3DJ4A

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PknB-mediated phosphorylation of a novel substrate, N-acetylglucosamine-1-phosphate uridyltransferase, modulates its acetyltransferase activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Bifunctional protein glmU
total genus 161
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3dj4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3dj4A01
2JCOA 2I5KA 2IU8A 5F42A 4EA8A 3VBNA 4MZUA 4M2BA 5C4DA 2ZU7A 5FU8A 2CU2A 2ZU8A 4FRPA 4EGGA 3CKNA 2RJ9A 1ZJOA 1H5TA 4G3QA 1OMZA 1VH1A 4HOCA 3OH4A 4FREA 1GQCA 2MZBA 4EEAA 1FR9A 1ZHJA 1H5SB 1HM0A 1ZCTA 3U2TA 1SSMA 2ICXA 4J18A 1SSQA 2APCA 2P6WA 5FU0A 3V8YA 3VBJA 3V4EA 4DCLA 4HURA 5E3RA 1FG5N 1ZJ3A 4EABA 2A8UA 3FSBA 2AESA 2FYDB 3JTJA 3K8EA 3PNNA 1VH3A 2WLGA 2RIJA 5CQOA 1EZIA 4HZCA 1PZTA 4G3PA 2X5SA 1KK5A 3ZGFA 1XHBA 3EG4A 3I0DA 3V0QA 4D11C 4DDZA 2VS3A 3P47A 3SPTA 4EA7A 5C49A 2RITA 5C1LA 5FUHA 5CMIA 4FQWA 5IDSA 2V0KA 4BQHA 2VSIA 3TISA 2FYCB 1WT2A 1KK6A 4M4KA 2IC7A 5CMGX 4B42A 5FYEA 2V0LA 1JVDA 4HO6A 2OI5A 2QIVX 4FRLA 2XMEA 2WLDA 3FSCA 1WVCA 1H3MA 1R80A 2IU9A 2FYBA 3FWWA 4FRBA 2BO7A 3SRTA 4B2WA 1FGXA 2XWLA 4E1KA 3T7MA 3I0KA 5C3BA 1LZ0A 3V90A 3BFPA 4ASYA 4H7OA 4N6BA 5C1GA 4R7PA 1LXAA 3I3XA 2WVLA 1H4DA 2RJ1A 4P02A 2YC3A 1ZDFA 1HM9A 1QRGA 1YROB 4DECA 1OCXA 3C8VA 2WLFA 5E3QA 5C4BA 1GX0A 1LL3A 4EEGA 2IUAA 2VXLA 3POLA 1FGGA 5AFUV 5ADXV 3OH3A 1G0RA 2ICYA 2NXVA 4FCUA 3V0LA 1H5SA 4FRQA 4EE5A 4GBPA 1HV9A 1R7TA 3OAMA 1R7YA 1VGZA 1W55A 2VXMA 1ZJ1A 1TDTA 3R5BA 5EJ1A 2JCJA 4KC2A 5DDVA 3KIAA 1JYLA 4FRAA 4FRHA 1EYRA 1HJJA 3ST8A 3VBIA 2AE7A 3F1YA 1FOAA 3OH2A 4E75A 1YP2A 1QG8A 1FO8A 1W57A 1ZCUA 2VD4A 4M28A 1G8OA 1KRUA 1S80A 2YESA 3IOJA 1R7UA 3SX7A 3BSWA 2FYAA 2Y7AA 5CQMX 3EEVA 1TZFA 4NANA 2YQHA 3OGZA 4ECMA 2Y4JA 3DJ4A 4Y62A 4IHGA 2PX7A 1ZDGA 3U2XA 4MFGA 3V0MA 2WLEA 2PA4A 3OUPA 1KQAA 2VS5A 4EAAA 5C48A 1H4CA 4IRPA 1MP3A 1LZIA 3ECTA 3MQHA 3IXCA 4KC1A 1MR9A 1S4NA 4UEGA 3VBKA 2WVKA 1FXOA 4EE3A 3I0IX 3NZ2A 1NHEB 4B4MA 3U0YA 4KPZA 1TW1A 3OU9A 2P2OA 1O23B 3CKOA 3Q7UA 3T7OA 1G93A 1K4VA 2GGOA 2OI6A 1O7OA 4Y9XA 1KRVA 3T57A 2RIXA 2AGDA 1KK4A 3P1BA 4HG6A 2OEGA 2RIYA 2O1HA 4EQYA 1PZYB 3DHOA 1QQ0A 1NQIB 2XWNA 3PKQA 2P73A 2W0VA 2D7RA 4G3SA 1MP5A 2P72A 1G2VA 4HO8A 1VGTA 3FS8A 3TK8A 4KNRA 1O7QA 2Z86A 3I0LA 3OH1A 4L41C 5DEMA 5DEPA 4M98A 2OEFA 2JF2A 3USQA 4HCQA 4N27A 1OQMB 2Z87A 4Y7GA 4EA9A 1S4OA 4Y7TA 4D11A 3R8YA 2WGZA 1FRWA 1FZWA 4IHHA 1R7VA 4Y7UA 3FSXA 3CKJA 1VPAA 2NPOA 1V82A 2XATA 5E3PA 4JISA 5FV9A 4E79A 1H7HA 4CJ8A 3BSYA 5C4FA 1WSZA 5DDTA 4ZDQA 2I5EA 1LL2A 2Y4KA 2X65A 1WT0A 3TZTA 4KQLA 2QGIA 4D48A 1SS9A 5L6VA 4N69A 3V8ZA 4IHFA 4ARWA 2BO6A 1G9RA 3D98A 5JQQA 4M2AA 2Y4LA 2RJ8A 5BXCA 5C4EA 3USRA 4HO5A 3U2VA 2D0JA 1R7XA 3RSBA 2X5ZA 1FR8A 2FKOA 5CQNX 5IDTA 3V0NA 3R3RA 5FTSA 1KRRA 1THJA 3FTTA 1H7LA 3D5NA 1G23A 5CQPA 1VZUA 5EJZA 4EEOA 1LZ7A 3ZLKA 2OI7A 1JV1A 3R1WA 2AQ9A 2VFZA 5J49A 5IFYA 3F1CA 1YP4A 3V0PA 4EE4A 3HJJA 3KWDA 3FOQA 3I0JA 3SXGA 3T7NA 3K8DA 1H5SC 2FY7A 3CU0A 4NAIA 1H5TB 1H7TA 1INJA 1J2ZA 4E6TA 2DPWA 2Y6PA 2V0IA 3IGJA 1ZI1A 1MC3A 1FXJA 1ZI4A 3N9WA 3LW6A 3I0FA 4R37A 4IRQA 4MNDA 3CJ8A 4G87A 1ZI3A 1VZTA 2FFVA 3PKPA 1H7EA 4DE7A 4YS8A 1MR7A 2WEEA 4KRVA 3V0OA 1H7QA 3I0HA 3SX5A 4FRMA 2RIZA 2O1FA 4XWIA 1HJLA 4AYJA 1I52A 4B5BA 1G97A 1XHDA 1H4EA 3R2WA 1VZXA 2ZU9A 4D0TA 2V0JA 1R82A 1JV3A 2PGYA 3Q1XA 1ZI5A 2RJ6A 2Q4JA 3JQYA 1XZ6A 2BO4A 2XMHA 1VGUA 2O1GA 1GWVA 2PGVA 4Y6NA 4Y64A 1MRLA 1QRLA 2YCMA 1H5SD 1KGQA 4KPXA 2AH9A 3KWCA 2E8BA 4Y7VA 1R81A 3F1XA 3ZF8A 1FO9A 4BMAA 2QH5A 5AJPA 1VM8A 2WAWA 1QRFA 3SXBA 5CQLX 4HO0A 4Y6UA 3ZGGA 1LVWA 3U2UA 2GGQA 3IOHA 1TVYA 4AYLA 3SX3A 4KT7A 1NWGB 3KWEA 2YQJA 4Y63A 3SXDA 5I1FA 1ZJ2A 4B2XA 1T3DA 2BO8A 4R36A 2RJ7A 4NALA 2W0WA 1S4PA 5C1HA 3I0EA 3VNPA 3EH0A 3VBPA 3BCVA 1LZJA 3Q80A 4C2SA 4HO4A 4HO3A 3MC4A 1LL0A 2AM4A 4D0ZA 1QWJA 4AC3A 2AM3A 1OMXA 2Y4MA 2YQSA 2I7BA 4ASJA 5EIYA 3EE5A 2FFUA 4LW6A 4B4GA 1NMMB 3OKRA 5CMJA 1IIMA 1GQ9A 5AJOA 1ZCYA 2V0HA 2JCKA 3OH0A 1H5RA 1MP4A 1O0RA 5C3DA 4JD0A 5ADXU 2WVMA 2UX8A 1G95A 3OC9A 3R5AA 1FWYA 5FTVA 1WT3A 4M99A 2RJ0A 3JUJA 2VHEA 4CJBA 2JF3A 3R5CA 3CKVA 3DK5A 2RJ4A 1GA8A 2E3DA 4HZDA 4MYOA 4EVWA 3E25A 2AM5A 1KHRA 2YC5A 4J09A 1G3LA 4KC4A 2RJ5A 3SXCA 1YP3A 3R0SA 4E6UA 1JVGA 4MYBA 1QRMA 5L6SA 4KNXA 3GUEA 1GX4A 4NAKA 1HM8A 4EEMA 4B3UA 4M9CA 1ON6A 3IOIA 3U0XA 4K6RA 5C4CA 3BSSA 1E5KA 3CKQA 1VGWA 1GWWA 3SX8A 1Z90A 3VBMA 4KXOA 3R5DA 1NKHB 2VSHA 3ZLLA 5C47A 3GVDA 5CMHA 3GOSA 3JUKA 4FROA 3OTMA 1G1LA 4AA7A 3NGWA 5C8RA 2QIAA 3OTZA 4HUSA 1ZJ0A 3I3AA 2QKXA 1ZJPA 2VS4A 4CVHA 1IINA 1V67A 1VICA 4FCEA 1XATA 4FRDA 1H7GA 3HL3A 4LW3A 1V3WA 5DG3A 1WT1A 3HSQA 1V84A 1QGSA 1ON8A 1QGQA 3OW5A 1V83A 4CJCA 5HS2A 3CGXA 1JYKA 4HO9A 3BRKX 3Q4SA 2WLCA 3QVBA 3O3PA 3TV0A 1QREA 4P00A 3TQDA 3PMOA 1TW5A 2A8WA 3RMWA 1INIA 2X60A 3DUVA 5CMFX 1H5RB 1NF5B 5AJNA 3U2WA 3I0GA 4Y7FA 4AAWA 3FSYA 1KWSA 5C3AA 3TIOA 3R3IA 3TDTA 2TDTA 1SSTA 1W77A 3SXAA 1ZIZA 1KGTA 2YQCA 3I0CA 3E26A 4B4BA 5U2KA 2D7IA 2JCLA 3V91A 4N6AA 4HO2A 3VBLA 5C38A 5AFUU 3MQGA 3BXYA 3TWDA 2XWMA 3SXEA 3D8VA 5C36A 4ISXA 3RMVA 1H7FA 1ZCVA 2WE9A 2AECA
