3TV0A

Structure of dynactin p27 subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
143
Chain Sequence
SVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNIKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Dynactin subunit 6
publication title Dynactin targets Polo-like kinase 1 to kinetochores
rcsb
source organism Homo sapiens
total genus 49
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tv0A00
1V3WA 2IUAA 1QRFA 4M2AA 4KPZA 5DG3A 1HM0A 3TK8A 3TV0A 2IU8A 3FSYA 5L6SA 3SPTA 3MQHA 1KK6A 4N27A 3VBLA 1MR9A 3R8YA 4KNRA 4HUSA 1YP3A 2WLFA 4KQLA 4R37A 3I3XA 3VBNA 3VBKA 3MQGA 3R0SA 2OI6A 2OI7A 3IGJA 4HURA 2W0VA 5DEMA 3TDTA 3OU9A 3R5DA 4FCEA 4N69A 5E3PA 3VBPA 3D8VA 1KGQA 3DHOA 3DK5A 3KWEA 3DJ4A 3VBJA 2OI5A 2JF3A 4ISXA 3FSCA 3CJ8A 3ECTA 3Q1XA 3TWDA 3FOQA 1MRLA 3KWCA 1G97A 3EH0A 3HSQA 3T57A 3HJJA 3MC4A 3R5AA 2WLEA 4HCQA 4EAAA 4EGGA 3BSWA 1HM8A 3VNPA 1OCXA 2NPOA 3JQYA 3FTTA 4IHFA 4N6AA 1TDTA 5L6VA 3KWDA 4EA9A 3BXYA 2V0LA 2XATA 2IU9A 5E3RA 3BSSA 3R5BA 4R36A 4HZCA 3V4EA 4AAWA 4R7PA 4EQYA 1KRVA 1SSTA 2OEGA 2W0WA 2Q4JA 2V0KA 2V0JA 2GGOA 1V67A 4KPXA 3F1XA 4J18A 2RIJA 3R1WA 2WLGA 1S80A 1QRGA 2WLDA 1FXJA 4AC3A 2VD4A 1HV9A 2OEFA 4M28A 1XATA 4DCLA 3I3AA 3BFPA 3VBMA 1J2ZA 3P1BA 1FWYA 1HM9A 4K6RA 1KHRA 4EABA 5E3QA 1QREA 2TDTA 3D98A 4MYOA 3TIOA 2AQ9A 1KGTA 4KNXA 3OTMA 2V0IA 2QKXA 3GOSA 4MFGA 3P47A 4H7OA 4E1KA 3OUPA 3ST8A 1MR7A 1KK4A 4E6UA 3EEVA 4G87A 3FSBA 5AFUU 4HZDA 1KRRA 4M98A 2QIAA 3PMOA 4AA7A 3GVDA 1KQAA 1LXAA 1KK5A 4IHGA 4MZUA 4EA8A 1T3DA 3R3IA 5U2KA 1XHDA 1QQ0A 1Z90A 4G3QA 3IXCA 5ADXU 3OW5A 3R3RA 1QRMA 3FWWA 3NZ2A 4G3PA 4M99A 4M9CA 2ICXA 3FS8A 3R2WA 2IC7A 5AFUV 2JF2A 4M2BA 2FKOA 2QIVX 1KRUA 2V0HA 3C8VA 1SSQA 3OTZA 4IHHA 4N6BA 1G95A 3VBIA 2GGQA 4E6TA 4J09A 2I5KA 2ICYA 1YP4A 3BSYA 5ADXV 2P2OA 2VHEA 3R5CA 1THJA 2WLCA 3FSXA 3GUEA 3SRTA 5F42A 4G3SA 4E75A 3EG4A 1YP2A 1SSMA 3TISA 4E79A 5DEPA 1QRLA 4EA7A 3BRKX
chains in the Genus database with same CATH superfamily
