3TV0A

Structure of dynactin p27 subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
143
Chain Sequence
SVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNIKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynactin targets Polo-like kinase 1 to kinetochores
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Dynactin subunit 6
total genus 49
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tv0A00
4KPZA 3I3AA 3DK5A 3OW5A 3VBIA 4HUSA 4G3SA 1KRUA 3KWCA 2I5KA 2TDTA 1SSQA 3DHOA 2XATA 3GOSA 1KHRA 2RIJA 3R8YA 1KK6A 3D98A 1G97A 3JQYA 4M2AA 3TWDA 3EG4A 4KNRA 1G95A 1YP2A 2ICYA 4ISXA 4N69A 3FTTA 1MRLA 4MFGA 4J18A 3R5BA 3R5DA 4M99A 2ICXA 1KRVA 5L6SA 4AA7A 3GVDA 1KQAA 1MR9A 1Z90A 3NZ2A 4KQLA 1XATA 5DG3A 3EEVA 3VBJA 4E6TA 5L6VA 1V3WA 3OTMA 1FWYA 1HV9A 1KGQA 2OI7A 3T57A 3BSWA 1KRRA 3BRKX 4E75A 2WLFA 3TK8A 2W0VA 3VBKA 3ECTA 2JF2A 1HM8A 3FOQA 4EQYA 4FCEA 3BSYA 2WLCA 4KNXA 3HSQA 4N27A 3MQHA 1QREA 3F1XA 4M98A 2AQ9A 5E3PA 5U2KA 3DJ4A 2FKOA 1QRMA 1QRGA 1S80A 2VD4A 2WLEA 4HURA 1LXAA 3P47A 3VBLA 5ADXU 2OEFA 2V0JA 4IHFA 3R3IA 2WLGA 3BXYA 3KWEA 4J09A 3VNPA 5ADXV 4R36A 4M28A 3FSXA 2V0IA 4K6RA 3C8VA 4HCQA 4EA8A 1V67A 1FXJA 1KK5A 1TDTA 3FSBA 4EA9A 3VBNA 4HZDA 3CJ8A 1QRFA 2IU8A 3MC4A 4N6BA 3VBPA 4IHHA 4AAWA 4M2BA 3D8VA 3R1WA 3VBMA 2GGQA 1THJA 2QIAA 4IHGA 3FSCA 1J2ZA 1YP4A 2JF3A 3EH0A 3FWWA 4R37A 5DEMA 3V4EA 3MQGA 4EAAA 4R7PA 2V0LA 3FSYA 2VHEA 3SPTA 3TIOA 5E3QA 4E1KA 3R2WA 1HM9A 4MYOA 1KK4A 2V0HA 3HJJA 4EABA 3IGJA 5F42A 3OU9A 3OTZA 3TDTA 4G3QA 3SRTA 5AFUV 3TV0A 4N6AA 2W0WA 1SSTA 1QQ0A 4E6UA 1XHDA 3PMOA 2Q4JA 2P2OA 1OCXA 2GGOA 2NPOA 2QIVX 4M9CA 1YP3A 4MZUA 3ST8A 2OEGA 2OI6A 4EA7A 3R3RA 3IXCA 1HM0A 4H7OA 3P1BA 4HZCA 3Q1XA 1SSMA 3FS8A 4E79A 2OI5A 3KWDA 2WLDA 3R0SA 4G87A 2QKXA 4EGGA 2IC7A 3TISA 1QRLA 5DEPA 5E3RA 3I3XA 4AC3A 3R5AA 3BFPA 4KPXA 5AFUU 2IUAA 2IU9A 2V0KA 3OUPA 3BSSA 1T3DA 1MR7A 3R5CA 4DCLA 3GUEA 4G3PA 1KGTA
