3TV0A

Structure of dynactin p27 subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
143
Chain Sequence
b'SVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNIKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 6
publication title Dynactin targets Polo-like kinase 1 to kinetochores
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 49
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tv0A00
4EA8A 3HJJA 3R5BA 5F42A 3CJ8A 2OEGA 1SSQA 1KRVA 4J18A 5AFUV 4J09A 2RIJA 3T57A 4AA7A 3FTTA 2V0HA 4DCLA 3F1XA 2GGOA 5ADXV 4HUSA 3BXYA 3R8YA 1LXAA 5E3RA 1SSMA 3KWCA 3I3XA 1HM0A 3VBNA 3OW5A 1G97A 5L6SA 1XATA 3OUPA 3HSQA 1THJA 4G87A 2GGQA 3VBKA 2OI7A 2QIAA 1YP2A 3FWWA 2QKXA 5L6VA 2WLEA 4IHHA 1QRLA 5DG3A 1KK5A 1TDTA 1KGTA 3R5CA 1QREA 2WLCA 4N6AA 3VBJA 2XATA 3OTMA 4FCEA 2Q4JA 1KQAA 2V0LA 1XHDA 3R1WA 1HV9A 2IU8A 3KWDA 2OI6A 4M2AA 3BSYA 5E3PA 3TISA 1HM8A 3ECTA 3VBIA 4IHGA 1KRUA 4MFGA 4M2BA 1SSTA 1QQ0A 4R37A 3VNPA 4E1KA 4AC3A 3R0SA 3TWDA 4E75A 3MQHA 1S80A 3D8VA 1FWYA 3EG4A 4EQYA 3R5AA 2W0WA 4E79A 3OU9A 2WLDA 4R7PA 1HM9A 1OCXA 3R5DA 3IXCA 5DEPA 4ISXA 4EA7A 3JQYA 2I5KA 4KQLA 3FSCA 3PMOA 3IGJA 1V3WA 4KPZA 1QRMA 4HZDA 4EABA 4M99A 3BSWA 3R3IA 3GOSA 3P1BA 3VBMA 1MR9A 3GUEA 1KK6A 3FS8A 2JF2A 3Q1XA 3FSYA 1QRFA 3OTZA 3TV0A 4MYOA 2W0VA 2FKOA 1YP4A 5E3QA 1KGQA 1MRLA 1KK4A 2IU9A 2JF3A 2VD4A 3P47A 2IUAA 4KPXA 4KNXA 1FXJA 4M9CA 3V4EA 5U2KA 1G95A 3C8VA 2OEFA 3KWEA 4G3QA 2ICYA 3BFPA 4IHFA 4EA9A 4N69A 2V0JA 1J2ZA 1MR7A 3MC4A 4E6TA 4R36A 4K6RA 4HZCA 3DHOA 3SRTA 3TDTA 1QRGA 1KRRA 2WLGA 3GVDA 3BSSA 3I3AA 4E6UA 3TK8A 3EH0A 3D98A 4M98A 2AQ9A 3FSXA 3R3RA 2P2OA 3R2WA 5DEMA 4N6BA 3VBLA 2NPOA 3BRKX 4H7OA 2IC7A 2QIVX 3FSBA 4HURA 2VHEA 3DJ4A 4G3SA 3MQGA 1YP3A 3VBPA 4N27A 2ICXA 3TIOA 3EEVA 3NZ2A 1Z90A 4AAWA 5AFUU 4MZUA 1T3DA 2V0KA 2V0IA 2WLFA 4EAAA 5ADXU 3SPTA 3DK5A 2TDTA 4KNRA 4EGGA 3ST8A 4HCQA 3FOQA 4G3PA 1KHRA 4M28A 2OI5A 1V67A
chains in the Genus database with same CATH superfamily