1V3WA 1L0SA 2IUAA 3GQAA 1QRFA 4M2AA 4KPZA 5DG3A 1HM0A 3TK8A 3TV0A 2IU8A 3FSYA 5L6SA 3SPTA 3MQHA 1KK6A 4N27A 3VBLA 1MR9A 3R8YA 4KNRA 3GQ7A 4HUSA 1YP3A 2WLFA 4KQLA 4R37A 3I3XA 3VBNA 3VBKA 3MQGA 3R0SA 2OI6A 2OI7A 3IGJA 4HURA 2W0VA 5DEMA 3TDTA 3OU9A 3R5DA 4FCEA 4N69A 5E3PA 3VBPA 3D8VA 1KGQA 3DHOA 3DK5A 3KWEA 3DJ4A 3VBJA 2OI5A 2JF3A 4ISXA 3FSCA 3CJ8A 3ECTA 3Q1XA 3TWDA 3FOQA 1MRLA 3KWCA 1G97A 3EH0A 3HSQA 3T57A 3HJJA 3MC4A 3R5AA 2WLEA 4HCQA 4EAAA 4EGGA 3BSWA 1HM8A 3VNPA 1OCXA 2NPOA 3JQYA 3SUCA 3FTTA 4IHFA 4N6AA 1TDTA 5L6VA 3KWDA 4EA9A 3OH0A 3GQ9A 3BXYA 1Z2FA 2V0LA 2XATA 2IU9A 5E3RA 3BSSA 3R5BA 4R36A 4HZCA 3V4EA 4AAWA 4R7PA 4EQYA 1KRVA 1SSTA 2OEGA 2W0WA 2Q4JA 3OH3A 2V0KA 2V0JA 2GGOA 1V67A 4KPXA 3F1XA 4J18A 1M8NA 2RIJA 3R1WA 2WLGA 3OH4A 1S80A 1QRGA 2WLDA 1FXJA 4AC3A 2VD4A 1HV9A 2OEFA 4M28A 1XATA 4DCLA 3I3AA 3BFPA 3VBMA 1J2ZA 3P1BA 1FWYA 1HM9A 4K6RA 1KHRA 4EABA 5E3QA 1QREA 2TDTA 3D98A 4MYOA 3TIOA 2AQ9A 1KGTA 3OH2A 3OH1A 4KNXA 3OTMA 2V0IA 2QKXA 3GOSA 1N4IA 3OGZA 4MFGA 3P47A 4H7OA 4E1KA 3OUPA 3ST8A 1EWWA 1MR7A 1KK4A 4E6UA 3EEVA 4G87A 3FSBA 5AFUU 4HZDA 1KRRA 4M98A 2QIAA 3PMOA 4AA7A 3GVDA 1KQAA 1LXAA 1KK5A 4IHGA 4MZUA 4EA8A 1T3DA 3R3IA 5U2KA 1XHDA 1QQ0A 1Z90A 4G3QA 3IXCA 5ADXU 3OW5A 3R3RA 1QRMA 3FWWA 3NZ2A 4G3PA 4M99A 4M9CA 2ICXA 3FS8A 3R2WA 2IC7A 5AFUV 2JF2A 4M2BA 2FKOA 2QIVX 1KRUA 2V0HA 3C8VA 1SSQA 3OTZA 4IHHA 4N6BA 1G95A 3VBIA 2GGQA 4E6TA 4J09A 2I5KA 2ICYA 1YP4A 3BSYA 5ADXV 2P2OA 2VHEA 3R5CA 1THJA 2WLCA 3FSXA 3GUEA 3SRTA 3GQ8A 5F42A 4G3SA 4E75A 3EG4A 1YP2A 1SSMA 3TISA 4E79A 5DEPA 1QRLA 4EA7A 3BRKX
chains in the Genus database with same CATH topology
1V3WA 2IUAA 1QRFA 4M2AA 4KPZA 5DG3A 1HM0A 3TK8A 3TV0A 2IU8A 3FSYA 5L6SA 3SPTA 3MQHA 1KK6A 4N27A 3VBLA 1MR9A 3R8YA 4KNRA 4HUSA 1YP3A 2WLFA 4KQLA 4R37A 3I3XA 3VBNA 3VBKA 3MQGA 3R0SA 2OI6A 2OI7A 3IGJA 4HURA 2W0VA 5DEMA 3TDTA 3OU9A 3R5DA 4FCEA 4N69A 5E3PA 3VBPA 3D8VA 1KGQA 3DHOA 3DK5A 3KWEA 3DJ4A 3VBJA 2OI5A 2JF3A 4ISXA 3FSCA 3CJ8A 3ECTA 3Q1XA 3TWDA 3FOQA 1MRLA 3KWCA 1G97A 3EH0A 3HSQA 3T57A 3HJJA 3MC4A 3R5AA 2WLEA 