A 3R5AA 4HZDA 5CMJA 1H7GA 1MP5A 3R1WA 1ZI3A 1K4VA 1VICA 1H7FA 4B5BA 4D48A 4ISXA 3R3RA 3GUEA 3SPTA 3V0QA 3OW5A 4HZCA 5AFUV 4KNXA 2WVMA 1H5SD 2XWMA 5AJOA 4ASYA 4EQYA 1VZUA 1JVDA 3I0CA 1H5TB 2RIYA 3PKQA 3FWWA 1YP3A 2YQSA 2XWNA 4O6NA 2V0HA 3TQDA 1LZIA 4HO8A 4MFGA 4B4MA 4FRDA 2OEFA 4D0ZA 3E26A 5CMGX 1MP3A 2D7IA 4KC4A 3JUKA 4D11A 2APCA 1MP4A 1T3DA 5EJ1A 4UEGA 1G0RA 2JF3A 3ZGFA 4B3UA 3OAMA 3DUVA 3K8DA 3PNNA 2V0IA 1G93A 3ST8A 1H7EA 2QH5A 2A8WA 1H4EA 1H5RA 3E25A 2JCLA 5FUHA 4Y64A 4XWIA 4KQLA 3V0PA 3CKQA 4FQWA 4ECMA 5CQNX 2E8BA 3VBKA 1SSQA 2ICXA 3V4EA 1W57A 2W0WA 1XZ6A 4IHGA 5C1GA 2OI5A 4JISA 5FYEA 5AJNA 5C47A 3I0DA 4FRHA 3KWEA 3I3AA 2DPWA 1I52A 1INJA 5D92A 2VSHA 1VGTA 1G2VA 3BSYA 3C8VA 1H3MA 4E79A 3MQHA 3SX3A 2AESA 4G3QA 1VZTA 5C1LA 2IUAA 5DDTA 1HJLA 1NMMB 3SXDA 3N9WA 4O6MA 4P00A 3O3PA 3T7NA 1W77A 5C4CA 1OMZA 3DK5A 3U2UA 3HJJA 4L41C 4AYLA 1PZTA 2V0LA 4EVWA 3U2XA 3HL3A 4E6TA 4FRPA 5U2KA 3GOSA 4FRLA 1JV3A 1VPAA 2YESA 4HURA 2WVLA 1QWJA 2MZBA 4EE4A 3R3IA 1S4NA 5CMFX 1H5RB 5IFYA 2Y4MA 4LW3A 4Y7UA 2WAWA 1G23A 4FIYA 4FIXA 4HO5A 2OI7A 1G1LA 3SXEA 3R5BA 2A8UA 2YQJA 2BO7A 2RJ8A 1XATA 4KT7A 2PX7A 5CQPA 3D5NA 2RIJA 2BO6A 1YP2A 5FTVA 4P02A 4FRAA 2AE7A 4NAKA 2QIAA 2NPOA 3NZ2A 1MRLA 2WLFA 4N69A 2PGVA 2AGDA 2X65A 2JF2A 1GWWA 2OEGA 4M9CA 2BO4A 3I0KA 3IXCA 3USQA 1H5SC 2FY7A 2JCOA 2P72A 5C49A 2FYDB 1VM8A 4Y7TA 1R82A 3KIAA 1J2ZA 3R5DA 4N6BA 4EGGA 2VS4A 1SSMA 1KRRA 2FYBA 5DEPA 3FSCA 1ZCVA 4R37A 3ZLLA 4IRPA 2X5SA 1THJA 3U2TA 3V0OA 2V0JA 2YCMA 3ECTA 1FWYA 2FYAA 3V0NA 4G87A 1YP4A 1ZCYA 1IINA 3SX7A 3V91A 4HO3A 4D11C 3I0EA 1VGUA 1FRWA 1IIMA 5D91A 1GA8A 1FGGA 4FREA 1ZJOA 4CVHA 3I0IX 4EEGA 4MYOA 2Y4JA 2AM5A 4M2BA 1H7HA 1XHDA 2X5ZA 3V90A 4KXOA 2RJ1A 2XMEA 3F1XA 2OI6A 4MZUA 3NGWA 4M4KA 3V0MA 3BSWA 5C3BA 2J0BA 3RMWA 4K6RA 1OQMB 3PKPA 2P2OA 3IOHA 2FKOA 4NAIA 4YS8A 2GGOA 1G3LA 4Y7GA 5CMHA 3SXBA 2AQ9A 4M28A 1TDTA 2QKXA 1LVWA 4B4GA 1TZFA 4Y63A 1H5SB 1R7XA 5IDSA 4ARWA 5JQQA 3LW6A 3T57A 4M99A 1WVCA 2VS5A 3SRTA 2J0AA 2YC5A 4FROA 5C1HA 1ZCTA 1LL2A 2PGYA 1EYRA 2RJ4A 5C4EA 1ZJ2A 4N6AA 3SXGA 4KNRA 5E3QA 1NHEB 3OH4A 2I5KA 3OC9A 4HO6A 3VBJA 4R7PA 3K8EA 5L6SA 5F42A 2FFUA 2AM4A 2YQCA 3V8YA 5C4FA 1LZ0A 2ZU8A 2C0NA 1MR7A 3R8YA 2GGQA 5EIYA 3SX8A 3T7OA 2RIZA 3I0LA 1ZJ3A 1ZJPA 2IU8A 4M98A 3MC4A 3VBLA 1KK4A 1ZCUA 4EA8A 1H4DA 3OH1A 3U2WA 5C3DA 5C4DA 3FSBA 4DECA 1FO8A 1SSTA 3TK8A 3EEVA 2VS3A 1V84A 1V82A 2VK9A 5DEMA 3PMOA 4AAWA 2V0KA 1NWGB 1V83A 3IOJA 4LW6A 5AJPA 5E3PA 1XHBA 3CU0A 1ZJ1A 2Y4LA 2XMHA 4AC3A 1ON6A 4JD0A 5I1FA 1W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3S A;  4IHH A;  4HOC A;  5FU8 A;  1ZI4 A;  4B4B A;  1FXJ A;  2RJ7 A;  4EEM A;  1H7T A;  2XAT A;  1O7Q A;  2VSI A;  3TZT A;  3I0G A;  2QGI A;  4AYJ A;  4EE5 A;  1KGQ A;  5IDT A;  1KK5 A;  2I7B A;  2VD4 A;  1R7V A;  2O1G A;  1GX0 A;  2TDT A;  3OUP A;  4DE7 A;  1LL0 A;  3EH0 A;  4G3P A;  3TDT A;  2ZU7 A;  3TIS A;  1ZDF A;  1ZI5 A;  1ZIZ A;  3F1C A;  1WT2 A;  4HO2 A;  4HUS A;  4BMA A;  2XWL A;  3F1Y A;  3R5C A;  3U0Y