chains in the Genus database with same CATH superfamily
2JCOA 2I5KA 2IU8A 5F42A 4EA8A 3VBNA 4MZUA 4M2BA 5C4DA 2ZU7A 5FU8A 2CU2A 2ZU8A 4FRPA 4EGGA 3CKNA 2RJ9A 1ZJOA 1H5TA 4G3QA 1OMZA 1VH1A 4HOCA 3OH4A 4FREA 1GQCA 2MZBA 4EEAA 1FR9A 1ZHJA 1H5SB 1HM0A 1ZCTA 3U2TA 1SSMA 2ICXA 4J18A 1SSQA 2APCA 2P6WA 5FU0A 3V8YA 3VBJA 3V4EA 4DCLA 4HURA 5E3RA 1FG5N 1ZJ3A 4EABA 2A8UA 3FSBA 2AESA 2FYDB 3JTJA 3K8EA 3PNNA 1VH3A 2WLGA 2RIJA 5CQOA 1EZIA 4HZCA 1PZTA 4G3PA 2X5SA 1KK5A 3ZGFA 1XHBA 3EG4A 3I0DA 3V0QA 4D11C 4DDZA 2VS3A 3P47A 3SPTA 4EA7A 5C49A 2RITA 5C1LA 5FUHA 5CMIA 4FQWA 5IDSA 2V0KA 4BQHA 2VSIA 3TISA 2FYCB 1WT2A 1KK6A 4M4KA 2IC7A 5CMGX 4B42A 5FYEA 2V0LA 1JVDA 4HO6A 2OI5A 2QIVX 4FRLA 2XMEA 2WLDA 3FSCA 1WVCA 1H3MA 1R80A 2IU9A 2FYBA 3FWWA 4FRBA 2C0NA 2BO7A 3SRTA 4B2WA 1FGXA 2XWLA 4E1KA 3T7MA 3I0KA 5C3BA 1LZ0A 3V90A 3BFPA 4ASYA 4H7OA 4N6BA 5C1GA 4R7PA 1LXAA 3I3XA 2WVLA 1H4DA 2RJ1A 4P02A 2YC3A 1ZDFA 1HM9A 1QRGA 1YROB 4DECA 1OCXA 3C8VA 2WLFA 5E3QA 5C4BA 1GX0A 1LL3A 4EEGA 2IUAA 2VXLA 3POLA 1FGGA 5AFUV 5ADXV 3OH3A 1G0RA 2ICYA 2NXVA 4FCUA 3V0LA 1H5SA 4FRQA 3GQAA 4EE5A 4GBPA 1HV9A 1R7TA 3OAMA 1R7YA 1VGZA 1W55A 2J0AA 2VXMA 1ZJ1A 1TDTA 4O6MA 3R5BA 5EJ1A 2JCJA 4FIXA 4KC2A 5DDVA 3KIAA 1JYLA 4FRAA 4FRHA 1EYRA 1HJJA 3ST8A 3VBIA 3OH2A 2AE7A 1FOAA 3F1YA 4E75A 1YP2A 1QG8A 1FO8A 1W57A 1ZCUA 2VD4A 4M28A 1G8OA 1KRUA 1S80A 2YESA 3IOJA 1R7UA 3SX7A 3BSWA 2FYAA 2Y7AA 5CQMX 3EEVA 1TZFA 4NANA 2YQHA 3OGZA 4ECMA 2Y4JA 3DJ4A 4Y62A 4IHGA 2PX7A 1ZDGA 3U2XA 4MFGA 3V0MA 2WLEA 2PA4A 3OUPA 1KQAA 2VS5A 4EAAA 5C48A 1H4CA 4IRPA 1MP3A 1LZIA 3ECTA 3MQHA 3IXCA 4KC1A 1MR9A 1S4NA 4UEGA 3VBKA 2WVKA 1FXOA 4EE3A 3I0IX 3NZ2A 1NHEB 4B4MA 3U0YA 4KPZA 1TW1A 3OU9A 2P2OA 1O23B 3CKOA 3Q7UA 3T7OA 1G93A 1K4VA 2GGOA 2OI6A 1O7OA 4Y9XA 1KRVA 3T57A 2RIXA 2AGDA 1KK4A 3P1BA 4HG6A 2OEGA 2RIYA 2O1HA 4EQYA 1PZYB 3DHOA 1QQ0A 1NQIB 2XWNA 3PKQA 2P73A 5D91A 2W0VA 2D7RA 4G3SA 1MP5A 2P72A 1G2VA 1Z2FA 1VGTA 3FS8A 3OH1A 4KNRA 3TK8A 3SUCA 1O7QA 2Z86A 3I0LA 4L41C 5DEMA 5DEPA 4M98A 2OEFA 2JF2A 3USQA 4HCQA 4N27A 1OQMB 2Z87A 4Y7GA 4EA9A 1S4OA 4Y7TA 4D11A 3R8YA 2WGZA 1FRWA 1FZWA 4IHHA 1R7VA 4Y7UA 3FSXA 3CKJA 1VPAA 2NPOA 1V82A 2XATA 5E3PA 4JISA 5FV9A 4E79A 1H7HA 4CJ8A 3BSYA 5C4FA 1WSZA 5DDTA 4ZDQA 2I5EA 1LL2A 2Y4KA 2X65A 1WT0A 3TZTA 4KQLA 2QGIA 4D48A 1SS9A 5L6VA 4N69A 3V8ZA 4IHFA 4ARWA 2BO6A 1G9RA 3D98A 5JQQA 4M2AA 2Y4LA 2RJ8A 5BXCA 5C4EA 3USRA 4HO5A 3U2VA 2D0JA 1R7XA 3RSBA 2X5ZA 1FR8A 2FKOA 5CQNX 5IDTA 4HO8A 3V0NA 3R3RA 5FTSA 1KRRA 1THJA 1EWWA 3FTTA 1H7LA 3D5NA 1G23A 5CQPA 1VZUA 5EJZA 4EEOA 1LZ7A 3ZLKA 2OI7A 1JV1A 3R1WA 2AQ9A 2VFZA 5J49A 5IFYA 3F1CA 1M8NA 1YP4A 3V0PA 4Q7CA 4EE4A 3HJJA 3KWDA 3FOQA 3I0JA 3SXGA 3T7NA 3K8DA 1H5SC 2FY7A 3CU0A 4NAIA 1H5TB 1H7TA 1INJA 1J2ZA 4E6TA 2DPWA 2Y6PA 2V0IA 3IGJA 1ZI1A 4MIXA 1MC3A 1FXJA 1ZI4A 3N9WA 3LW6A 3I0FA 4R37A 4IRQA 4MNDA 3CJ8A 4G87A 1ZI3A 1VZTA 2FFVA 3PKPA 1H7EA 4DE7A 4YS8A 1MR7A 2WEEA 4KRVA 3V0OA 1H7QA 3I0HA 3SX5A 4FRMA 2RIZA 2O1FA 4XWIA 1HJLA 4AYJA 1N4IA 1I52A 4B5BA 1G97A 1XHDA 1H4EA 3R2WA 1VZXA 2ZU9A 4D0TA 2V0JA 1R82A 1JV3A 2PGYA 3Q1XA 1ZI5A 2RJ6A 4FIYA 2Q4JA 3JQYA 1XZ6A 2BO4A 2XMHA 1VGUA 2O1GA 1GWVA 2PGVA 4Y6NA 4Y64A 1MRLA 1QRLA 3GQ8A 2YCMA 1H5SD 1KGQA 4KPXA 2AH9A 3KWCA 2E8BA 4Y7VA 1L0SA 1R81A 3F1XA 3ZF8A 1FO9A 4BMAA 2QH5A 5AJPA 1VM8A 2WAWA 1QRFA 3SXBA 5CQLX 4HO0A 4Y6UA 3ZGGA 1LVWA 3U2UA 2GGQA 3IOHA 1TVYA 4AYLA 3SX3A 4KT7A 1NWGB 3KWEA 2YQJA 4Y63A 3SXDA 5I1FA 1ZJ2A 4B2XA 1T3DA 2BO8A 4R36A 2RJ7A 4NALA 2W0WA 1S4PA 5C1HA 3I0EA 3VNPA 3EH0A 3VBPA 3BCVA 1LZJA 3Q80A 4C2SA 4HO4A 4HO3A 3MC4A 1LL0A 2AM4A 4D0ZA 1QWJA 4AC3A 2AM3A 1OMXA 2Y4MA 2YQSA 2I7BA 4ASJA 5EIYA 3EE5A 2FFUA 4LW6A 4B4GA 1NMMB 3OKRA 5CMJA 1IIMA 1GQ9A 5AJOA 1ZCYA 2V0HA 3OH0A 2JCKA 1H5RA 1MP4A 1O0RA 5C3DA 4JD0A 5ADXU 2WVMA 2UX8A 2VK9A 1G95A 3OC9A 3R5AA 1FWYA 5FTVA 1WT3A 4M99A 2RJ0A 3JUJA 2VHEA 4CJBA 2JF3A 3R5CA 3CKVA 3DK5A 2RJ4A 1GA8A 2E3DA 4HZDA 4MYOA 4EVWA 3E25A 2AM5A 1KHRA 2YC5A 4J09A 1G3LA 4KC4A 2RJ5A 3SXCA 1YP3A 3R0SA 4E6UA 