4HCQA 4EAAA 4EGGA 3BSWA 1HM8A 3VNPA 1OCXA 2NPOA 3JQYA 3FTTA 4IHFA 4N6AA 1TDTA 5L6VA 3KWDA 4EA9A 3BXYA 2V0LA 2XATA 2IU9A 5E3RA 3BSSA 3R5BA 4R36A 4HZCA 3V4EA 4AAWA 4R7PA 4EQYA 1KRVA 1SSTA 2OEGA 2W0WA 2Q4JA 2V0KA 2V0JA 2GGOA 1V67A 4KPXA 3F1XA 4J18A 2RIJA 3R1WA 2WLGA 1S80A 1QRGA 2WLDA 1FXJA 4AC3A 2VD4A 1HV9A 2OEFA 4M28A 1XATA 4DCLA 3I3AA 3BFPA 3VBMA 1J2ZA 3P1BA 1FWYA 1HM9A 4K6RA 1KHRA 4EABA 5E3QA 1QREA 2TDTA 3D98A 4MYOA 3TIOA 2AQ9A 1KGTA 4KNXA 3OTMA 2V0IA 2QKXA 3GOSA 4MFGA 3P47A 4H7OA 4E1KA 3OUPA 3ST8A 1MR7A 1KK4A 4E6UA 3EEVA 4G87A 3FSBA 5AFUU 4HZDA 1KRRA 4M98A 2QIAA 3PMOA 4AA7A 3GVDA 1KQAA 1LXAA 1KK5A 4IHGA 4MZUA 4EA8A 1T3DA 3R3IA 5U2KA 1XHDA 1QQ0A 1Z90A 4G3QA 3IXCA 5ADXU 3OW5A 3R3RA 1QRMA 3FWWA 3NZ2A 4G3PA 4M99A 4M9CA 2ICXA 3FS8A 3R2WA 2IC7A 5AFUV 2JF2A 4M2BA 2FKOA 2QIVX 1KRUA 2V0HA 3C8VA 1SSQA 3OTZA 4IHHA 4N6BA 1G95A 3VBIA 2GGQA 4E6TA 4J09A 2I5KA 2ICYA 1YP4A 3BSYA 5ADXV 2P2OA 2VHEA 3R5CA 1THJA 2WLCA 3FSXA 3GUEA 3SRTA 5F42A 4G3SA 4E75A 3EG4A 1YP2A 1SSMA 3TISA 4E79A 5DEPA 1QRLA 4EA7A 3BRKX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V3W A;  2IUA A;  1QRF A;  4M2A A;  4KPZ A;  5DG3 A;  1HM0 A;  3TK8 A;  3TV0 A;  2IU8 A;  3FSY A;  5L6S A;  3SPT A;  3MQH A;  1KK6 A;  4N27 A;  3VBL A;  1MR9 A;  3R8Y A;  4KNR A;  4HUS A;  1YP3 A;  2WLF A;  4KQL A;  4R37 A;  3I3X A;  3VBN A;  3VBK A;  3MQG A;  3R0S A;  2OI6 A;  2OI7 A;  3IGJ A;  4HUR A;  2W0V A;  5DEM A;  3TDT A;  3OU9 A;  3R5D A;  4FCE A;  4N69 A;  5E3P A;  3VBP A;  3D8V A;  1KGQ A;  3DHO A;  3DK5 A;  3KWE A;  3DJ4 A;  3VBJ A;  2OI5 A;  2JF3 A;  4ISX A;  3FSC A;  3CJ8 A;  3ECT A;  3Q1X A;  3TWD A;  3FOQ A;  1MRL A;  3KWC A;  1G97 A;  3EH0 A;  3HSQ A;  3T57 A;  3HJJ A;  3MC4 A;  3R5A A;  2WLE A;  4HCQ A;  4EAA A;  4EGG A;  3BSW A;  1HM8 A;  3VNP A;  1OCX A;  2NPO A;  3JQY A;  3FTT A;  4IHF A;  4N6A A;  1TDT A;  5L6V A;  3KWD A;  4EA9 A;  3BXY A;  2V0L A;  2XAT A;  2IU9 A;  5E3R A;  3BSS A;  3R5B A;  4R36 A;  4HZC A;  3V4E A;  4AAW A;  4R7P A;  4EQY