A;  2NXV A;  3OH2 A;  1JVG A;  5E3R A;  3IGJ A;  1ZJ0 A;  2WLC A;  3VBN A;  1E5K A;  1FR8 A;  3CKO A;  1QRE A;  4MND A;  4H7O A;  4KC1 A;  4C2S A;  4HG6 A;  3I0J A;  1H7L A;  4DCL A;  2RJ0 A;  3BFP A;  1INI A;  3ZLK A;  2VXL A;  3FSY A;  3D98 A;  2VXM A;  4HO9 A;  1KRV A;  2Y4K A;  4EEO A;  3VBP A;  5EJZ A;  2Q4J A;  4FRQ A;  4NAL A;  3VBI A;  1JYL A;  3JUJ A;  4AA7 A;  1HJJ A;  1Z90 A;  5FTS A;  3JTJ A;  1NQI B;  1TW5 A;  4HCQ A;  1S4P A;  2AH9 A;  3OU9 A;  2FYC B;  5ADX U;  3BXY A;  1VZX A;  3I0F A;  3HSQ A;  2I5E A;  5C48 A;  1R7U A;  3BCV A;  2WEE A;  4IHF A;  3Q4S A;  5J49 A;  2WLD A;  3VNP A;  3IOI A;  1ZI1 A;  3TV0 A;  1VH3 A;  2CU2 A;  4CJB A;  1HM8 A;  1TW1 A;  1WSZ A;  5FU0 A;  5L6V A;  5C38 A;  2VHE A;  3OTZ A;  1KRU A;  1GX4 A;  3EG4 A;  2YC3 A;  1QRM A;  4Y7F A;  1KGT A;  1FO9 A;  1WT1 A;  3MQG A;  2D0J A;  1ZHJ A;  4MYB A;  3BRK X;  4KPX A;  3QVB A;  1KHR A;  2D7R A;  2BO8 A;  4ZDQ A;  3RMV A;  1HM0 A;  2WLG A;  1V67 A;  4EA9 A;  3KWC A;  4NAN A;  1VGZ A;  2Y6P A;  4EE3 A;  4E6U A;  5CMI A;  1O0R A;  3I3X A;  3V0L A;  3CKJ A;  1FGX A;  5C8R A;  3POL A;  4Y6U A;  2RIX A;  3ZF8 A;  1VH1 A;  4HO4 A;  1FXO A;  3SXA A;  4Y7V A;  4J18 A;  1H4C A;  2JCK A;  5ADX V;  2Z86 A;  3FS8 A;  3R0S A;  2UX8 A;  3CKN A;  3TWD A;  4Y62 A;  1NF5 B;  1JYK A;  1G95 A;  1MR9 A;  1GQC A;  2JCJ A;  2Y7A A;  1R81 A;  4FCU A;  4D0T A;  1S80 A;  2AEC A;  1QGS A;  1MC3 A;  4IRQ A;  3U0X A;  4J09 A;  3DJ4 A;  1KQA A;  4GBP A;  4EAA A;  4FCE A;  3TIO A;  5BXC A;  4HO0 A;  1FZW A;  3KWD A;  3D8V A;  1NKH B;  3FSX A;  1QG8 A;  4R36 A;  2X60 A;  4FRB A;  2RIT A;  2IC7 A;  3GVD A;  4E75 A;  3Q7U A;  2RJ6 A;  2O1F A;  3DHO A;  4B2X A;  5FV9 A;  2O1H A;  1LXA A;  3Q1X A;  3I0H A;  1OMX A;  5CQO A;  1TVY A;  2P6W A;  1VGW A;  2FFV A;  1H7Q A;  3ZGG A;  4FRM A;  2W0V A;  3OGZ A;  1YRO B;  1LZJ A;  1FG5 N;  1LL3 A;  4EAB A;  1R80 A;  1QGQ A;  5HS2 A;  2Z87 A;  1WT0 A;  2YQH A;  1QRG A;  5CQL X;  1G97 A;  1KK6 A;  5CQM X;  2RJ9 A;  4EEA A;  3BSS A;  3CGX A;  1QRL A;  1G8O A;  1FR9 A;  2WE9 A;  2WGZ A;  1PZY B;  4KC2 A;  5C36 A;  3FOQ A;  2VFZ A;  3OKR A;  4KPZ A;  1H5T A;  5AFU U;  3T7M A;  1R7Y A;  2QIV X;  1GWV A;  3CKV A;  4BQH A;  4KRV A;  2RJ5 A;  2ICY A;  1SS9 A;  4N27 A;  1V3W A;  1EZI A;  2WVK A;  3USR A;  3R2W A;  1OCX A;  5DG3 A;  3Q80 A;  4M2A A;  2E3D A;  1LZ7 A;  5DDV A;  1FOA A;  1QRF A;  3OTM A;  3P47 A;  1GQ9 A;  3U2V A;  3SXC A;  5C4B A;  5C3A A;  2AM3 A;  4CJC A;  3OH3 A;  4B42 A;  3JQY A;  3SX5 A;  1R7T A;  4ASJ A;  1ZDG A;  3RSB A;  1S4O A;  3V8Z A;  4CJ8 A;  3P1B A;  2WLE A;  3CJ8 A;  3FTT A;  1G9R A;  2ZU9 A;  4EA7 A;  1QQ0 A;  4Y9X A;  1H5S A;  1O7O A;  1KWS A;  3VBM A;  1WT3 A;  2PA4 A;  3EE5 A;  1JV1 A;  2IU9 A;  4E1K A;  2P73 A;  4Y6N A;  1O23 B;  1ON8 A;  1HV9 A;  4B2W A;  4DDZ A;  1HM9 A;  3OH0 A;  3R5A A;  4HZD A;  5CMJ A;  1H7G A;  1MP5 A;  3R1W A;  1ZI3 A;  1K4V A;  1VIC A;  1H7F A;  4B5B A;  4D48 A;  4ISX A;  3R3R