chains in the Genus database with same CATH superfamily
4KPZA 3I3AA 3DK5A 3OW5A 3VBIA 4HUSA 3GQ7A 4G3SA 1KRUA 3KWCA 2I5KA 2TDTA 1SSQA 3DHOA 2XATA 3GOSA 1KHRA 2RIJA 3R8YA 1KK6A 3D98A 1G97A 3JQYA 1EWWA 4M2AA 3TWDA 3EG4A 4KNRA 1G95A 1YP2A 2ICYA 4ISXA 4N69A 3FTTA 1MRLA 4MFGA 4J18A 3R5BA 3R5DA 4M99A 2ICXA 1KRVA 5L6SA 4AA7A 3GVDA 1KQAA 1MR9A 1Z90A 3NZ2A 4KQLA 1XATA 5DG3A 3EEVA 3VBJA 4E6TA 5L6VA 1V3WA 3OTMA 1FWYA 1HV9A 1KGQA 2OI7A 3T57A 3BSWA 1KRRA 3BRKX 4E75A 2WLFA 3TK8A 3OH2A 2W0VA 3VBKA 3ECTA 3OH1A 2JF2A 1HM8A 3FOQA 4EQYA 4FCEA 3OH4A 3BSYA 2WLCA 4KNXA 3HSQA 4N27A 3MQHA 1QREA 3F1XA 4M98A 2AQ9A 5E3PA 5U2KA 3DJ4A 2FKOA 1QRMA 1QRGA 1S80A 2VD4A 2WLEA 4HURA 1LXAA 3P47A 3VBLA 5ADXU 1N4IA 2OEFA 2V0JA 4IHFA 3R3IA 2WLGA 3BXYA 3KWEA 4J09A 3VNPA 5ADXV 4R36A 4M28A 3FSXA 2V0IA 4K6RA 1L0SA 3C8VA 4HCQA 4EA8A 1V67A 1FXJA 1KK5A 1TDTA 3FSBA 4EA9A 3VBNA 4HZDA 3CJ8A 1QRFA 2IU8A 3MC4A 4N6BA 3VBPA 4IHHA 4AAWA 4M2BA 3D8VA 3R1WA 3VBMA 2GGQA 1THJA 2QIAA 4IHGA 3FSCA 1J2ZA 1YP4A 2JF3A 3EH0A 3FWWA 4R37A 5DEMA 3V4EA 3MQGA 4EAAA 4R7PA 2V0LA 3FSYA 2VHEA 3SPTA 3TIOA 5E3QA 4E1KA 3R2WA 1HM9A 4MYOA 1KK4A 2V0HA 3HJJA 1Z2FA 3IGJA 5F42A 3OU9A 3OTZA 4EABA 3TDTA 4G3QA 3SRTA 5AFUV 3TV0A 4N6AA 2W0WA 3OGZA 3SUCA 1SSTA 1QQ0A 4E6UA 1XHDA 3PMOA 2Q4JA 2P2OA 1OCXA 2GGOA 2NPOA 2QIVX 3OH3A 4M9CA 1YP3A 4MZUA 3ST8A 2OEGA 2OI6A 4EA7A 3R3RA 3IXCA 1HM0A 4H7OA 3P1BA 4HZCA 3Q1XA 1SSMA 3FS8A 3GQAA 4E79A 2OI5A 3KWDA 2WLDA 3R0SA 4G87A 2QKXA 4EGGA 2IC7A 3GQ9A 3TISA 1QRLA 5DEPA 5E3RA 3GQ8A 3I3XA 4AC3A 3OH0A 3R5AA 3BFPA 4KPXA 5AFUU 2IUAA 2IU9A 2V0KA 3OUPA 3BSSA 1T3DA 1MR7A 1M8NA 3R5CA 3GUEA 4G3PA 4DCLA 1KGTA
chains in the Genus database with same CATH topology