1JVGA 4MYBA 1QRMA 5L6SA 4KNXA 3GUEA 1GX4A 4NAKA 1HM8A 4EEMA 4B3UA 4M9CA 1ON6A 3IOIA 3U0XA 4K6RA 5C4CA 3BSSA 1E5KA 3CKQA 1VGWA 1GWWA 3SX8A 1Z90A 3VBMA 4KXOA 3R5DA 1NKHB 2VSHA 3ZLLA 5C47A 3GVDA 5CMHA 3GOSA 3JUKA 4FROA 3OTMA 1G1LA 4AA7A 3NGWA 5C8RA 2QIAA 3OTZA 4HUSA 1ZJ0A 3I3AA 2QKXA 1ZJPA 2VS4A 4CVHA 1IINA 1V67A 1VICA 4FCEA 1XATA 4FRDA 1H7GA 3HL3A 4LW3A 1V3WA 5DG3A 1WT1A 3HSQA 1V84A 1QGSA 3GQ9A 1ON8A 1QGQA 3OW5A 1V83A 4CJCA 5HS2A 3CGXA 1JYKA 4HO9A 3BRKX 3Q4SA 2WLCA 3GQ7A 3QVBA 3O3PA 3TV0A 1QREA 4P00A 3TQDA 3PMOA 1TW5A 2A8WA 3RMWA 1INIA 2X60A 3DUVA 5CMFX 1H5RB 1NF5B 5AJNA 5D92A 3U2WA 3I0GA 4Y7FA 4AAWA 3FSYA 1KWSA 5C3AA 3TIOA 3R3IA 3TDTA 4O6NA 2TDTA 1SSTA 1W77A 3SXAA 1ZIZA 1KGTA 2YQCA 3I0CA 3E26A 4B4BA 5U2KA 2D7IA 2JCLA 3V91A 4N6AA 4HO2A 3VBLA 5C38A 5AFUU 3MQGA 3BXYA 3TWDA 2XWMA 3SXEA 3D8VA 2J0BA 5C36A 4ISXA 3RMVA 1H7FA 1ZCVA 2WE9A 2AECA
chains in the Genus database with same CATH topology
2JCOA 2I5KA 2IU8A 5F42A 4EA8A 3VBNA 4MZUA 4M2BA 5C4DA 2ZU7A 5FU8A 2CU2A 2ZU8A 4FRPA 4EGGA 3CKNA 2RJ9A 1ZJOA 1H5TA 4G3QA 1OMZA 1VH1A 4HOCA 3OH4A 4FREA 1GQCA 2MZBA 4EEAA 1FR9A 1ZHJA 1H5SB 1HM0A 1ZCTA 3U2TA 1SSMA 2ICXA 4J18A 1SSQA 2APCA 2P6WA 5FU0A 3V8YA 3VBJA 3V4EA 4DCLA 4HURA 5E3RA 1FG5N 1ZJ3A 4EABA 2A8UA 3FSBA 2AESA 2FYDB 3JTJA 3K8EA 3PNNA 1VH3A 2WLGA 2RIJA 5CQOA 1EZIA 4HZCA 1PZTA 4G3PA 2X5SA 1KK5A 3ZGFA 1XHBA 3EG4A 3I0DA 3V0QA 4D11C 4DDZA 2VS3A 3P47A 3SPTA 4EA7A 5C49A 2RITA 5C1LA 5FUHA 5CMIA 4FQWA 5IDSA 2V0KA 4BQHA 2VSIA 3TISA 2FYCB 1WT2A 1KK6A 4M4KA 2IC7A 5CMGX 4B42A 5FYEA 2V0LA 1JVDA 4HO6A 2OI5A 2QIVX 4FRLA 2XMEA 2WLDA 3FSCA 1WVCA 1H3MA 1R80A 2IU9A 2FYBA 3FWWA 4FRBA 2C0NA 2BO7A 3SRTA 4B2WA 1FGXA 2XWLA 4E1KA 3T7MA 3I0KA 5C3BA 1LZ0A 3V90A 3BFPA 4ASYA 4H7OA 4N6BA 5C1GA 4R7PA 1LXAA 3I3XA 2WVLA 1H4DA 2RJ1A 4P02A 2YC3A 1ZDFA 1HM9A 1QRGA 1YROB 4DECA 1OCXA 3C8VA 2WLFA 5E3QA 5C4BA 1GX0A 1LL3A 4EEGA 2IUAA 2VXLA 3POLA 1FGGA 5AFUV 5ADXV 3OH3A 1G0RA 2ICYA 2NXVA 4FCUA 3V0LA 1H5SA 4FRQA 4EE5A 4GBPA 1HV9A 1R7TA 3OAMA 1R7YA 1VGZA 1W55A 2J0AA 2VXMA 1ZJ1A 1TDTA 4O6MA 3R5BA 5EJ1A 2JCJA 4FIXA 4KC2A 5DDVA 3KIAA 1JYLA 4FRAA 4FRHA 1EYRA 1HJJA 3ST8A 3VBIA 2AE7A 3F1YA 1FOAA 3OH2A 4E75A 1YP2A 1QG8A 1FO8A 1W57A 1ZCUA 2VD4A 4M28A 1G8OA 1KRUA 1S80A 2YESA 3IOJA 1R7UA 3SX7A 3BSWA 2FYAA 2Y7AA 5CQMX 3EEVA 1TZFA 4NANA 2YQHA 3OGZA 4ECMA 2Y4JA 3DJ4A 4Y62A 4IHGA 2PX7A 1ZDGA 3U2XA 4MFGA 3V0MA 2WLEA 2PA4A 3OUPA 1KQAA 2VS5A 4EAAA 5C48A 1H4CA 4IRPA 1MP3A 1LZIA 3ECTA 3MQHA 3IXCA 4KC1A 1MR9A 1S4NA 4UEGA 3VBKA 2WVKA 1FXOA 4EE3A 3I0IX 3NZ2A 1NHEB 4B4MA 3U0YA 4KPZA 1TW1A 3OU9A 2P2OA 1O23B 3CKOA 3Q7UA 3T7OA 1G93A 1K4VA 2GGOA 2OI6A 1O7OA 4Y9XA 1KRVA 3T57A 2RIXA 2AGDA 1KK4A 3P1BA 4HG6A 2OEGA 2RIYA 2O1HA 4EQYA 1PZYB 3DHOA 1QQ0A 1NQIB 2XWNA 3PKQA 2P73A 5D91A 2W0VA 2D7RA 4G3SA 1MP5A 2P72A 1G2VA 4HO8A 1VGTA 3FS8A 3TK8A 4KNRA 1O7QA 2Z86A 3I0LA 3OH1A 4L41C 5DEMA 5DEPA 4M98A 2OEFA 2JF2A 3USQA 4HCQA 4N27A 1OQMB 2Z87A 4Y7GA 4EA9A 1S4OA 4Y7TA 4D11A 3R8YA 2WGZA 1FRWA 1FZWA 4IHHA 1R7VA 4Y7UA 3FSXA 3CKJA 1VPAA 2NPOA 1V82A 2XATA 5E3PA 4JISA 5FV9A 4E79A 1H7HA 4CJ8A 3BSYA 5C4FA 1WSZA 5DDTA 4ZDQA 2I5EA 1LL2A 2Y4KA 2X65A 1WT0A 3TZTA 4KQLA 2QGIA 4D48A 1SS9A 5L6VA 4N69A 3V8ZA 4IHFA 4ARWA 2BO6A 1G9RA 3D98A 5JQQA 4M2AA 2Y4LA 2RJ8A 5BXCA 5C4EA 3USRA 4HO5A 3U2VA 2D0JA 1R7XA 3RSBA 2X5ZA 1FR8A 2FKOA 5CQNX 5IDTA 3V0NA 3R3RA 5FTSA 1KRRA 1THJA 3FTTA 1H7LA 3D5NA 1G23A 5CQPA 1VZUA 5EJZA 4EEOA 1LZ7A 3ZLKA 2OI7A 1JV1A 3R1WA 2AQ9A 2VFZA 5J49A 5IFYA 3F1CA 1YP4A 3V0PA 4Q7CA 4EE4A 3HJJA 3KWDA 3FOQA 3I0JA 3SXGA 3T7NA 3K8DA 1H5SC 2FY7A 3CU0A 4NAIA 1H5TB 1H7TA 1INJA 1J2ZA 4E6TA 2DPWA 2Y6PA 2V0IA 3IGJA 1ZI1A 4MIXA 1MC3A 1FXJA 1ZI4A 3N9WA 3LW6A 3I0FA 4R37A 4IRQA 4MNDA 3CJ8A 4G87A 1ZI3A 1VZTA 2FFVA 3PKPA 1H7EA 4DE7A 4YS8A 1MR7A 2WEEA 4KRVA 3V0OA 1H7QA 3I0HA 3SX5A 4FRMA 2RIZA 2O1FA 4XWIA 1HJLA 4AYJA 1I52A 4B5BA 1G97A 1XHDA 1H4EA 3R2WA 1VZXA 2ZU9A 4D0TA 2V0JA 1R82A 1JV3A 2PGYA 3Q1XA 1ZI5A 2RJ6A 4FIYA 2Q4JA 3JQYA 1XZ6A 2BO4A 2XMHA 1VGUA 2O1GA 1GWVA 2PGVA 4Y6NA 4Y64A 1MRLA 1QRLA 2YCMA 1H5SD 1KGQA 4KPXA 2AH9A 3KWCA 2E8BA 4Y7VA 1R81A 3F1XA 3ZF8A 1FO9A 4BMAA 2QH5A 5AJPA 1VM8A 2WAWA 1QRFA 3SXBA 5CQLX 4HO0A 4Y6UA 3ZGGA 1LVWA 3U2UA 2GGQA 3IOHA 1TVYA 4AYLA 3SX3A 4KT7A 1NWGB 3KWEA 2YQJA 4Y63A 3SXDA 5I1FA 1ZJ2A 4B2XA 1T3DA 2BO8A 4R36A 2RJ7A 4NALA 2W0WA 1S4PA 5C1HA 3I0EA 3VNPA 3EH0A 3VBPA 3BCVA 1LZJA 3Q80A 4C2SA 4HO4A 4HO3A 3MC4A 1LL0A 2AM4A 4D0ZA 1QWJA 4AC3A 2AM3A 1OMXA 2Y4MA 2YQSA 2I7BA 4ASJA 5EIYA 3EE5A 2FFUA 4LW6A 4B4GA 1NMMB 3OKRA 5CMJA 1IIMA 1GQ9A 5AJOA 1ZCYA 2V0HA 