A;  3GUE A;  3SPT A;  3V0Q A;  3OW5 A;  4HZC A;  5AFU V;  4KNX A;  2WVM A;  1H5S D;  2XWM A;  5AJO A;  4ASY A;  4EQY A;  1VZU A;  1JVD A;  3I0C A;  1H5T B;  2RIY A;  3PKQ A;  3FWW A;  1YP3 A;  2YQS A;  2XWN A;  2V0H A;  3TQD A;  1LZI A;  4HO8 A;  4MFG A;  4B4M A;  4FRD A;  2OEF A;  4D0Z A;  3E26 A;  5CMG X;  1MP3 A;  2D7I A;  4KC4 A;  3JUK A;  4D11 A;  2APC A;  1MP4 A;  1T3D A;  5EJ1 A;  4UEG A;  1G0R A;  2JF3 A;  3ZGF A;  4B3U A;  3OAM A;  3DUV A;  3K8D A;  3PNN A;  2V0I A;  1G93 A;  3ST8 A;  1H7E A;  2QH5 A;  2A8W A;  1H4E A;  1H5R A;  3E25 A;  2JCL A;  5FUH A;  4Y64 A;  4XWI A;  4KQL A;  3V0P A;  3CKQ A;  4FQW A;  4ECM A;  5CQN X;  2E8B A;  3VBK A;  1SSQ A;  2ICX A;  3V4E A;  1W57 A;  2W0W A;  1XZ6 A;  4IHG A;  5C1G A;  2OI5 A;  4JIS A;  5FYE A;  5AJN A;  5C47 A;  3I0D A;  4FRH A;  3KWE A;  3I3A A;  2DPW A;  1I52 A;  1INJ A;  2VSH A;  1VGT A;  1G2V A;  3BSY A;  3C8V A;  1H3M A;  4E79 A;  3MQH A;  3SX3 A;  2AES A;  4G3Q A;  1VZT A;  5C1L A;  2IUA A;  5DDT A;  1HJL A;  1NMM B;  3SXD A;  3N9W A;  4P00 A;  3O3P A;  3T7N A;  1W77 A;  5C4C A;  1OMZ A;  3DK5 A;  3U2U A;  3HJJ A;  4L41 C;  4AYL A;  1PZT A;  2V0L A;  4EVW A;  3U2X A;  3HL3 A;  4E6T A;  4FRP A;  5U2K A;  3GOS A;  4FRL A;  1JV3 A;  1VPA A;  2YES A;  4HUR A;  2WVL A;  1QWJ A;  2MZB A;  4EE4 A;  3R3I A;  1S4N A;  5CMF X;  1H5R B;  5IFY A;  2Y4M A;  4LW3 A;  4Y7U A;  2WAW A;  1G23 A;  4HO5 A;  2OI7 A;  1G1L A;  3SXE A;  3R5B A;  2A8U A;  2YQJ A;  2BO7 A;  2RJ8 A;  1XAT A;  4KT7 A;  2PX7 A;  5CQP A;  3D5N A;  2RIJ A;  2BO6 A;  1YP2 A;  5FTV A;  4P02 A;  4FRA A;  2AE7 A;  4NAK A;  2QIA A;  2NPO A;  3NZ2 A;  1MRL A;  2WLF A;  4N69 A;  2PGV A;  2AGD A;  2X65 A;  2JF2 A;  1GWW A;  2OEG A;  4M9C A;  2BO4 A;  3I0K A;  3IXC A;  3USQ A;  1H5S C;  2FY7 A;  2JCO A;  2P72 A;  5C49 A;  2FYD B;  1VM8 A;  4Y7T A;  1R82 A;  3KIA A;  1J2Z A;  3R5D A;  4N6B A;  4EGG A;  2VS4 A;  1SSM A;  1KRR A;  2FYB A;  5DEP A;  3FSC A;  1ZCV A;  4R37 A;  3ZLL A;  4IRP A;  2X5S A;  1THJ A;  3U2T A;  3V0O A;  2V0J A;  2YCM A;  3ECT A;  1FWY A;  2FYA A;  3V0N A;  4G87 A;  1YP4 A;  1ZCY A;  1IIN A;  3SX7 A;  3V91 A;  4HO3 A;  4D11 C;  3I0E A;  1VGU A;  1FRW A;  1IIM A;  1GA8 A;  1FGG A;  4FRE A;  1ZJO A;  4CVH A;  3I0I X;  4EEG A;  4MYO A;  2Y4J A;  2AM5 A;  4M2B A;  1H7H A;  1XHD A;  2X5Z A;  3V90 A;  4KXO A;  2RJ1 A;  2XME A;  3F1X A;  2OI6 A;  4MZU A;  3NGW A;  4M4K A;  3V0M A;  3BSW A;  5C3B A;  3RMW A;  4K6R A;  1OQM B;  3PKP A;  2P2O A;  3IOH A;  2FKO A;  4NAI A;  4YS8 A;  2GGO A;  1G3L A;  4Y7G A;  5CMH A;  3SXB A;  2AQ9 A;  4M28 A;  1TDT A;  2QKX A;  1LVW A;  4B4G A;  1TZF A;  4Y63 A;  1H5S B;  1R7X A;  5IDS A;  4ARW A;  5JQQ A;  3LW6 A;  3T57 A;  4M99 A;  1WVC A;  2VS5 A;  3SRT A;  2YC5 A;  4FRO A;  5C1H A;  1ZCT A;  1LL2 A;  2PGY A;  1EYR A;  2RJ4 A;  5C4E A;  1ZJ2 A;  4N6A A;  3SXG A;  4KNR A;  5E3Q A;  1NHE B;  3OH4 A;  2I5K A;  3OC9 A;  4HO6 A;  3VBJ A;  4R7P A;  3K8E A;  5L6S A;  5F42 