4EA8A 3HJJA 3R5BA 5F42A 3CJ8A 2OEGA 1SSQA 1KRVA 4J18A 5AFUV 4J09A 2RIJA 3OH3A 3T57A 4AA7A 3FTTA 2V0HA 1Z2FA 4DCLA 3F1XA 2GGOA 5ADXV 4HUSA 3BXYA 3OH0A 3R8YA 1LXAA 5E3RA 1SSMA 3KWCA 3I3XA 1HM0A 3VBNA 3OW5A 1G97A 5L6SA 1XATA 3OUPA 3HSQA 1THJA 4G87A 2GGQA 3VBKA 2OI7A 2QIAA 1YP2A 3FWWA 2QKXA 5L6VA 2WLEA 4IHHA 1QRLA 5DG3A 1KK5A 1HV9A 1TDTA 1KGTA 3R5CA 1QREA 2WLCA 4N6AA 3VBJA 2XATA 3OTMA 4FCEA 2Q4JA 1KQAA 3GQ8A 2V0LA 1XHDA 3R1WA 3OH1A 2IU8A 3KWDA 2OI6A 4M2AA 3BSYA 5E3PA 3TISA 1HM8A 3ECTA 3VBIA 4IHGA 1KRUA 4MFGA 4M2BA 1SSTA 1QQ0A 4R37A 3GQ9A 3VNPA 4E1KA 4AC3A 3R0SA 3TWDA 4E75A 3MQHA 1S80A 3D8VA 1FWYA 3EG4A 4EQYA 3R5AA 2W0WA 4E79A 3OU9A 2WLDA 4R7PA 1HM9A 3OH4A 1OCXA 3R5DA 3IXCA 1EWWA 5DEPA 4ISXA 4EA7A 3JQYA 2I5KA 4KQLA 3FSCA 3PMOA 3IGJA 1V3WA 4KPZA 1QRMA 4HZDA 4EABA 4M99A 3BSWA 3R3IA 3GOSA 3P1BA 1M8NA 3VBMA 1MR9A 3GUEA 1KK6A 3FS8A 2JF2A 3Q1XA 3FSYA 1QRFA 3OTZA 3TV0A 4MYOA 2W0VA 2FKOA 1YP4A 5E3QA 1KGQA 1MRLA 1KK4A 2IU9A 2JF3A 2VD4A 3P47A 2IUAA 4KPXA 4KNXA 1FXJA 4M9CA 3V4EA 5U2KA 1G95A 3C8VA 2OEFA 3KWEA 4G3QA 2ICYA 3BFPA 4IHFA 4EA9A 4N69A 2V0JA 1J2ZA 1MR7A 3MC4A 4E6TA 4R36A 4K6RA 4HZCA 3DHOA 3SRTA 3TDTA 1QRGA 1KRRA 2WLGA 3GVDA 1L0SA 3BSSA 3I3AA 4E6UA 3TK8A 3EH0A 3D98A 4M98A 2AQ9A 3FSXA 3R3RA 3OGZA 2P2OA 3R2WA 5DEMA 4N6BA 3VBLA 2NPOA 3BRKX 4H7OA 2IC7A 2QIVX 3FSBA 4HURA 2VHEA 3DJ4A 4G3SA 3MQGA 1YP3A 3VBPA 4N27A 2ICXA 3TIOA 3EEVA 3NZ2A 1Z90A 4AAWA 1N4IA 3GQAA 4MZUA 3SUCA 5AFUU 3OH2A 1T3DA 2V0KA 2V0IA 2WLFA 4EAAA 5ADXU 3SPTA 3DK5A 2TDTA 4KNRA 4EGGA 3ST8A 4HCQA 3FOQA 3GQ7A 1KHRA 4G3PA 2OI5A 4M28A 1V67A
chains in the Genus database with same CATH topology
4EA8A 3HJJA 3R5BA 5F42A 3CJ8A 2OEGA 1SSQA 1KRVA 4J18A 5AFUV 4J09A 2RIJA 3T57A 4AA7A 3FTTA 2V0HA 4DCLA 3F1XA 2GGOA 5ADXV 4HUSA 3BXYA 3R8YA 1LXAA 5E3RA 1SSMA 3KWCA 3I3XA 1HM0A 3VBNA 3OW5A 1G97A 5L6SA 1XATA 3OUPA 3HSQA 1THJA 4G87A 2GGQA 3VBKA 2OI7A 2QIAA 1YP2A 3FWWA 2QKXA 5L6VA 2WLEA 4IHHA 1QRLA 5DG3A 1KK5A 1TDTA 1KGTA 3R5CA 1QREA 2WLCA 4N6AA 3VBJA 2XATA 3OTMA 4FCEA 2Q4JA 1KQAA 2V0LA 1XHDA 3R1WA 1HV9A 2IU8A 3KWDA 