2JCKA 3OH0A 1H5RA 1MP4A 1O0RA 5C3DA 4JD0A 5ADXU 2WVMA 2UX8A 2VK9A 1G95A 3OC9A 3R5AA 1FWYA 5FTVA 1WT3A 4M99A 2RJ0A 3JUJA 2VHEA 4CJBA 2JF3A 3R5CA 3CKVA 3DK5A 2RJ4A 1GA8A 2E3DA 4HZDA 4MYOA 4EVWA 3E25A 2AM5A 1KHRA 2YC5A 4J09A 1G3LA 4KC4A 2RJ5A 3SXCA 1YP3A 3R0SA 4E6UA 1JVGA 4MYBA 1QRMA 5L6SA 4KNXA 3GUEA 1GX4A 4NAKA 1HM8A 4EEMA 4B3UA 4M9CA 1ON6A 3IOIA 3U0XA 4K6RA 5C4CA 3BSSA 1E5KA 3CKQA 1VGWA 1GWWA 3SX8A 1Z90A 3VBMA 4KXOA 3R5DA 1NKHB 2VSHA 3ZLLA 5C47A 3GVDA 5CMHA 3GOSA 3JUKA 4FROA 3OTMA 1G1LA 4AA7A 3NGWA 5C8RA 2QIAA 3OTZA 4HUSA 1ZJ0A 3I3AA 2QKXA 1ZJPA 2VS4A 4CVHA 1IINA 1V67A 1VICA 4FCEA 1XATA 4FRDA 1H7GA 3HL3A 4LW3A 1V3WA 5DG3A 1WT1A 3HSQA 1V84A 1QGSA 1ON8A 1QGQA 3OW5A 1V83A 4CJCA 5HS2A 3CGXA 1JYKA 4HO9A 3BRKX 3Q4SA 2WLCA 3QVBA 3O3PA 3TV0A 1QREA 4P00A 3TQDA 3PMOA 1TW5A 2A8WA 3RMWA 1INIA 2X60A 3DUVA 5CMFX 1H5RB 1NF5B 5AJNA 5D92A 3U2WA 3I0GA 4Y7FA 4AAWA 3FSYA 1KWSA 5C3AA 3TIOA 3R3IA 3TDTA 4O6NA 2TDTA 1SSTA 1W77A 3SXAA 1ZIZA 1KGTA 2YQCA 3I0CA 3E26A 4B4BA 5U2KA 2D7IA 2JCLA 3V91A 4N6AA 4HO2A 3VBLA 5C38A 5AFUU 3MQGA 3BXYA 3TWDA 2XWMA 3SXEA 3D8VA 2J0BA 5C36A 4ISXA 3RMVA 1H7FA 1ZCVA 2WE9A 2AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCO A;  2I5K A;  2IU8 A;  5F42 A;  4EA8 A;  3VBN A;  4MZU A;  4M2B A;  5C4D A;  2ZU7 A;  5FU8 A;  2CU2 A;  2ZU8 A;  4FRP A;  4EGG A;  3CKN A;  2RJ9 A;  1ZJO A;  1H5T A;  4G3Q A;  1OMZ A;  1VH1 A;  4HOC A;  3OH4 A;  4FRE A;  1GQC A;  2MZB A;  4EEA A;  1FR9 A;  1ZHJ A;  1H5S B;  1HM0 A;  1ZCT A;  3U2T A;  1SSM A;  2ICX A;  4J18 A;  1SSQ A;  2APC A;  2P6W A;  5FU0 A;  3V8Y A;  3VBJ A;  3V4E A;  4DCL A;  4HUR A;  5E3R A;  1FG5 N;  1ZJ3 A;  4EAB A;  2A8U A;  3FSB A;  2AES A;  2FYD B;  3JTJ A;  3K8E A;  3PNN A;  1VH3 A;  2WLG A;  2RIJ A;  5CQO A;  1EZI A;  4HZC A;  1PZT A;  4G3P A;  2X5S A;  1KK5 A;  3ZGF A;  1XHB A;  3EG4 A;  3I0D A;  3V0Q A;  4D11 C;  4DDZ A;  2VS3 A;  3P47 A;  3SPT A;  4EA7 A;  5C49 A;  2RIT A;  5C1L A;  5FUH A;  5CMI A;  4FQW A;  5IDS A;  2V0K A;  4BQH A;  2VSI A;  3TIS A;  2FYC B;  1WT2 A;  1KK6 A;  4M4K A;  2IC7 A;  5CMG X;  4B42 A;  5FYE A;  2V0L A;  1JVD A;  4HO6 A;  2OI5 A;  2QIV X;  4FRL A;  2XME A;  2WLD A;  3FSC A;  1WVC A;  1H3M A;  1R80 A;  2IU9 A;  2FYB A;  3FWW A;  4FRB A;  2BO7 A;  3SRT A;  4B2W A;  1FGX A;  2XWL A;  4E1K A;  3T7M A;  3I0K A;  5C3B A;  1LZ0 A;  3V90 A;  3BFP A;  4ASY A;  4H7O A;  4N6B A;  5C1G A;  4R7P A;  1LXA A;  3I3X A;  2WVL A;  1H4D A;  2RJ1 A;  4P02 A;  2YC3 A;  1ZDF A;  1HM9 A;  1QRG A;  1YRO B;  4DEC A;  1OCX A;  3C8V A;  2WLF A;  5E3Q A;  5C4B A;  1GX0 A;  1LL3 A;  4EEG A;  2IUA A;  2VXL A;  3POL A;  1FGG A;  5AFU V;  5ADX V;  3OH3 A;  1G0R A;  2ICY A;  2NXV A;  4FCU A;  3V0L A;  1H5S A;  4FRQ A;  4EE5 A;  4GBP A;  1HV9 A;  1R7T A;  3OAM A;  1R7Y A;  1VGZ A;  1W55 A;  2VXM A;  1ZJ1 A;  1TDT A;  3R5B A;  5EJ1 A;  2JCJ A;  4KC2 A;  5DDV A;  3KIA A;  1JYL A;  4FRA A;  4FRH A;  1EYR A;  1HJJ A;  3ST8 A;  3VBI A;  2AE7 A;  3F1Y A;  1FOA A;  3OH2 A;  4E75 A;  1YP2 A;  1QG8 A;  1FO8 A;  1W57 A;  1ZCU A;  2VD4 A;  4M28 A;  1G8O A;  1KRU A;  1S80 A;  2YES A;  3IOJ A;  1R7U A;  3SX7 A;  3BSW A;  2FYA A;  2Y7A A;  5CQM X;  3EEV A;  1TZF A;  4NAN A;  2YQH A;  3OGZ A;  4ECM A;  2Y4J A;  3DJ4 A;  4Y62 A;  4IHG A;  2PX7 A;  1ZDG A;  3U2X A;  4MFG A;  3V0M A;  2WLE A;  2PA4 A;  3OUP A;  1KQA A;  2VS5 A;  4EAA A;  5C48 A;  1H4C A;  4IRP A;  1MP3 A;  1LZI A;  3ECT A;  3MQH A;  3IXC A;  4KC1 A;  1MR9 A;  1S4N A;  4UEG A;  3VBK A;  2WVK A;  1FXO A;  4EE3 A;  3I0I X;  3NZ2 A;  1NHE B;  4B4M A;  3U0Y A;  4KPZ A;  1TW1 A;  3OU9 A;  2P2O A;  1O23 B;  3CKO A;  3Q7U A;  3T7O A;  1G93 A;  1K4V A;  2GGO A;  2OI6 A;  1O7O A;  4Y9X A;  1KRV A;  3T57 A;  2RIX A;  2AGD A;  1KK4 A;  3P1B A;  4HG6 A;  2OEG A;  2RIY A;  2O1H A;  4EQY A;  1PZY B;  3DHO A;  1QQ0 A;  1NQI B;  2XWN A;  3PKQ A;  2P73 A;  2W0V A;  2D7R A;  4G3S A;  1MP5 A;  2P72 A;  1G2V A;  4HO8 A;  1VGT A;  3FS8 A;  3TK8 A;  4KNR A;  1O7Q A;  2Z86 A;  3I0L A;  3OH1 A;  4L41 C;  5DEM A;  5DEP A;  4M98 A;  2OEF A;  2JF2 A;  3USQ A;  4HCQ A;  4N27 A;  1OQM B;  2Z87 A;  4Y7G A;  4EA9 A;  1S4O A;  4Y7T A;  4D11 A;  3R8Y A;  2WGZ A;  1FRW A;  1FZW A;  4IHH A;  1R7V A;  4Y7U A;  3FSX A;  3CKJ A;  1VPA A;  2NPO A;  1V82 A;  2XAT A;  5E3P A;  4JIS A;  5FV9 A;  4E79 A;  1H7H A;  4CJ8 A;  3BSY A;  5C4F A;  1WSZ A;  5DDT A;  4ZDQ A;  2I5E A;  1LL2 A;  2Y4K A;  2X65 A;  1WT0 A;  3TZT A;  4KQL A;  2QGI A;  4D48 A;  1SS9 A;  5L6V A;  4N69 A;  3V8Z A;  4IHF A;  4ARW