A;  2FFU A;  2AM4 A;  2YQC A;  3V8Y A;  5C4F A;  1LZ0 A;  2ZU8 A;  1MR7 A;  3R8Y A;  2GGQ A;  5EIY A;  3SX8 A;  3T7O A;  2RIZ A;  3I0L A;  1ZJ3 A;  1ZJP A;  2IU8 A;  4M98 A;  3MC4 A;  3VBL A;  1KK4 A;  1ZCU A;  4EA8 A;  1H4D A;  3OH1 A;  3U2W A;  5C3D A;  5C4D A;  3FSB A;  4DEC A;  1FO8 A;  1SST A;  3TK8 A;  3EEV A;  2VS3 A;  1V84 A;  1V82 A;  5DEM A;  3PMO A;  4AAW A;  2V0K A;  1NWG B;  1V83 A;  3IOJ A;  4LW6 A;  5AJP A;  5E3P A;  1XHB A;  3CU0 A;  1ZJ1 A;  2Y4L A;  2XMH A;  4AC3 A;  1ON6 A;  4JD0 A;  5I1F A;  1W55 A; 
#chains in the Genus database with same CATH topology
 4G3S A;  4IHH A;  4HOC A;  5FU8 A;  1ZI4 A;  4B4B A;  1FXJ A;  2RJ7 A;  4EEM A;  1H7T A;  2XAT A;  1O7Q A;  2VSI A;  3TZT A;  3I0G A;  2QGI A;  4AYJ A;  4EE5 A;  1KGQ A;  5IDT A;  1KK5 A;  2I7B A;  2VD4 A;  1R7V A;  2O1G A;  1GX0 A;  2TDT A;  3OUP A;  4DE7 A;  1LL0 A;  3EH0 A;  4G3P A;  3TDT A;  2ZU7 A;  3TIS A;  1ZDF A;  1ZI5 A;  1ZIZ A;  3F1C A;  1WT2 A;  4HO2 A;  4HUS A;  4BMA A;  2XWL A;  3F1Y A;  3R5C A;  3U0Y A;  2NXV A;  3OH2 A;  1JVG A;  5E3R A;  3IGJ A;  1ZJ0 A;  2WLC A;  3VBN A;  1E5K A;  1FR8 A;  3CKO A;  1QRE A;  4MND A;  4H7O A;  4KC1 A;  4C2S A;  4HG6 A;  3I0J A;  1H7L A;  4DCL A;  2RJ0 A;  3BFP A;  1INI A;  3ZLK A;  2VXL A;  3FSY A;  3D98 A;  2VXM A;  4HO9 A;  1KRV A;  2Y4K A;  4EEO A;  3VBP A;  5EJZ A;  2Q4J A;  4FRQ A;  4NAL A;  3VBI A;  1JYL A;  3JUJ A;  4AA7 A;  1HJJ A;  1Z90 A;  5FTS A;  3JTJ A;  1NQI B;  1TW5 A;  4HCQ A;  1S4P A;  2AH9 A;  3OU9 A;  2FYC B;  5ADX U;  3BXY A;  1VZX A;  3I0F A;  3HSQ A;  2I5E A;  5C48 A;  1R7U A;  3BCV A;  2WEE A;  4IHF A;  3Q4S A;  5J49 A;  2WLD A;  3VNP A;  3IOI A;  1ZI1 A;  3TV0 A;  1VH3 A;  2CU2 A;  4CJB A;  1HM8 A;  1TW1 A;  1WSZ A;  5FU0 A;  5L6V A;  5C38 A;  1N4I A;  2VHE A;  3OTZ A;  1KRU A;  1GX4 A;  3EG4 A;  2YC3 A;  1QRM A;  4Y7F A;  1KGT A;  1FO9 A;  1WT1 A;  3MQG A;  2D0J A;  1ZHJ A;  4MYB A;  3BRK X;  4KPX A;  3QVB A;  1KHR A;  2D7R A;  2BO8 A;  4ZDQ A;  3RMV A;  1HM0 A;  2WLG A;  1V67 A;  4EA9 A;  4Q7C A;  3KWC A;  4NAN A;  1VGZ A;  2Y6P A;  4EE3 A;  4E6U A;  5CMI A;  1O0R A;  3I3X A;  3V0L A;  3CKJ A;  1FGX A;  5C8R A;  3POL A;  4Y6U A;  2RIX A;  3ZF8 A;  1VH1 A;  4HO4 A;  3SUC A;  1FXO A;  3SXA A;  4Y7V A;  4J18 A;  1H4C A;  2JCK A;  5ADX V;  2Z86 A;  3FS8 A;  3R0S A;  2UX8 A;  3CKN A;  3TWD A;  4Y62 A;  1NF5 B;  1JYK A;  1G95 A;  1MR9 A;  1GQC A;  2JCJ A;  2Y7A A;  1R81 A;  4FCU A;  4D0T A;  1S80 A;  2AEC A;  1QGS A;  1MC3 A;  4IRQ A;  3U0X A;  4J09 A;  3DJ4 A;  1KQA A;  4GBP A;  4EAA A;  4FCE A;  3TIO A;  5BXC A;  4HO0 A;  1FZW A;  3KWD A;  3D8V A;  1NKH B;  3FSX A;  3GQ9 A;  1QG8 A;  4R36 A;  2X60 A;  4FRB A;  2RIT A;  2IC7 A;  3GVD A;  4E75 A;  3Q7U A;  2RJ6 A;  2O1F A;  3DHO A;  4B2X A;  5FV9 A;  2O1H A;  1LXA A;  3Q1X A;  3I0H A;  1OMX A;  5CQO A;  1TVY A;  2P6W A;  1VGW A;  2FFV A;  1H7Q A;  3ZGG A;  4FRM A;  2W0V A;  3OGZ A;  1YRO B;  1LZJ A;  1FG5 N;  1LL3 A;  4EAB A;  1R80 A;  