A;  1KRV A;  1SST A;  2OEG A;  2W0W A;  2Q4J A;  2V0K A;  2V0J A;  2GGO A;  1V67 A;  4KPX A;  3F1X A;  4J18 A;  2RIJ A;  3R1W A;  2WLG A;  1S80 A;  1QRG A;  2WLD A;  1FXJ A;  4AC3 A;  2VD4 A;  1HV9 A;  2OEF A;  4M28 A;  1XAT A;  4DCL A;  3I3A A;  3BFP A;  3VBM A;  1J2Z A;  3P1B A;  1FWY A;  1HM9 A;  4K6R A;  1KHR A;  4EAB A;  5E3Q A;  1QRE A;  2TDT A;  3D98 A;  4MYO A;  3TIO A;  2AQ9 A;  1KGT A;  4KNX A;  3OTM A;  2V0I A;  2QKX A;  3GOS A;  4MFG A;  3P47 A;  4H7O A;  4E1K A;  3OUP A;  3ST8 A;  1MR7 A;  1KK4 A;  4E6U A;  3EEV A;  4G87 A;  3FSB A;  5AFU U;  4HZD A;  1KRR A;  4M98 A;  2QIA A;  3PMO A;  4AA7 A;  3GVD A;  1KQA A;  1LXA A;  1KK5 A;  4IHG A;  4MZU A;  4EA8 A;  1T3D A;  3R3I A;  5U2K A;  1XHD A;  1QQ0 A;  1Z90 A;  4G3Q A;  3IXC A;  5ADX U;  3OW5 A;  3R3R A;  1QRM A;  3FWW A;  3NZ2 A;  4G3P A;  4M99 A;  4M9C A;  2ICX A;  3FS8 A;  3R2W A;  2IC7 A;  5AFU V;  2JF2 A;  4M2B A;  2FKO A;  2QIV X;  1KRU A;  2V0H A;  3C8V A;  1SSQ A;  3OTZ A;  4IHH A;  4N6B A;  1G95 A;  3VBI A;  2GGQ A;  4E6T A;  4J09 A;  2I5K A;  2ICY A;  1YP4 A;  3BSY A;  5ADX V;  2P2O A;  2VHE A;  3R5C A;  1THJ A;  2WLC A;  3FSX A;  3GUE A;  3SRT A;  5F42 A;  4G3S A;  4E75 A;  3EG4 A;  1YP2 A;  1SSM A;  3TIS A;  4E79 A;  5DEP A;  1QRL A;  4EA7 A;  3BRK X; 
#chains in the Genus database with same CATH topology
 1V3W A;  1L0S A;  2IUA A;  3GQA A;  1QRF A;  4M2A A;  4KPZ A;  5DG3 A;  1HM0 A;  3TK8 A;  3TV0 A;  2IU8 A;  3FSY A;  5L6S A;  3SPT A;  3MQH A;  1KK6 A;  4N27 A;  3VBL A;  1MR9 A;  3R8Y A;  4KNR A;  3GQ7 A;  4HUS A;  1YP3 A;  2WLF A;  4KQL A;  4R37 A;  3I3X A;  3VBN A;  3VBK A;  3MQG A;  3R0S A;  2OI6 A;  2OI7 A;  3IGJ A;  4HUR A;  2W0V A;  5DEM A;  3TDT A;  3OU9 A;  3R5D A;  4FCE A;  4N69 A;  5E3P A;  3VBP A;  3D8V A;  1KGQ A;  3DHO A;  3DK5 A;  3KWE A;  3DJ4 A;  3VBJ A;  2OI5 A;  2JF3 A;  4ISX A;  3FSC A;  3CJ8 A;  3ECT A;  3Q1X A;  3TWD A;  3FOQ A;  1MRL A;  3KWC A;  1G97 A;  3EH0 A;  3HSQ A;  3T57 A;  3HJJ A;  3MC4 A;  3R5A