A;  2BO6 A;  1G9R A;  3D98 A;  5JQQ A;  4M2A A;  2Y4L A;  2RJ8 A;  5BXC A;  5C4E A;  3USR A;  4HO5 A;  3U2V A;  2D0J A;  1R7X A;  3RSB A;  2X5Z A;  1FR8 A;  2FKO A;  5CQN X;  5IDT A;  3V0N A;  3R3R A;  5FTS A;  1KRR A;  1THJ A;  3FTT A;  1H7L A;  3D5N A;  1G23 A;  5CQP A;  1VZU A;  5EJZ A;  4EEO A;  1LZ7 A;  3ZLK A;  2OI7 A;  1JV1 A;  3R1W A;  2AQ9 A;  2VFZ A;  5J49 A;  5IFY A;  3F1C A;  1YP4 A;  3V0P A;  4EE4 A;  3HJJ A;  3KWD A;  3FOQ A;  3I0J A;  3SXG A;  3T7N A;  3K8D A;  1H5S C;  2FY7 A;  3CU0 A;  4NAI A;  1H5T B;  1H7T A;  1INJ A;  1J2Z A;  4E6T A;  2DPW A;  2Y6P A;  2V0I A;  3IGJ A;  1ZI1 A;  1MC3 A;  1FXJ A;  1ZI4 A;  3N9W A;  3LW6 A;  3I0F A;  4R37 A;  4IRQ A;  4MND A;  3CJ8 A;  4G87 A;  1ZI3 A;  1VZT A;  2FFV A;  3PKP A;  1H7E A;  4DE7 A;  4YS8 A;  1MR7 A;  2WEE A;  4KRV A;  3V0O A;  1H7Q A;  3I0H A;  3SX5 A;  4FRM A;  2RIZ A;  2O1F A;  4XWI A;  1HJL A;  4AYJ A;  1I52 A;  4B5B A;  1G97 A;  1XHD A;  1H4E A;  3R2W A;  1VZX A;  2ZU9 A;  4D0T A;  2V0J A;  1R82 A;  1JV3 A;  2PGY A;  3Q1X A;  1ZI5 A;  2RJ6 A;  2Q4J A;  3JQY A;  1XZ6 A;  2BO4 A;  2XMH A;  1VGU A;  2O1G A;  1GWV A;  2PGV A;  4Y6N A;  4Y64 A;  1MRL A;  1QRL A;  2YCM A;  1H5S D;  1KGQ A;  4KPX A;  2AH9 A;  3KWC A;  2E8B A;  4Y7V A;  1R81 A;  3F1X A;  3ZF8 A;  1FO9 A;  4BMA A;  2QH5 A;  5AJP A;  1VM8 A;  2WAW A;  1QRF A;  3SXB A;  5CQL X;  4HO0 A;  4Y6U A;  3ZGG A;  1LVW A;  3U2U A;  2GGQ A;  3IOH A;  1TVY A;  4AYL A;  3SX3 A;  4KT7 A;  1NWG B;  3KWE A;  2YQJ A;  4Y63 A;  3SXD A;  5I1F A;  1ZJ2 A;  4B2X A;  1T3D A;  2BO8 A;  4R36 A;  2RJ7 A;  4NAL A;  2W0W A;  1S4P A;  5C1H A;  3I0E A;  3VNP A;  3EH0 A;  3VBP A;  3BCV A;  1LZJ A;  3Q80 A;  4C2S A;  4HO4 A;  4HO3 A;  3MC4 A;  1LL0 A;  2AM4 A;  4D0Z A;  1QWJ A;  4AC3 A;  2AM3 A;  1OMX A;  2Y4M A;  2YQS A;  2I7B A;  4ASJ A;  5EIY A;  3EE5 A;  2FFU A;  4LW6 A;  4B4G A;  1NMM B;  3OKR A;  5CMJ A;  1IIM A;  1GQ9 A;  5AJO A;  1ZCY A;  2V0H A;  2JCK A;  3OH0 A;  1H5R A;  1MP4 A;  1O0R A;  5C3D A;  4JD0 A;  5ADX U;  2WVM A;  2UX8 A;  1G95 A;  3OC9 A;  3R5A A;  1FWY A;  5FTV A;  1WT3 A;  4M99 A;  2RJ0 A;  3JUJ A;  2VHE A;  4CJB A;  2JF3 A;  3R5C A;  3CKV A;  3DK5 A;  2RJ4 A;  1GA8 A;  2E3D A;  4HZD A;  4MYO A;  4EVW A;  3E25 A;  2AM5 A;  1KHR A;  2YC5 A;  4J09 A;  1G3L A;  4KC4 A;  2RJ5 A;  3SXC A;  1YP3 A;  3R0S A;  4E6U A;  1JVG A;  4MYB A;  1QRM A;  5L6S A;  4KNX A;  3GUE A;  1GX4 A;  4NAK A;  1HM8 A;  4EEM A;  4B3U A;  4M9C A;  1ON6 A;  3IOI A;  3U0X A;  4K6R A;  5C4C A;  3BSS A;  1E5K A;  3CKQ A;  1VGW A;  1GWW A;  3SX8 A;  1Z90 A;  3VBM A;  4KXO A;  3R5D A;  1NKH B;  2VSH A;  3ZLL A;  5C47 A;  3GVD A;  5CMH A;  3GOS A;  3JUK A;  4FRO A;  3OTM A;  1G1L A;  4AA7 A;  3NGW A;  5C8R A;  2QIA A;  3OTZ A;  4HUS A;  1ZJ0 A;  3I3A A;  2QKX A;  1ZJP A;  2VS4 A;  4CVH A;  1IIN A;  1V67 A;  1VIC A;  4FCE A;  1XAT A;  4FRD A;  1H7G A;  3HL3 A;  4LW3 A;  1V3W A;  5DG3 A;  1WT1 A;  3HSQ A;  1V84 A;  1QGS A;  1ON8 A;  1QGQ A;  3OW5 A;  1V83 A;  4CJC A;  5HS2 A;  3CGX A;  1JYK A;  4HO9 A;  3BRK X;  3Q4S A;  2WLC A;  3QVB A;  3O3P A;  3TV0 A;  1QRE A;  4P00 A;  3TQD A;  3PMO A;  1TW5 A;  2A8W A;  3RMW A;  1INI A;  2X60 A;  3DUV A;  5CMF X;  1H5R B;  1NF5 B;  5AJN A;  3U2W A;  3I0G A;  4Y7F A;  4AAW A;  3FSY A;  1KWS A;  5C3A A;  3TIO A;  3R3I A;  3TDT A;  2TDT A;  1SST A;  1W77 A;  3SXA A;  1ZIZ A;  1KGT A;  2YQC A;  3I0C A;  3E26 A;  4B4B A;  5U2K A;  2D7I A;  2JCL A;  3V91 A;  4N6A A;  4HO2 A;  3VBL A;  5C38 A;  5AFU U;  3MQG A;  3BXY A;  3TWD A;  2XWM A;  3SXE A;  3D8V A;  5C36 A;  4ISX A;  3RMV A;  1H7F A;  1ZCV A;  2WE9 A;  2AEC A; 
#chains in the Genus database with same CATH topology
 2JCO A;  2I5K A;  2IU8 A;  5F42 A;  4EA8 A;  3VBN A;  4MZU A;  4M2B A;  5C4D A;  2ZU7 A;  5FU8 A;  2CU2 A;  2ZU8 A;  4FRP A;  4EGG A;  3CKN A;  2RJ9 A;  1ZJO A;  1H5T A;  4G3Q A;  1OMZ A;  1VH1 A;  4HOC A;  3OH4 A;  4FRE A;  1GQC A;  2MZB A;  4EEA A;  1FR9 A;  1ZHJ A;  1H5S B;  1HM0 A;  1ZCT A;  3U2T A;  1SSM A;  2ICX A;  4J18 A;  1SSQ A;  2APC A;  2P6W A;  5FU0 A;  3V8Y A;  3VBJ A;  3V4E A;  4DCL A;  4HUR A;  5E3R A;  1FG5 N;  1ZJ3 A;  4EAB A;  2A8U A;  3FSB A;  2AES A;  2FYD B;  3JTJ A;  3K8E A;  3PNN A;  1VH3 A;  2WLG A;  2RIJ A;  5CQO A;  1EZI A;  4HZC A;  1PZT A;  4G3P A;  2X5S A;  1KK5 A;  3ZGF A;  1XHB A;  3EG4 A;  3I0D A;  3V0Q A;  4D11 C;  4DDZ A;  2VS3 A;  3P47 A;  3SPT A;  4EA7 A;  5C49 A;  2RIT A;  5C1L A;  5FUH A;  5CMI A;  4FQW A;  5IDS A;  2V0K A;  4BQH A;  