1QGQ A;  5HS2 A;  2Z87 A;  1WT0 A;  2YQH A;  1QRG A;  5CQL X;  1G97 A;  1KK6 A;  5CQM X;  2RJ9 A;  4EEA A;  3BSS A;  3CGX A;  1QRL A;  1G8O A;  1FR9 A;  2WE9 A;  2WGZ A;  1PZY B;  4KC2 A;  5C36 A;  3FOQ A;  2VFZ A;  3OKR A;  4KPZ A;  1H5T A;  5AFU U;  3T7M A;  1R7Y A;  2QIV X;  1GWV A;  3CKV A;  4BQH A;  4KRV A;  2RJ5 A;  2ICY A;  1SS9 A;  4N27 A;  1V3W A;  1EZI A;  2WVK A;  3USR A;  3R2W A;  1OCX A;  5DG3 A;  3Q80 A;  4M2A A;  2E3D A;  1LZ7 A;  5DDV A;  1FOA A;  1QRF A;  3OTM A;  3P47 A;  1GQ9 A;  3U2V A;  1EWW A;  3SXC A;  5C4B A;  5C3A A;  2AM3 A;  4CJC A;  3OH3 A;  4MIX A;  4B42 A;  3JQY A;  3SX5 A;  1R7T A;  4ASJ A;  1ZDG A;  3RSB A;  1S4O A;  3V8Z A;  4CJ8 A;  3P1B A;  2WLE A;  3GQA A;  3CJ8 A;  3FTT A;  1G9R A;  2ZU9 A;  4EA7 A;  1QQ0 A;  4Y9X A;  1H5S A;  1O7O A;  3VBM A;  1KWS A;  1WT3 A;  2PA4 A;  3EE5 A;  1JV1 A;  2IU9 A;  4E1K A;  2P73 A;  4Y6N A;  1O23 B;  1ON8 A;  1HV9 A;  4B2W A;  4DDZ A;  1HM9 A;  3OH0 A;  3R5A A;  4HZD A;  5CMJ A;  1H7G A;  1MP5 A;  3R1W A;  1ZI3 A;  1K4V A;  1VIC A;  1H7F A;  4B5B A;  4D48 A;  4ISX A;  3R3R A;  3GUE A;  3SPT A;  3V0Q A;  3OW5 A;  4HZC A;  5AFU V;  4KNX A;  2WVM A;  1H5S D;  2XWM A;  5AJO A;  4ASY A;  4EQY A;  1VZU A;  1JVD A;  3I0C A;  1H5T B;  2RIY A;  3PKQ A;  3FWW A;  1YP3 A;  2YQS A;  2XWN A;  4O6N A;  2V0H A;  3TQD A;  1LZI A;  4HO8 A;  4MFG A;  4B4M A;  4FRD A;  2OEF A;  4D0Z A;  3E26 A;  5CMG X;  1MP3 A;  2D7I A;  4KC4 A;  3JUK A;  4D11 A;  2APC A;  1MP4 A;  1T3D A;  5EJ1 A;  4UEG A;  1G0R A;  2JF3 A;  3ZGF A;  4B3U A;  3OAM A;  3DUV A;  3K8D A;  3PNN A;  2V0I A;  1G93 A;  3ST8 A;  1H7E A;  2QH5 A;  2A8W A;  1H4E A;  1H5R A;  3E25 A;  2JCL A;  5FUH A;  4Y64 A;  4XWI A;  4KQL A;  3V0P A;  3CKQ A;  4FQW A;  4ECM A;  5CQN X;  2E8B A;  3VBK A;  1SSQ A;  2ICX A;  3V4E A;  1W57 A;  2W0W A;  1XZ6 A;  4IHG A;  5C1G A;  2OI5 A;  4JIS A;  5FYE A;  5AJN A;  5C47 A;  3I0D A;  4FRH A;  3KWE A;  3I3A A;  2DPW A;  1I52 A;  1INJ A;  5D92 A;  2VSH A;  1VGT A;  1G2V A;  3BSY A;  3C8V A;  1H3M A;  4E79 A;  3MQH A;  3SX3 A;  2AES A;  4G3Q A;  1VZT A;  5C1L A;  2IUA A;  5DDT A;  1HJL A;  1NMM B;  3SXD A;  3N9W A;  4O6M A;  4P00 A;  3O3P A;  3T7N A;  1W77 A;  5C4C A;  1OMZ A;  3DK5 A;  3U2U A;  3HJJ A;  4L41 C;  4AYL A;  1PZT A;  2V0L A;  4EVW A;  3U2X A;  3HL3 A;  4E6T A;  4FRP A;  5U2K A;  3GOS A;  4FRL A;  1JV3 A;  1VPA A;  2YES A;  4HUR A;  2WVL A;  1QWJ A;  2MZB A;  4EE4 A;  3R3I A;  1S4N A;  5CMF X;  1H5R B;  5IFY A;  2Y4M A;  4LW3 A;  4Y7U A;  2WAW A;  1G23 A;  4FIY A;  4FIX A;  4HO5 A;  1Z2F A;  1M8N A;  2OI7 A;  1G1L A;  3SXE A;  3R5B A;  2A8U A;  2YQJ A;  2BO7 A;  2RJ8 A;  1XAT A;  4KT7 A;  2PX7 A;  5CQP A;  3D5N A;  2RIJ A;  2BO6 A;  1YP2 A;  5FTV A;  4P02 A;  4FRA A;  2AE7 A;  4NAK A;  2QIA A;  2NPO A;  3NZ2 A;  1MRL A;  2WLF A;  4N69 A;  2PGV A;  2AGD A;  2X65 A;  2JF2 A;  1GWW A;  2OEG A;  4M9C A;  2BO4 A;  3I0K A;  3IXC A;  3USQ A;  1H5S C;  3GQ8 A;  2FY7 A;  2JCO A;  