2OI6A 4M2AA 3BSYA 5E3PA 3TISA 1HM8A 3ECTA 3VBIA 4IHGA 1KRUA 4MFGA 4M2BA 1SSTA 1QQ0A 4R37A 3VNPA 4E1KA 4AC3A 3R0SA 3TWDA 4E75A 3MQHA 1S80A 3D8VA 1FWYA 3EG4A 4EQYA 3R5AA 2W0WA 4E79A 3OU9A 2WLDA 4R7PA 1HM9A 1OCXA 3R5DA 3IXCA 5DEPA 4ISXA 4EA7A 3JQYA 2I5KA 4KQLA 3FSCA 3PMOA 3IGJA 1V3WA 4KPZA 1QRMA 4HZDA 4EABA 4M99A 3BSWA 3R3IA 3GOSA 3P1BA 3VBMA 1MR9A 3GUEA 1KK6A 3FS8A 2JF2A 3Q1XA 3FSYA 1QRFA 3OTZA 3TV0A 4MYOA 2W0VA 2FKOA 1YP4A 5E3QA 1KGQA 1MRLA 1KK4A 2IU9A 2JF3A 2VD4A 3P47A 2IUAA 4KPXA 4KNXA 1FXJA 4M9CA 3V4EA 5U2KA 1G95A 3C8VA 2OEFA 3KWEA 4G3QA 2ICYA 3BFPA 4IHFA 4EA9A 4N69A 2V0JA 1J2ZA 1MR7A 3MC4A 4E6TA 4R36A 4K6RA 4HZCA 3DHOA 3SRTA 3TDTA 1QRGA 1KRRA 2WLGA 3GVDA 3BSSA 3I3AA 4E6UA 3TK8A 3EH0A 3D98A 4M98A 2AQ9A 3FSXA 3R3RA 2P2OA 3R2WA 5DEMA 4N6BA 3VBLA 2NPOA 3BRKX 4H7OA 2IC7A 2QIVX 3FSBA 4HURA 2VHEA 3DJ4A 4G3SA 3MQGA 1YP3A 3VBPA 4N27A 2ICXA 3TIOA 3EEVA 3NZ2A 1Z90A 4AAWA 5AFUU 4MZUA 1T3DA 2V0KA 2V0IA 2WLFA 4EAAA 5ADXU 3SPTA 3DK5A 2TDTA 4KNRA 4EGGA 3ST8A 4HCQA 3FOQA 4G3PA 1KHRA 4M28A 2OI5A 1V67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA8 A;  3HJJ A;  3R5B A;  5F42 A;  3CJ8 A;  2OEG A;  1SSQ A;  1KRV A;  4J18 A;  5AFU V;  4J09 A;  2RIJ A;  3T57 A;  4AA7 A;  3FTT A;  2V0H A;  4DCL A;  3F1X A;  2GGO A;  5ADX V;  4HUS A;  3BXY A;  3R8Y A;  1LXA A;  5E3R A;  1SSM A;  3KWC A;  3I3X A;  1HM0 A;  3VBN A;  3OW5 A;  1G97 A;  5L6S A;  1XAT A;  3OUP A;  3HSQ A;  1THJ A;  4G87 A;  2GGQ A;  3VBK A;  2OI7 A;  2QIA A;  1YP2 A;  3FWW A;  2QKX A;  5L6V A;  2WLE A;  4IHH A;  1QRL A;  5DG3 A;  1KK5 A;  1TDT A;  1KGT A;  3R5C A;  1QRE A;  2WLC A;  4N6A A;  3VBJ A;  2XAT A;  3OTM A;  4FCE A;  2Q4J A;  1KQA A;  2V0L A;  1XHD A;  3R1W A;  1HV9 A;  2IU8 A;  3KWD A;  2OI6 A;  4M2A A;  3BSY A;  5E3P A;  3TIS A;  1HM8 A;  3ECT A;  3VBI A;  4IHG A;  1KRU A;  4MFG A;  4M2B A;  1SST A;  1QQ0 A;  4R37 A;  3VNP A;  4E1K A;  4AC3 A;  3R0S A;  3TWD A;  4E75 A;  3MQH A;  1S80 A;  3D8V A;  1FWY A;  3EG4 A;  4EQY A;  3R5A A;  2W0W A;  