2VSI A;  3TIS A;  2FYC B;  1WT2 A;  1KK6 A;  4M4K A;  2IC7 A;  5CMG X;  4B42 A;  5FYE A;  2V0L A;  1JVD A;  4HO6 A;  2OI5 A;  2QIV X;  4FRL A;  2XME A;  2WLD A;  3FSC A;  1WVC A;  1H3M A;  1R80 A;  2IU9 A;  2FYB A;  3FWW A;  4FRB A;  2C0N A;  2BO7 A;  3SRT A;  4B2W A;  1FGX A;  2XWL A;  4E1K A;  3T7M A;  3I0K A;  5C3B A;  1LZ0 A;  3V90 A;  3BFP A;  4ASY A;  4H7O A;  4N6B A;  5C1G A;  4R7P A;  1LXA A;  3I3X A;  2WVL A;  1H4D A;  2RJ1 A;  4P02 A;  2YC3 A;  1ZDF A;  1HM9 A;  1QRG A;  1YRO B;  4DEC A;  1OCX A;  3C8V A;  2WLF A;  5E3Q A;  5C4B A;  1GX0 A;  1LL3 A;  4EEG A;  2IUA A;  2VXL A;  3POL A;  1FGG A;  5AFU V;  5ADX V;  3OH3 A;  1G0R A;  2ICY A;  2NXV A;  4FCU A;  3V0L A;  1H5S A;  4FRQ A;  3GQA A;  4EE5 A;  4GBP A;  1HV9 A;  1R7T A;  3OAM A;  1R7Y A;  1VGZ A;  1W55 A;  2J0A A;  2VXM A;  1ZJ1 A;  1TDT A;  4O6M A;  3R5B A;  5EJ1 A;  2JCJ A;  4FIX A;  4KC2 A;  5DDV A;  3KIA A;  1JYL A;  4FRA A;  4FRH A;  1EYR A;  1HJJ A;  3ST8 A;  3VBI A;  3OH2 A;  2AE7 A;  1FOA A;  3F1Y A;  4E75 A;  1YP2 A;  1QG8 A;  1FO8 A;  1W57 A;  1ZCU A;  2VD4 A;  4M28 A;  1G8O A;  1KRU A;  1S80 A;  2YES A;  3IOJ A;  1R7U A;  3SX7 A;  3BSW A;  2FYA A;  2Y7A A;  5CQM X;  3EEV A;  1TZF A;  4NAN A;  2YQH A;  3OGZ A;  4ECM A;  2Y4J A;  3DJ4 A;  4Y62 A;  4IHG A;  2PX7 A;  1ZDG A;  3U2X A;  4MFG A;  3V0M A;  2WLE A;  2PA4 A;  3OUP A;  1KQA A;  2VS5 A;  4EAA A;  5C48 A;  1H4C A;  4IRP A;  1MP3 A;  1LZI A;  3ECT A;  3MQH A;  3IXC A;  4KC1 A;  1MR9 A;  1S4N A;  4UEG A;  3VBK A;  2WVK A;  1FXO A;  4EE3 A;  3I0I X;  3NZ2 A;  1NHE B;  4B4M A;  3U0Y A;  4KPZ A;  1TW1 A;  3OU9 A;  2P2O A;  1O23 B;  3CKO A;  3Q7U A;  3T7O A;  1G93 A;  1K4V A;  2GGO A;  2OI6 A;  1O7O A;  4Y9X A;  1KRV A;  3T57 A;  2RIX A;  2AGD A;  1KK4 A;  3P1B A;  4HG6 A;  2OEG A;  2RIY A;  2O1H A;  4EQY A;  1PZY B;  3DHO A;  1QQ0 A;  1NQI B;  2XWN A;  3PKQ A;  2P73 A;  5D91 A;  2W0V A;  2D7R A;  4G3S A;  1MP5 A;  2P72 A;  1G2V A;  1Z2F A;  1VGT A;  3FS8 A;  3OH1 A;  4KNR A;  3TK8 A;  3SUC A;  1O7Q A;  2Z86 A;  3I0L A;  4L41 C;  5DEM A;  5DEP A;  4M98 A;  2OEF A;  2JF2 A;  3USQ A;  4HCQ A;  4N27 A;  1OQM B;  2Z87 A;  4Y7G A;  4EA9 A;  1S4O A;  4Y7T A;  4D11 A;  3R8Y A;  2WGZ A;  1FRW A;  1FZW A;  4IHH A;  1R7V A;  4Y7U A;  3FSX A;  3CKJ A;  1VPA A;  2NPO A;  1V82 A;  2XAT A;  5E3P A;  4JIS A;  5FV9 A;  4E79 A;  1H7H A;  4CJ8 A;  3BSY A;  5C4F A;  1WSZ A;  5DDT A;  4ZDQ A;  2I5E A;  1LL2 A;  2Y4K A;  2X65 A;  1WT0 A;  3TZT A;  4KQL A;  2QGI A;  4D48 A;  1SS9 A;  5L6V A;  4N69 A;  3V8Z A;  4IHF A;  4ARW A;  2BO6 A;  1G9R A;  3D98 A;  5JQQ A;  4M2A A;  2Y4L A;  2RJ8 A;  5BXC A;  5C4E A;  3USR A;  4HO5 A;  3U2V A;  2D0J A;  1R7X A;  3RSB A;  2X5Z A;  1FR8 A;  2FKO A;  5CQN X;  5IDT A;  4HO8 A;  3V0N A;  3R3R A;  5FTS A;  1KRR A;  1THJ A;  1EWW A;  3FTT A;  1H7L A;  3D5N A;  1G23 A;  5CQP A;  1VZU A;  5EJZ A;  4EEO A;  1LZ7 A;  3ZLK A;  2OI7 A;  1JV1 A;  3R1W A;  2AQ9 A;  2VFZ A;  5J49 A;  5IFY A;  3F1C A;  1M8N A;  1YP4 A;  3V0P A;  4Q7C A;  4EE4 A;  3HJJ A;  3KWD A;  3FOQ A;  3I0J A;  3SXG A;  3T7N A;  3K8D A;  1H5S C;  2FY7 A;  3CU0 A;  4NAI A;  1H5T B;  1H7T A;  1INJ A;  1J2Z A;  4E6T A;  2DPW A;  2Y6P A;  2V0I A;  3IGJ A;  1ZI1 A;  4MIX A;  1MC3 A;  1FXJ A;  1ZI4 A;  3N9W A;  3LW6 A;  3I0F A;  4R37 A;  4IRQ A;  4MND A;  3CJ8 A;  4G87 A;  1ZI3 A;  1VZT A;  2FFV A;  3PKP A;  1H7E A;  4DE7 A;  4YS8 A;  1MR7 A;  2WEE A;  4KRV A;  3V0O A;  1H7Q A;  3I0H A;  3SX5 A;  4FRM A;  2RIZ A;  2O1F A;  4XWI A;  1HJL A;  4AYJ A;  1N4I A;  1I52 A;  4B5B A;  1G97 A;  1XHD A;  1H4E A;  3R2W A;  1VZX A;  2ZU9 A;  4D0T A;  2V0J A;  1R82 A;  1JV3 A;  2PGY A;  3Q1X A;  1ZI5 A;  2RJ6 A;  4FIY A;  2Q4J A;  3JQY A;  1XZ6 A;  2BO4 A;  2XMH A;  1VGU A;  2O1G A;  1GWV A;  2PGV A;  4Y6N A;  4Y64 A;  1MRL A;  1QRL A;  3GQ8 A;  2YCM A;  1H5S D;  1KGQ A;  4KPX A;  2AH9 A;  3KWC A;  2E8B A;  4Y7V A;  1L0S A;  1R81 A;  3F1X A;  3ZF8 A;  1FO9 A;  4BMA A;  2QH5 A;  5AJP A;  1VM8 A;  2WAW A;  1QRF A;  3SXB A;  5CQL X;  4HO0 A;  4Y6U A;  3ZGG A;  1LVW A;  3U2U A;  2GGQ A;  3IOH A;  1TVY A;  4AYL A;  3SX3 A;  4KT7 A;  1NWG B;  3KWE A;  2YQJ A;  4Y63 A;  3SXD A;  5I1F A;  1ZJ2 A;  4B2X A;  1T3D A;  2BO8 A;  4R36 A;  2RJ7 A;  4NAL A;  2W0W A;  1S4P A;  5C1H A;  3I0E A;  3VNP A;  3EH0 A;  3VBP A;  3BCV A;  1LZJ A;  3Q80 A;  4C2S A;  4HO4 A;  4HO3 A;  3MC4 A;  1LL0 A;  2AM4 A;  4D0Z A;  1QWJ A;  4AC3 A;  2AM3 A;  1OMX A;  2Y4M A;  2YQS A;  2I7B A;  4ASJ A;  5EIY A;  3EE5 