2P72 A;  5C49 A;  2FYD B;  1VM8 A;  4Y7T A;  1R82 A;  3KIA A;  1J2Z A;  3R5D A;  4N6B A;  4EGG A;  2VS4 A;  1SSM A;  1KRR A;  2FYB A;  5DEP A;  3FSC A;  1ZCV A;  4R37 A;  3ZLL A;  4IRP A;  2X5S A;  1THJ A;  3U2T A;  3V0O A;  2V0J A;  2YCM A;  3ECT A;  1FWY A;  2FYA A;  3V0N A;  4G87 A;  1YP4 A;  1ZCY A;  1IIN A;  3SX7 A;  3V91 A;  4HO3 A;  4D11 C;  3I0E A;  1VGU A;  1FRW A;  1IIM A;  5D91 A;  1GA8 A;  1FGG A;  4FRE A;  1ZJO A;  4CVH A;  3I0I X;  4EEG A;  4MYO A;  2Y4J A;  2AM5 A;  4M2B A;  1H7H A;  1XHD A;  2X5Z A;  3V90 A;  4KXO A;  2RJ1 A;  2XME A;  3F1X A;  2OI6 A;  4MZU A;  3NGW A;  4M4K A;  3V0M A;  3BSW A;  5C3B A;  2J0B A;  3RMW A;  4K6R A;  1OQM B;  3PKP A;  2P2O A;  3IOH A;  2FKO A;  4NAI A;  4YS8 A;  2GGO A;  1G3L A;  4Y7G A;  5CMH A;  3SXB A;  2AQ9 A;  4M28 A;  1TDT A;  2QKX A;  1LVW A;  4B4G A;  1TZF A;  4Y63 A;  1H5S B;  1R7X A;  5IDS A;  4ARW A;  5JQQ A;  3LW6 A;  3T57 A;  4M99 A;  1WVC A;  2VS5 A;  3SRT A;  2J0A A;  2YC5 A;  4FRO A;  5C1H A;  1ZCT A;  1LL2 A;  2PGY A;  1EYR A;  2RJ4 A;  5C4E A;  1ZJ2 A;  4N6A A;  3SXG A;  4KNR A;  3OH4 A;  5E3Q A;  1NHE B;  2I5K A;  3OC9 A;  4HO6 A;  3VBJ A;  4R7P A;  3K8E A;  5L6S A;  5F42 A;  2FFU A;  2AM4 A;  2YQC A;  3V8Y A;  5C4F A;  1LZ0 A;  2ZU8 A;  2C0N A;  1MR7 A;  3R8Y A;  2GGQ A;  5EIY A;  3SX8 A;  3T7O A;  2RIZ A;  3I0L A;  1ZJ3 A;  1ZJP A;  2IU8 A;  1L0S A;  4M98 A;  3MC4 A;  3VBL A;  1KK4 A;  1ZCU A;  3OH1 A;  4EA8 A;  1H4D A;  3U2W A;  5C3D A;  5C4D A;  3FSB A;  4DEC A;  1FO8 A;  1SST A;  3TK8 A;  3EEV A;  2VS3 A;  1V84 A;  1V82 A;  2VK9 A;  5DEM A;  3PMO A;  4AAW A;  2V0K A;  1NWG B;  1V83 A;  3IOJ A;  4LW6 A;  5AJP A;  5E3P A;  1XHB A;  3CU0 A;  1ZJ1 A;  2Y4L A;  2XMH A;  4AC3 A;  1ON6 A;  4JD0 A;  5I1F A;  3GQ7 A;  1W55 A; 
#chains in the Genus database with same CATH homology
 4G3S A;  4IHH A;  4HOC A;  5FU8 A;  1ZI4 A;  4B4B A;  1FXJ A;  2RJ7 A;  4EEM A;  1H7T A;  2XAT A;  1O7Q A;  2VSI A;  3TZT A;  3I0G A;  2QGI A;  4AYJ A;  4EE5 A;  1KGQ A;  5IDT A;  1KK5 A;  2I7B A;  2VD4 A;  1R7V A;  2O1G A;  1GX0 A;  2TDT A;  3OUP A;  4DE7 A;  1LL0 A;  3EH0 A;  4G3P A;  3TDT A;  2ZU7 A;  3TIS A;  1ZDF A;  1ZI5 A;  1ZIZ A;  3F1C A;  1WT2 A;  4HO2 A;  4HUS A;  4BMA A;  2XWL A;  3F1Y A;  3R5C A;  3U0Y A;  2NXV A;  3OH2 A;  1JVG A;  5E3R A;  3IGJ A;  1ZJ0 A;  2WLC A;  3VBN A;  1E5K A;  1FR8 A;  3CKO A;  1QRE A;  4MND A;  4H7O A;  4KC1 A;  4C2S A;  4HG6 A;  3I0J A;  1H7L A;  4DCL A;  2RJ0 A;  3BFP A;  1INI A;  3ZLK A;  2VXL A;  3FSY A;  3D98 A;  2VXM A;  4HO9 A;  1KRV A;  2Y4K A;  4EEO A;  3VBP A;  5EJZ A;  2Q4J A;  4FRQ A;  4NAL A;  3VBI A;  1JYL A;  3JUJ A;  4AA7 A;  1HJJ A;  1Z90 A;  5FTS A;  3JTJ A;  1NQI B;  1TW5 A;  4HCQ A;  1S4P A;  2AH9 A;  3OU9 A;  2FYC B;  5ADX U;  3BXY A;  1VZX A;  3I0F A;  3HSQ A;  2I5E A;  5C48 A;  1R7U A;  3BCV A;  2WEE A;  4IHF A;  3Q4S A;  5J49 A;  2WLD A;  3VNP A;  3IOI A;  1ZI1 A;  3TV0 A;  1VH3 A;  2CU2 A;  4CJB A;  1HM8 A;  1TW1 A;  