A;  2WLE A;  4HCQ A;  4EAA A;  4EGG A;  3BSW A;  1HM8 A;  3VNP A;  1OCX A;  2NPO A;  3JQY A;  3SUC A;  3FTT A;  4IHF A;  4N6A A;  1TDT A;  5L6V A;  3KWD A;  4EA9 A;  3OH0 A;  3GQ9 A;  3BXY A;  1Z2F A;  2V0L A;  2XAT A;  2IU9 A;  5E3R A;  3BSS A;  3R5B A;  4R36 A;  4HZC A;  3V4E A;  4AAW A;  4R7P A;  4EQY A;  1KRV A;  1SST A;  2OEG A;  2W0W A;  2Q4J A;  3OH3 A;  2V0K A;  2V0J A;  2GGO A;  1V67 A;  4KPX A;  3F1X A;  4J18 A;  1M8N A;  2RIJ A;  3R1W A;  2WLG A;  3OH4 A;  1S80 A;  1QRG A;  2WLD A;  1FXJ A;  4AC3 A;  2VD4 A;  1HV9 A;  2OEF A;  4M28 A;  1XAT A;  4DCL A;  3I3A A;  3BFP A;  3VBM A;  1J2Z A;  3P1B A;  1FWY A;  1HM9 A;  4K6R A;  1KHR A;  4EAB A;  5E3Q A;  1QRE A;  2TDT A;  3D98 A;  4MYO A;  3TIO A;  2AQ9 A;  1KGT A;  3OH2 A;  3OH1 A;  4KNX A;  3OTM A;  2V0I A;  2QKX A;  3GOS A;  1N4I A;  3OGZ A;  4MFG A;  3P47 A;  4H7O A;  4E1K A;  3OUP A;  3ST8 A;  1EWW A;  1MR7 A;  1KK4 A;  4E6U A;  3EEV A;  4G87 A;  3FSB A;  5AFU U;  4HZD A;  1KRR A;  4M98 A;  2QIA A;  3PMO A;  4AA7 A;  3GVD A;  1KQA A;  1LXA A;  1KK5 A;  4IHG A;  4MZU A;  4EA8 A;  1T3D A;  3R3I A;  5U2K A;  1XHD A;  1QQ0 A;  1Z90 A;  4G3Q A;  3IXC A;  5ADX U;  3OW5 A;  3R3R A;  1QRM A;  3FWW A;  3NZ2 A;  4G3P A;  4M99 A;  4M9C A;  2ICX A;  3FS8 A;  3R2W A;  2IC7 A;  5AFU V;  2JF2 A;  4M2B A;  2FKO A;  2QIV X;  1KRU A;  2V0H A;  3C8V A;  1SSQ A;  3OTZ A;  4IHH A;  4N6B A;  1G95 A;  3VBI A;  2GGQ A;  4E6T A;  4J09 A;  2I5K A;  2ICY A;  1YP4 A;  3BSY A;  5ADX V;  2P2O A;  2VHE A;  3R5C A;  1THJ A;  2WLC A;  3FSX A;  3GUE A;  3SRT A;  3GQ8 A;  5F42 A;  4G3S A;  4E75 A;  3EG4 A;  1YP2 A;  1SSM A;  3TIS A;  4E79 A;  5DEP A;  1QRL A;  4EA7 A;  3BRK X; 
#chains in the Genus database with same CATH homology