A;  2FFU A;  4LW6 A;  4B4G A;  1NMM B;  3OKR A;  5CMJ A;  1IIM A;  1GQ9 A;  5AJO A;  1ZCY A;  2V0H A;  3OH0 A;  2JCK A;  1H5R A;  1MP4 A;  1O0R A;  5C3D A;  4JD0 A;  5ADX U;  2WVM A;  2UX8 A;  2VK9 A;  1G95 A;  3OC9 A;  3R5A A;  1FWY A;  5FTV A;  1WT3 A;  4M99 A;  2RJ0 A;  3JUJ A;  2VHE A;  4CJB A;  2JF3 A;  3R5C A;  3CKV A;  3DK5 A;  2RJ4 A;  1GA8 A;  2E3D A;  4HZD A;  4MYO A;  4EVW A;  3E25 A;  2AM5 A;  1KHR A;  2YC5 A;  4J09 A;  1G3L A;  4KC4 A;  2RJ5 A;  3SXC A;  1YP3 A;  3R0S A;  4E6U A;  1JVG A;  4MYB A;  1QRM A;  5L6S A;  4KNX A;  3GUE A;  1GX4 A;  4NAK A;  1HM8 A;  4EEM A;  4B3U A;  4M9C A;  1ON6 A;  3IOI A;  3U0X A;  4K6R A;  5C4C A;  3BSS A;  1E5K A;  3CKQ A;  1VGW A;  1GWW A;  3SX8 A;  1Z90 A;  3VBM A;  4KXO A;  3R5D A;  1NKH B;  2VSH A;  3ZLL A;  5C47 A;  3GVD A;  5CMH A;  3GOS A;  3JUK A;  4FRO A;  3OTM A;  1G1L A;  4AA7 A;  3NGW A;  5C8R A;  2QIA A;  3OTZ A;  4HUS A;  1ZJ0 A;  3I3A A;  2QKX A;  1ZJP A;  2VS4 A;  4CVH A;  1IIN A;  1V67 A;  1VIC A;  4FCE A;  1XAT A;  4FRD A;  1H7G A;  3HL3 A;  4LW3 A;  1V3W A;  5DG3 A;  1WT1 A;  3HSQ A;  1V84 A;  1QGS A;  3GQ9 A;  1ON8 A;  1QGQ A;  3OW5 A;  1V83 A;  4CJC A;  5HS2 A;  3CGX A;  1JYK A;  4HO9 A;  3BRK X;  3Q4S A;  2WLC A;  3GQ7 A;  3QVB A;  3O3P A;  3TV0 A;  1QRE A;  4P00 A;  3TQD A;  3PMO A;  1TW5 A;  2A8W A;  3RMW A;  1INI A;  2X60 A;  3DUV A;  5CMF X;  1H5R B;  1NF5 B;  5AJN A;  5D92 A;  3U2W A;  3I0G A;  4Y7F A;  4AAW A;  3FSY A;  1KWS A;  5C3A A;  3TIO A;  3R3I A;  3TDT A;  4O6N A;  2TDT A;  1SST A;  1W77 A;  3SXA A;  1ZIZ A;  1KGT A;  2YQC A;  3I0C A;  3E26 A;  4B4B A;  5U2K A;  2D7I A;  2JCL A;  3V91 A;  4N6A A;  4HO2 A;  3VBL A;  5C38 A;  5AFU U;  3MQG A;  3BXY A;  3TWD A;  2XWM A;  3SXE A;  3D8V A;  2J0B A;  5C36 A;  4ISX A;  3RMV A;  1H7F A;  1ZCV A;  2WE9 A;  2AEC A; 
#chains in the Genus database with same CATH homology
 2JCO A;  2I5K A;  2IU8 A;  5F42 A;  4EA8 A;  3VBN A;  4MZU A;  4M2B A;  5C4D A;  2ZU7 A;  5FU8 A;  2CU2 A;  2ZU8 A;  4FRP A;  4EGG A;  3CKN A;  2RJ9 A;  1ZJO A;  1H5T A;  4G3Q A;  1OMZ A;  1VH1 A;  4HOC A;  3OH4 A;  4FRE A;  1GQC A;  2MZB A;  4EEA A;  1FR9 A;  1ZHJ A;  1H5S B;  1HM0 A;  1ZCT A;  3U2T A;  1SSM A;  2ICX A;  4J18 A;  1SSQ A;  2APC A;  2P6W A;  5FU0 A;  3V8Y A;  3VBJ A;  3V4E A;  4DCL A;  4HUR A;  5E3R A;  1FG5 N;  1ZJ3 A;  4EAB A;  2A8U A;  3FSB A;  2AES A;  2FYD B;  3JTJ A;  3K8E A;  3PNN A;  1VH3 A;  2WLG A;  2RIJ A;  5CQO A;  1EZI A;  4HZC A;  1PZT A;  4G3P A;  2X5S A;  1KK5 A;  3ZGF A;  1XHB A;  3EG4 A;  3I0D A;  3V0Q A;  4D11 C;  4DDZ A;  2VS3 A;  3P47 A;  3SPT A;  4EA7 A;  5C49 A;  2RIT A;  5C1L A;  5FUH A;  5CMI A;  4FQW A;  5IDS A;  2V0K A;  4BQH A;  2VSI A;  3TIS A;  2FYC B;  1WT2 A;  1KK6 A;  4M4K A;  2IC7 A;  5CMG X;  4B42 A;  5FYE A;  2V0L A;  1JVD A;  4HO6 A;  2OI5 A;  2QIV X;  4FRL A;  2XME A;  2WLD A;  3FSC A;  1WVC A;  1H3M A;  1R80 A;  2IU9 A;  2FYB A;  3FWW A;  4FRB A;  2C0N A;  2BO7 A;  3SRT A;  4B2W A;  1FGX A;  2XWL A;  4E1K A;  3T7M A;  3I0K A;  5C3B A;  1LZ0 A;  3V90 A;  3BFP A;  4ASY A;  4H7O A;  4N6B A;  5C1G A;  4R7P A;  1LXA A;  3I3X A;  2WVL A;  1H4D A;  2RJ1 A;  4P02 A;  2YC3 A;  1ZDF A;  1HM9 A;  1QRG A;  1YRO B;  4DEC A;  1OCX A;  3C8V A;  2WLF A;  5E3Q A;  5C4B A;  1GX0 A;  1LL3 A;  4EEG A;  2IUA A;  2VXL A;  3POL A;  1FGG A;  5AFU V;  5ADX V;  3OH3 A;  1G0R A;  2ICY A;  2NXV A;  4FCU A;  3V0L A;  1H5S A;  4FRQ A;  4EE5 A;  4GBP A;  1HV9 A;  1R7T A;  3OAM A;  1R7Y A;  1VGZ A;  1W55 A;  2J0A A;  2VXM A;  1ZJ1 A;  1TDT A;  4O6M A;  3R5B A;  5EJ1 A;  2JCJ A;  4FIX A;  4KC2 A;  5DDV A;  3KIA A;  1JYL A;  4FRA A;  4FRH A;  1EYR A;  1HJJ A;  3ST8 A;  3VBI A;  2AE7 A;  3F1Y A;  1FOA A;  3OH2 A;  4E75 A;  1YP2 A;  1QG8 A;  1FO8 A;  1W57 A;  1ZCU A;  2VD4 A;  4M28 A;  1G8O A;  1KRU A;  1S80 A;  2YES A;  3IOJ A;  1R7U A;  3SX7 A;  3BSW A;  2FYA A;  2Y7A A;  5CQM X;  3EEV A;  1TZF A;  4NAN A;  2YQH A;  3OGZ A;  4ECM A;  2Y4J A;  3DJ4 A;  4Y62 A;  4IHG A;  2PX7 A;  1ZDG A;  3U2X A;  4MFG A;  3V0M A;  2WLE A;  2PA4 A;  3OUP A;  1KQA A;  2VS5 A;  4EAA A;  5C48 A;  1H4C A;  4IRP A;  1MP3 A;  1LZI A;  3ECT A;  3MQH A;  3IXC A;  4KC1 A;  1MR9 A;  1S4N A;  4UEG A;  3VBK A;  2WVK A;  1FXO A;  4EE3 A;  3I0I X;  3NZ2 A;  1NHE B;  4B4M A;  3U0Y A;  4KPZ A;  1TW1 A;  3OU9 A;  2P2O A;  1O23 B;  3CKO A;  3Q7U A;  3T7O A;  1G93 A;  1K4V A;  2GGO A;  2OI6 A;  1O7O A;  4Y9X A;  1KRV A;  3T57 A;  2RIX A;  2AGD A;  1KK4 A;  3P1B A;  4HG6 A;  2OEG A;  