1WSZ A;  5FU0 A;  5L6V A;  5C38 A;  2VHE A;  3OTZ A;  1KRU A;  1GX4 A;  3EG4 A;  2YC3 A;  1QRM A;  4Y7F A;  1KGT A;  1FO9 A;  1WT1 A;  3MQG A;  2D0J A;  1ZHJ A;  4MYB A;  3BRK X;  4KPX A;  3QVB A;  1KHR A;  2D7R A;  2BO8 A;  4ZDQ A;  3RMV A;  1HM0 A;  2WLG A;  1V67 A;  4EA9 A;  4Q7C A;  3KWC A;  4NAN A;  1VGZ A;  2Y6P A;  4EE3 A;  4E6U A;  5CMI A;  1O0R A;  3I3X A;  3V0L A;  3CKJ A;  1FGX A;  5C8R A;  3POL A;  4Y6U A;  2RIX A;  3ZF8 A;  1VH1 A;  4HO4 A;  1FXO A;  3SXA A;  4Y7V A;  4J18 A;  1H4C A;  2JCK A;  5ADX V;  2Z86 A;  3FS8 A;  3R0S A;  2UX8 A;  3CKN A;  3TWD A;  4Y62 A;  1NF5 B;  1JYK A;  1G95 A;  1MR9 A;  1GQC A;  2JCJ A;  2Y7A A;  1R81 A;  4FCU A;  4D0T A;  1S80 A;  2AEC A;  1QGS A;  1MC3 A;  4IRQ A;  3U0X A;  4J09 A;  3DJ4 A;  1KQA A;  4GBP A;  4EAA A;  4FCE A;  3TIO A;  5BXC A;  4HO0 A;  1FZW A;  3KWD A;  3D8V A;  1NKH B;  3FSX A;  1QG8 A;  4R36 A;  2X60 A;  4FRB A;  2RIT A;  2IC7 A;  3GVD A;  4E75 A;  3Q7U A;  2RJ6 A;  2O1F A;  3DHO A;  4B2X A;  5FV9 A;  2O1H A;  1LXA A;  3Q1X A;  3I0H A;  1OMX A;  5CQO A;  1TVY A;  2P6W A;  1VGW A;  2FFV A;  1H7Q A;  3ZGG A;  4FRM A;  2W0V A;  3OGZ A;  1YRO B;  1LZJ A;  1FG5 N;  1LL3 A;  4EAB A;  1R80 A;  1QGQ A;  5HS2 A;  2Z87 A;  1WT0 A;  2YQH A;  1QRG A;  5CQL X;  1G97 A;  1KK6 A;  5CQM X;  2RJ9 A;  4EEA A;  3BSS A;  3CGX A;  1QRL A;  1G8O A;  1FR9 A;  2WE9 A;  2WGZ A;  1PZY B;  4KC2 A;  5C36 A;  3FOQ A;  2VFZ A;  3OKR A;  4KPZ A;  1H5T A;  5AFU U;  3T7M A;  1R7Y A;  2QIV X;  1GWV A;  3CKV A;  4BQH A;  4KRV A;  2RJ5 A;  2ICY A;  1SS9 A;  4N27 A;  1V3W A;  1EZI A;  2WVK A;  3USR A;  3R2W A;  1OCX A;  5DG3 A;  3Q80 A;  4M2A A;  2E3D A;  1LZ7 A;  5DDV A;  1FOA A;  1QRF A;  3OTM A;  3P47 A;  1GQ9 A;  3U2V A;  3SXC A;  5C4B A;  5C3A A;  2AM3 A;  4CJC A;  3OH3 A;  4MIX A;  4B42 A;  3JQY A;  3SX5 A;  1R7T A;  4ASJ A;  1ZDG A;  3RSB A;  1S4O A;  3V8Z A;  4CJ8 A;  3P1B A;  2WLE A;  3CJ8 A;  3FTT A;  1G9R A;  2ZU9 A;  4EA7 A;  1QQ0 A;  4Y9X A;  1H5S A;  1O7O A;  1KWS A;  3VBM A;  1WT3 A;  2PA4 A;  3EE5 A;  1JV1 A;  2IU9 A;  4E1K A;  2P73 A;  4Y6N A;  1O23 B;  1ON8 A;  1HV9 A;  4B2W A;  4DDZ A;  1HM9 A;  3OH0 A;  3R5A A;  4HZD A;  5CMJ A;  1H7G A;  1MP5 A;  3R1W A;  1ZI3 A;  1K4V A;  1VIC A;  1H7F A;  4B5B A;  4D48 A;  4ISX A;  3R3R A;  3GUE A;  3SPT A;  3V0Q A;  3OW5 A;  4HZC A;  5AFU V;  4KNX A;  2WVM A;  1H5S D;  2XWM A;  5AJO A;  4ASY A;  4EQY A;  1VZU A;  1JVD A;  3I0C A;  1H5T B;  2RIY A;  3PKQ A;  3FWW A;  1YP3 A;  2YQS A;  2XWN A;  4O6N A;  2V0H A;  3TQD A;  1LZI A;  4HO8 A;  4MFG A;  4B4M A;  4FRD A;  2OEF A;  4D0Z A;  3E26 A;  5CMG X;  1MP3 A;  2D7I A;  4KC4 A;  3JUK A;  4D11 A;  2APC A;  1MP4 A;  1T3D A;  5EJ1 A;  4UEG A;  1G0R A;  2JF3 A;  3ZGF A;  4B3U A;  3OAM A;  3DUV A;  3K8D A;  3PNN A;  2V0I A;  1G93 A;  3ST8 A;  1H7E A;  2QH5 A;  2A8W A;  1H4E A;  1H5R A;  3E25 A;  2JCL A;  5FUH A;  4Y64 A;  4XWI A;  4KQL A;  3V0P A;  3CKQ A;  4FQW A;  4ECM A;  5CQN X;  2E8B A;  