4E79 A;  3OU9 A;  2WLD A;  4R7P A;  1HM9 A;  1OCX A;  3R5D A;  3IXC A;  5DEP A;  4ISX A;  4EA7 A;  3JQY A;  2I5K A;  4KQL A;  3FSC A;  3PMO A;  3IGJ A;  1V3W A;  4KPZ A;  1QRM A;  4HZD A;  4EAB A;  4M99 A;  3BSW A;  3R3I A;  3GOS A;  3P1B A;  3VBM A;  1MR9 A;  3GUE A;  1KK6 A;  3FS8 A;  2JF2 A;  3Q1X A;  3FSY A;  1QRF A;  3OTZ A;  3TV0 A;  4MYO A;  2W0V A;  2FKO A;  1YP4 A;  5E3Q A;  1KGQ A;  1MRL A;  1KK4 A;  2IU9 A;  2JF3 A;  2VD4 A;  3P47 A;  2IUA A;  4KPX A;  4KNX A;  1FXJ A;  4M9C A;  3V4E A;  5U2K A;  1G95 A;  3C8V A;  2OEF A;  3KWE A;  4G3Q A;  2ICY A;  3BFP A;  4IHF A;  4EA9 A;  4N69 A;  2V0J A;  1J2Z A;  1MR7 A;  3MC4 A;  4E6T A;  4R36 A;  4K6R A;  4HZC A;  3DHO A;  3SRT A;  3TDT A;  1QRG A;  1KRR A;  2WLG A;  3GVD A;  3BSS A;  3I3A A;  4E6U A;  3TK8 A;  3EH0 A;  3D98 A;  4M98 A;  2AQ9 A;  3FSX A;  3R3R A;  2P2O A;  3R2W A;  5DEM A;  4N6B A;  3VBL A;  2NPO A;  3BRK X;  4H7O A;  2IC7 A;  2QIV X;  3FSB A;  4HUR A;  2VHE A;  3DJ4 A;  4G3S A;  3MQG A;  1YP3 A;  3VBP A;  4N27 A;  2ICX A;  3TIO A;  3EEV A;  3NZ2 A;  1Z90 A;  4AAW A;  5AFU U;  4MZU A;  1T3D A;  2V0K A;  2V0I A;  2WLF A;  4EAA A;  5ADX U;  3SPT A;  3DK5 A;  2TDT A;  4KNR A;  4EGG A;  3ST8 A;  4HCQ A;  3FOQ A;  4G3P A;  1KHR A;  4M28 A;  2OI5 A;  1V67 A; 
#chains in the Genus database with same CATH topology
 4EA8 A;  3HJJ A;  3R5B A;  5F42 A;  3CJ8 A;  2OEG A;  1SSQ A;  1KRV A;  4J18 A;  5AFU V;  4J09 A;  2RIJ A;  3OH3 A;  3T57 A;  4AA7 A;  3FTT A;  2V0H A;  1Z2F A;  4DCL A;  3F1X A;  2GGO A;  5ADX V;  4HUS A;  3BXY A;  3OH0 A;  3R8Y A;  1LXA A;  5E3R A;  1SSM A;  3KWC A;  3I3X A;  1HM0 A;  3VBN A;  3OW5 A;  1G97 A;  5L6S A;  1XAT A;  3OUP A;  3HSQ A;  1THJ A;  4G87 A;  2GGQ A;  3VBK A;  2OI7 A;  2QIA A;  1YP2 A;  3FWW A;  2QKX A;  5L6V A;  2WLE A;  4IHH A;  1QRL A;  5DG3 A;  1KK5 A;  1HV9 A;  1TDT A;  1KGT A;  3R5C A;  1QRE A;  2WLC A;  4N6A A;  3VBJ A;  2XAT A;  3OTM A;  4FCE A;  2Q4J A;  1KQA A;  3GQ8 A;  2V0L A;  1XHD A;  3R1W