2RIY A;  2O1H A;  4EQY A;  1PZY B;  3DHO A;  1QQ0 A;  1NQI B;  2XWN A;  3PKQ A;  2P73 A;  5D91 A;  2W0V A;  2D7R A;  4G3S A;  1MP5 A;  2P72 A;  1G2V A;  4HO8 A;  1VGT A;  3FS8 A;  3TK8 A;  4KNR A;  1O7Q A;  2Z86 A;  3I0L A;  3OH1 A;  4L41 C;  5DEM A;  5DEP A;  4M98 A;  2OEF A;  2JF2 A;  3USQ A;  4HCQ A;  4N27 A;  1OQM B;  2Z87 A;  4Y7G A;  4EA9 A;  1S4O A;  4Y7T A;  4D11 A;  3R8Y A;  2WGZ A;  1FRW A;  1FZW A;  4IHH A;  1R7V A;  4Y7U A;  3FSX A;  3CKJ A;  1VPA A;  2NPO A;  1V82 A;  2XAT A;  5E3P A;  4JIS A;  5FV9 A;  4E79 A;  1H7H A;  4CJ8 A;  3BSY A;  5C4F A;  1WSZ A;  5DDT A;  4ZDQ A;  2I5E A;  1LL2 A;  2Y4K A;  2X65 A;  1WT0 A;  3TZT A;  4KQL A;  2QGI A;  4D48 A;  1SS9 A;  5L6V A;  4N69 A;  3V8Z A;  4IHF A;  4ARW A;  2BO6 A;  1G9R A;  3D98 A;  5JQQ A;  4M2A A;  2Y4L A;  2RJ8 A;  5BXC A;  5C4E A;  3USR A;  4HO5 A;  3U2V A;  2D0J A;  1R7X A;  3RSB A;  2X5Z A;  1FR8 A;  2FKO A;  5CQN X;  5IDT A;  3V0N A;  3R3R A;  5FTS A;  1KRR A;  1THJ A;  3FTT A;  1H7L A;  3D5N A;  1G23 A;  5CQP A;  1VZU A;  5EJZ A;  4EEO A;  1LZ7 A;  3ZLK A;  2OI7 A;  1JV1 A;  3R1W A;  2AQ9 A;  2VFZ A;  5J49 A;  5IFY A;  3F1C A;  1YP4 A;  3V0P A;  4Q7C A;  4EE4 A;  3HJJ A;  3KWD A;  3FOQ A;  3I0J A;  3SXG A;  3T7N A;  3K8D A;  1H5S C;  2FY7 A;  3CU0 A;  4NAI A;  1H5T B;  1H7T A;  1INJ A;  1J2Z A;  4E6T A;  2DPW A;  2Y6P A;  2V0I A;  3IGJ A;  1ZI1 A;  4MIX A;  1MC3 A;  1FXJ A;  1ZI4 A;  3N9W A;  3LW6 A;  3I0F A;  4R37 A;  4IRQ A;  4MND A;  3CJ8 A;  4G87 A;  1ZI3 A;  1VZT A;  2FFV A;  3PKP A;  1H7E A;  4DE7 A;  4YS8 A;  1MR7 A;  2WEE A;  4KRV A;  3V0O A;  1H7Q A;  3I0H A;  3SX5 A;  4FRM A;  2RIZ A;  2O1F A;  4XWI A;  1HJL A;  4AYJ A;  1I52 A;  4B5B A;  1G97 A;  1XHD A;  1H4E A;  3R2W A;  1VZX A;  2ZU9 A;  4D0T A;  2V0J A;  1R82 A;  1JV3 A;  2PGY A;  3Q1X A;  1ZI5 A;  2RJ6 A;  4FIY A;  2Q4J A;  3JQY A;  1XZ6 A;  2BO4 A;  2XMH A;  1VGU A;  2O1G A;  1GWV A;  2PGV A;  4Y6N A;  4Y64 A;  1MRL A;  1QRL A;  2YCM A;  1H5S D;  1KGQ A;  4KPX A;  2AH9 A;  3KWC A;  2E8B A;  4Y7V A;  1R81 A;  3F1X A;  3ZF8 A;  1FO9 A;  4BMA A;  2QH5 A;  5AJP A;  1VM8 A;  2WAW A;  1QRF A;  3SXB A;  5CQL X;  4HO0 A;  4Y6U A;  3ZGG A;  1LVW A;  3U2U A;  2GGQ A;  3IOH A;  1TVY A;  4AYL A;  3SX3 A;  4KT7 A;  1NWG B;  3KWE A;  2YQJ A;  4Y63 A;  3SXD A;  5I1F A;  1ZJ2 A;  4B2X A;  1T3D A;  2BO8 A;  4R36 A;  2RJ7 A;  4NAL A;  2W0W A;  1S4P A;  5C1H A;  3I0E A;  3VNP A;  3EH0 A;  3VBP A;  3BCV A;  1LZJ A;  3Q80 A;  4C2S A;  4HO4 A;  4HO3 A;  3MC4 A;  1LL0 A;  2AM4 A;  4D0Z A;  1QWJ A;  4AC3 A;  2AM3 A;  1OMX A;  2Y4M A;  2YQS A;  2I7B A;  4ASJ A;  5EIY A;  3EE5 A;  2FFU A;  4LW6 A;  4B4G A;  1NMM B;  3OKR A;  5CMJ A;  1IIM A;  1GQ9 A;  5AJO A;  1ZCY A;  2V0H A;  2JCK A;  3OH0 A;  1H5R A;  1MP4 A;  1O0R A;  5C3D A;  4JD0 A;  5ADX U;  2WVM A;  2UX8 A;  2VK9 A;  1G95 A;  3OC9 A;  3R5A A;  1FWY A;  5FTV A;  1WT3 A;  4M99 A;  2RJ0 A;  3JUJ A;  2VHE A;  4CJB A;  2JF3 A;  3R5C A;  3CKV A;  3DK5 A;  2RJ4 A;  1GA8 A;  2E3D A;  4HZD A;  4MYO A;  4EVW A;  3E25 A;  2AM5 A;  1KHR A;  2YC5 A;  4J09 A;  1G3L A;  4KC4 A;  2RJ5 A;  3SXC A;  1YP3 A;  3R0S A;  4E6U A;  1JVG A;  4MYB A;  1QRM A;  5L6S A;  4KNX A;  3GUE A;  1GX4 A;  4NAK A;  1HM8 A;  4EEM A;  4B3U A;  4M9C A;  1ON6 A;  3IOI A;  3U0X A;  4K6R A;  5C4C A;  3BSS A;  1E5K A;  3CKQ A;  1VGW A;  1GWW A;  3SX8 A;  1Z90 A;  3VBM A;  4KXO A;  3R5D A;  1NKH B;  2VSH A;  3ZLL A;  5C47 A;  3GVD A;  5CMH A;  3GOS A;  3JUK A;  4FRO A;  3OTM A;  1G1L A;  4AA7 A;  3NGW A;  5C8R A;  2QIA A;  3OTZ A;  4HUS A;  1ZJ0 A;  3I3A A;  2QKX A;  1ZJP A;  2VS4 A;  4CVH A;  1IIN A;  1V67 A;  1VIC A;  4FCE A;  1XAT A;  4FRD A;  1H7G A;  3HL3 A;  4LW3 A;  1V3W A;  5DG3 A;  1WT1 A;  3HSQ A;  1V84 A;  1QGS A;  1ON8 A;  1QGQ A;  3OW5 A;  1V83 A;  4CJC A;  5HS2 A;  3CGX A;  1JYK A;  4HO9 A;  3BRK X;  3Q4S A;  2WLC A;  3QVB A;  3O3P A;  3TV0 A;  1QRE A;  4P00 A;  3TQD A;  3PMO A;  1TW5 A;  2A8W A;  3RMW A;  1INI A;  2X60 A;  3DUV A;  5CMF X;  1H5R B;  1NF5 B;  5AJN A;  5D92 A;  3U2W A;  3I0G A;  4Y7F A;  4AAW A;  3FSY A;  1KWS A;  5C3A A;  3TIO A;  3R3I A;  3TDT A;  4O6N A;  2TDT A;  1SST A;  1W77 A;  3SXA A;  1ZIZ A;  1KGT A;  2YQC A;  3I0C A;  3E26 A;  4B4B A;  5U2K A;  2D7I A;  2JCL A;  3V91 A;  4N6A A;  4HO2 A;  3VBL A;  5C38 A;  5AFU U;  3MQG A;  3BXY A;  3TWD A;  2XWM A;  3SXE A;  3D8V A;  2J0B A;  5C36 A;  4ISX A;  3RMV A;  1H7F A;  1ZCV A;  2WE9 A;  2AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...