3VBK A;  1SSQ A;  2ICX A;  3V4E A;  1W57 A;  2W0W A;  1XZ6 A;  4IHG A;  5C1G A;  2OI5 A;  4JIS A;  5FYE A;  5AJN A;  5C47 A;  3I0D A;  4FRH A;  3KWE A;  3I3A A;  2DPW A;  1I52 A;  1INJ A;  5D92 A;  2VSH A;  1VGT A;  1G2V A;  3BSY A;  3C8V A;  1H3M A;  4E79 A;  3MQH A;  3SX3 A;  2AES A;  4G3Q A;  1VZT A;  5C1L A;  2IUA A;  5DDT A;  1HJL A;  1NMM B;  3SXD A;  3N9W A;  4O6M A;  4P00 A;  3O3P A;  3T7N A;  1W77 A;  5C4C A;  1OMZ A;  3DK5 A;  3U2U A;  3HJJ A;  4L41 C;  4AYL A;  1PZT A;  2V0L A;  4EVW A;  3U2X A;  3HL3 A;  4E6T A;  4FRP A;  5U2K A;  3GOS A;  4FRL A;  1JV3 A;  1VPA A;  2YES A;  4HUR A;  2WVL A;  1QWJ A;  2MZB A;  4EE4 A;  3R3I A;  1S4N A;  5CMF X;  1H5R B;  5IFY A;  2Y4M A;  4LW3 A;  4Y7U A;  2WAW A;  1G23 A;  4FIY A;  4FIX A;  4HO5 A;  2OI7 A;  1G1L A;  3SXE A;  3R5B A;  2A8U A;  2YQJ A;  2BO7 A;  2RJ8 A;  1XAT A;  4KT7 A;  2PX7 A;  5CQP A;  3D5N A;  2RIJ A;  2BO6 A;  1YP2 A;  5FTV A;  4P02 A;  4FRA A;  2AE7 A;  4NAK A;  2QIA A;  2NPO A;  3NZ2 A;  1MRL A;  2WLF A;  4N69 A;  2PGV A;  2AGD A;  2X65 A;  2JF2 A;  1GWW A;  2OEG A;  4M9C A;  2BO4 A;  3I0K A;  3IXC A;  3USQ A;  1H5S C;  2FY7 A;  2JCO A;  2P72 A;  5C49 A;  2FYD B;  1VM8 A;  4Y7T A;  1R82 A;  3KIA A;  1J2Z A;  3R5D A;  4N6B A;  4EGG A;  2VS4 A;  1SSM A;  1KRR A;  2FYB A;  5DEP A;  3FSC A;  1ZCV A;  4R37 A;  3ZLL A;  4IRP A;  2X5S A;  1THJ A;  3U2T A;  3V0O A;  2V0J A;  2YCM A;  3ECT A;  1FWY A;  2FYA A;  3V0N A;  4G87 A;  1YP4 A;  1ZCY A;  1IIN A;  3SX7 A;  3V91 A;  4HO3 A;  4D11 C;  3I0E A;  1VGU A;  1FRW A;  1IIM A;  5D91 A;  1GA8 A;  1FGG A;  4FRE A;  1ZJO A;  4CVH A;  3I0I X;  4EEG A;  4MYO A;  2Y4J A;  2AM5 A;  4M2B A;  1H7H A;  1XHD A;  2X5Z A;  3V90 A;  4KXO A;  2RJ1 A;  2XME A;  3F1X A;  2OI6 A;  4MZU A;  3NGW A;  4M4K A;  3V0M A;  3BSW A;  5C3B A;  2J0B A;  3RMW A;  4K6R A;  1OQM B;  3PKP A;  2P2O A;  3IOH A;  2FKO A;  4NAI A;  4YS8 A;  2GGO A;  1G3L A;  4Y7G A;  5CMH A;  3SXB A;  2AQ9 A;  4M28 A;  1TDT A;  2QKX A;  1LVW A;  4B4G A;  1TZF A;  4Y63 A;  1H5S B;  1R7X A;  5IDS A;  4ARW A;  5JQQ A;  3LW6 A;  3T57 A;  4M99 A;  1WVC A;  2VS5 A;  3SRT A;  2J0A A;  2YC5 A;  4FRO A;  5C1H A;  1ZCT A;  1LL2 A;  2PGY A;  1EYR A;  2RJ4 A;  5C4E A;  1ZJ2 A;  4N6A A;  3SXG A;  4KNR A;  5E3Q A;  1NHE B;  3OH4 A;  2I5K A;  3OC9 A;  4HO6 A;  3VBJ A;  4R7P A;  3K8E A;  5L6S A;  5F42 A;  2FFU A;  2AM4 A;  2YQC A;  3V8Y A;  5C4F A;  1LZ0 A;  2ZU8 A;  2C0N A;  1MR7 A;  3R8Y A;  2GGQ A;  5EIY A;  3SX8 A;  3T7O A;  2RIZ A;  3I0L A;  1ZJ3 A;  1ZJP A;  2IU8 A;  4M98 A;  3MC4 A;  3VBL A;  1KK4 A;  1ZCU A;  4EA8 A;  1H4D A;  3OH1 A;  3U2W A;  5C3D A;  5C4D A;  3FSB A;  4DEC A;  1FO8 A;  1SST A;  3TK8 A;  3EEV A;  2VS3 A;  1V84 A;  1V82 A;  2VK9 A;  5DEM A;  3PMO A;  4AAW A;  2V0K A;  1NWG B;  1V83 A;  3IOJ A;  4LW6 A;  5AJP A;  5E3P A;  1XHB A;  3CU0 A;  1ZJ1 A;  2Y4L A;  2XMH A;  4AC3 A;  1ON6 A;  4JD0 A;  5I1F A;  1W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...