A;  3OH1 A;  2IU8 A;  3KWD A;  2OI6 A;  4M2A A;  3BSY A;  5E3P A;  3TIS A;  1HM8 A;  3ECT A;  3VBI A;  4IHG A;  1KRU A;  4MFG A;  4M2B A;  1SST A;  1QQ0 A;  4R37 A;  3GQ9 A;  3VNP A;  4E1K A;  4AC3 A;  3R0S A;  3TWD A;  4E75 A;  3MQH A;  1S80 A;  3D8V A;  1FWY A;  3EG4 A;  4EQY A;  3R5A A;  2W0W A;  4E79 A;  3OU9 A;  2WLD A;  4R7P A;  1HM9 A;  3OH4 A;  1OCX A;  3R5D A;  3IXC A;  1EWW A;  5DEP A;  4ISX A;  4EA7 A;  3JQY A;  2I5K A;  4KQL A;  3FSC A;  3PMO A;  3IGJ A;  1V3W A;  4KPZ A;  1QRM A;  4HZD A;  4EAB A;  4M99 A;  3BSW A;  3R3I A;  3GOS A;  3P1B A;  1M8N A;  3VBM A;  1MR9 A;  3GUE A;  1KK6 A;  3FS8 A;  2JF2 A;  3Q1X A;  3FSY A;  1QRF A;  3OTZ A;  3TV0 A;  4MYO A;  2W0V A;  2FKO A;  1YP4 A;  5E3Q A;  1KGQ A;  1MRL A;  1KK4 A;  2IU9 A;  2JF3 A;  2VD4 A;  3P47 A;  2IUA A;  4KPX A;  4KNX A;  1FXJ A;  4M9C A;  3V4E A;  5U2K A;  1G95 A;  3C8V A;  2OEF A;  3KWE A;  4G3Q A;  2ICY A;  3BFP A;  4IHF A;  4EA9 A;  4N69 A;  2V0J A;  1J2Z A;  1MR7 A;  3MC4 A;  4E6T A;  4R36 A;  4K6R A;  4HZC A;  3DHO A;  3SRT A;  3TDT A;  1QRG A;  1KRR A;  2WLG A;  3GVD A;  1L0S A;  3BSS A;  3I3A A;  4E6U A;  3TK8 A;  3EH0 A;  3D98 A;  4M98 A;  2AQ9 A;  3FSX A;  3R3R A;  3OGZ A;  2P2O A;  3R2W A;  5DEM A;  4N6B A;  3VBL A;  2NPO A;  3BRK X;  4H7O A;  2IC7 A;  2QIV X;  3FSB A;  4HUR A;  2VHE A;  3DJ4 A;  4G3S A;  3MQG A;  1YP3 A;  3VBP A;  4N27 A;  2ICX A;  3TIO A;  3EEV A;  3NZ2 A;  1Z90 A;  4AAW A;  1N4I A;  3GQA A;  4MZU A;  3SUC A;  5AFU U;  3OH2 A;  1T3D A;  2V0K A;  2V0I A;  2WLF A;  4EAA A;  5ADX U;  3SPT A;  3DK5 A;  2TDT A;  4KNR A;  4EGG A;  3ST8 A;  4HCQ A;  3FOQ A;  3GQ7 A;  1KHR A;  4G3P A;  2OI5 A;  4M28 A;  1V67 A; 
#chains in the Genus database with same CATH homology