 1V3W A;  2IUA A;  1QRF A;  4M2A A;  4KPZ A;  5DG3 A;  1HM0 A;  3TK8 A;  3TV0 A;  2IU8 A;  3FSY A;  5L6S A;  3SPT A;  3MQH A;  1KK6 A;  4N27 A;  3VBL A;  1MR9 A;  3R8Y A;  4KNR A;  4HUS A;  1YP3 A;  2WLF A;  4KQL A;  4R37 A;  3I3X A;  3VBN A;  3VBK A;  3MQG A;  3R0S A;  2OI6 A;  2OI7 A;  3IGJ A;  4HUR A;  2W0V A;  5DEM A;  3TDT A;  3OU9 A;  3R5D A;  4FCE A;  4N69 A;  5E3P A;  3VBP A;  3D8V A;  1KGQ A;  3DHO A;  3DK5 A;  3KWE A;  3DJ4 A;  3VBJ A;  2OI5 A;  2JF3 A;  4ISX A;  3FSC A;  3CJ8 A;  3ECT A;  3Q1X A;  3TWD A;  3FOQ A;  1MRL A;  3KWC A;  1G97 A;  3EH0 A;  3HSQ A;  3T57 A;  3HJJ A;  3MC4 A;  3R5A A;  2WLE A;  4HCQ A;  4EAA A;  4EGG A;  3BSW A;  1HM8 A;  3VNP A;  1OCX A;  2NPO A;  3JQY A;  3FTT A;  4IHF A;  4N6A A;  1TDT A;  5L6V A;  3KWD A;  4EA9 A;  3BXY A;  2V0L A;  2XAT A;  2IU9 A;  5E3R A;  3BSS A;  3R5B A;  4R36 A;  4HZC A;  3V4E A;  4AAW A;  4R7P A;  4EQY A;  1KRV A;  1SST A;  2OEG A;  2W0W A;  2Q4J A;  2V0K A;  2V0J A;  2GGO A;  1V67 A;  4KPX A;  3F1X A;  4J18 A;  2RIJ A;  3R1W A;  2WLG A;  1S80 A;  1QRG A;  2WLD A;  1FXJ A;  4AC3 A;  2VD4 A;  1HV9 A;  2OEF A;  4M28 A;  1XAT A;  4DCL A;  3I3A A;  3BFP A;  3VBM A;  1J2Z A;  3P1B A;  1FWY A;  1HM9 A;  4K6R A;  1KHR A;  4EAB A;  5E3Q A;  1QRE A;  2TDT A;  3D98 A;  4MYO A;  3TIO A;  2AQ9 A;  1KGT A;  4KNX A;  3OTM A;  2V0I A;  2QKX A;  3GOS A;  4MFG A;  3P47 A;  4H7O A;  4E1K A;  3OUP A;  3ST8 A;  1MR7 A;  1KK4 A;  4E6U A;  3EEV A;  4G87 A;  3FSB A;  5AFU U;  4HZD A;  1KRR A;  4M98 A;  2QIA A;  3PMO A;  4AA7 A;  3GVD A;  1KQA A;  1LXA A;  1KK5 A;  4IHG A;  4MZU A;  4EA8 A;  1T3D A;  3R3I A;  5U2K A;  1XHD A;  1QQ0 A;  1Z90 A;  4G3Q A;  3IXC A;  5ADX U;  3OW5 A;  3R3R A;  1QRM A;  3FWW A;  3NZ2 A;  4G3P A;  4M99 A;  4M9C A;  2ICX A;  3FS8 A;  3R2W A;  2IC7 A;  5AFU V;  2JF2 A;  4M2B A;  2FKO A;  2QIV X;  1KRU A;  2V0H A;  3C8V A;  1SSQ A;  3OTZ A;  4IHH A;  4N6B A;  1G95 A;  3VBI A;  2GGQ A;  4E6T A;  4J09 A;  2I5K A;  2ICY A;  1YP4 A;  3BSY A;  5ADX V;  2P2O A;  2VHE A;  3R5C A;  1THJ A;  2WLC A;  3FSX A;  3GUE A;  3SRT A;  5F42 A;  4G3S A;  4E75 A;  3EG4 A;  1YP2 A;  1SSM A;  3TIS A;  4E79 A;  5DEP A;  1QRL A;  4EA7 A;  3BRK X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...