 4EA8 A;  3HJJ A;  3R5B A;  5F42 A;  3CJ8 A;  2OEG A;  1SSQ A;  1KRV A;  4J18 A;  5AFU V;  4J09 A;  2RIJ A;  3T57 A;  4AA7 A;  3FTT A;  2V0H A;  4DCL A;  3F1X A;  2GGO A;  5ADX V;  4HUS A;  3BXY A;  3R8Y A;  1LXA A;  5E3R A;  1SSM A;  3KWC A;  3I3X A;  1HM0 A;  3VBN A;  3OW5 A;  1G97 A;  5L6S A;  1XAT A;  3OUP A;  3HSQ A;  1THJ A;  4G87 A;  2GGQ A;  3VBK A;  2OI7 A;  2QIA A;  1YP2 A;  3FWW A;  2QKX A;  5L6V A;  2WLE A;  4IHH A;  1QRL A;  5DG3 A;  1KK5 A;  1TDT A;  1KGT A;  3R5C A;  1QRE A;  2WLC A;  4N6A A;  3VBJ A;  2XAT A;  3OTM A;  4FCE A;  2Q4J A;  1KQA A;  2V0L A;  1XHD A;  3R1W A;  1HV9 A;  2IU8 A;  3KWD A;  2OI6 A;  4M2A A;  3BSY A;  5E3P A;  3TIS A;  1HM8 A;  3ECT A;  3VBI A;  4IHG A;  1KRU A;  4MFG A;  4M2B A;  1SST A;  1QQ0 A;  4R37 A;  3VNP A;  4E1K A;  4AC3 A;  3R0S A;  3TWD A;  4E75 A;  3MQH A;  1S80 A;  3D8V A;  1FWY A;  3EG4 A;  4EQY A;  3R5A A;  2W0W A;  4E79 A;  3OU9 A;  2WLD A;  4R7P A;  1HM9 A;  1OCX A;  3R5D A;  3IXC A;  5DEP A;  4ISX A;  4EA7 A;  3JQY A;  2I5K A;  4KQL A;  3FSC A;  3PMO A;  3IGJ A;  1V3W A;  4KPZ A;  1QRM A;  4HZD A;  4EAB A;  4M99 A;  3BSW A;  3R3I A;  3GOS A;  3P1B A;  3VBM A;  1MR9 A;  3GUE A;  1KK6 A;  3FS8 A;  2JF2 A;  3Q1X A;  3FSY A;  1QRF A;  3OTZ A;  3TV0 A;  4MYO A;  2W0V A;  2FKO A;  1YP4 A;  5E3Q A;  1KGQ A;  1MRL A;  1KK4 A;  2IU9 A;  2JF3 A;  2VD4 A;  3P47 A;  2IUA A;  4KPX A;  4KNX A;  1FXJ A;  4M9C A;  3V4E A;  5U2K A;  1G95 A;  3C8V A;  2OEF A;  3KWE A;  4G3Q A;  2ICY A;  3BFP A;  4IHF A;  4EA9 A;  4N69 A;  2V0J A;  1J2Z A;  1MR7 A;  3MC4 A;  4E6T A;  4R36 A;  4K6R A;  4HZC A;  3DHO A;  3SRT A;  3TDT A;  1QRG A;  1KRR A;  2WLG A;  3GVD A;  3BSS A;  3I3A A;  4E6U A;  3TK8 A;  3EH0 A;  3D98 A;  4M98 A;  2AQ9 A;  3FSX A;  3R3R A;  2P2O A;  3R2W A;  5DEM A;  4N6B A;  3VBL A;  2NPO A;  3BRK X;  4H7O A;  2IC7 A;  2QIV X;  3FSB A;  4HUR A;  2VHE A;  3DJ4 A;  4G3S A;  3MQG A;  1YP3 A;  3VBP A;  4N27 A;  2ICX A;  3TIO A;  3EEV A;  3NZ2 A;  1Z90 A;  4AAW A;  5AFU U;  4MZU A;  1T3D A;  2V0K A;  2V0I A;  2WLF A;  4EAA A;  5ADX U;  3SPT A;  3DK5 A;  2TDT A;  4KNR A;  4EGG A;  3ST8 A;  4HCQ A;  3FOQ A;  4G3P A;  1KHR A;  4M28 A;  2OI5 A;  1V67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...