4KPZA 3I3AA 3DK5A 3OW5A 3VBIA 4HUSA 4G3SA 1KRUA 3KWCA 2I5KA 2TDTA 1SSQA 3DHOA 2XATA 3GOSA 1KHRA 2RIJA 3R8YA 1KK6A 3D98A 1G97A 3JQYA 4M2AA 3TWDA 3EG4A 4KNRA 1G95A 1YP2A 2ICYA 4ISXA 4N69A 3FTTA 1MRLA 4MFGA 4J18A 3R5BA 3R5DA 4M99A 2ICXA 1KRVA 5L6SA 4AA7A 3GVDA 1KQAA 1MR9A 1Z90A 3NZ2A 4KQLA 1XATA 5DG3A 3EEVA 3VBJA 4E6TA 5L6VA 1V3WA 3OTMA 1FWYA 1HV9A 1KGQA 2OI7A 3T57A 3BSWA 1KRRA 3BRKX 4E75A 2WLFA 3TK8A 2W0VA 3VBKA 3ECTA 2JF2A 1HM8A 3FOQA 4EQYA 4FCEA 3BSYA 2WLCA 4KNXA 3HSQA 4N27A 3MQHA 1QREA 3F1XA 4M98A 2AQ9A 5E3PA 5U2KA 3DJ4A 2FKOA 1QRMA 1QRGA 1S80A 2VD4A 2WLEA 4HURA 1LXAA 3P47A 3VBLA 5ADXU 2OEFA 2V0JA 4IHFA 3R3IA 2WLGA 3BXYA 3KWEA 4J09A 3VNPA 5ADXV 4R36A 4M28A 3FSXA 2V0IA 4K6RA 3C8VA 4HCQA 4EA8A 1V67A 1FXJA 1KK5A 1TDTA 3FSBA 4EA9A 3VBNA 4HZDA 3CJ8A 1QRFA 2IU8A 3MC4A 4N6BA 3VBPA 4IHHA 4AAWA 4M2BA 3D8VA 3R1WA 3VBMA 2GGQA 1THJA 2QIAA 4IHGA 3FSCA 1J2ZA 1YP4A 2JF3A 3EH0A 3FWWA 4R37A 5DEMA 3V4EA 3MQGA 4EAAA 4R7PA 2V0LA 3FSYA 2VHEA 3SPTA 3TIOA 5E3QA 4E1KA 3R2WA 1HM9A 4MYOA 1KK4A 2V0HA 3HJJA 4EABA 3IGJA 5F42A 3OU9A 3OTZA 3TDTA 4G3QA 3SRTA 5AFUV 3TV0A 4N6AA 2W0WA 1SSTA 1QQ0A 4E6UA 1XHDA 3PMOA 2Q4JA 2P2OA 1OCXA 2GGOA 2NPOA 2QIVX 4M9CA 1YP3A 4MZUA 3ST8A 2OEGA 2OI6A 4EA7A 3R3RA 3IXCA 1HM0A 4H7OA 3P1BA 4HZCA 3Q1XA 1SSMA 3FS8A 4E79A 2OI5A 3KWDA 2WLDA 3R0SA 4G87A 2QKXA 4EGGA 2IC7A 3TISA 1QRLA 5DEPA 5E3RA 3I3XA 4AC3A 3R5AA 3BFPA 4KPXA 5AFUU 2IUAA 2IU9A 2V0KA 3OUPA 3BSSA 1T3DA 1MR7A 3R5CA 4DCLA 3GUEA 4G3PA 1KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPZ A;  3I3A A;  3DK5 A;  3OW5 A;  3VBI A;  4HUS A;  4G3S A;  1KRU A;  3KWC A;  2I5K A;  2TDT A;  1SSQ A;  3DHO A;  2XAT A;  3GOS A;  1KHR A;  2RIJ A;  3R8Y A;  1KK6 A;  3D98 A;  1G97 A;  3JQY A;  4M2A A;  3TWD A;  3EG4 A;  4KNR A;  1G95 A;  1YP2 A;  2ICY A;  4ISX A;  4N69 A;  3FTT A;  1MRL A;  4MFG A;  4J18 A;  3R5B A;  3R5D A;  4M99 A;  2ICX A;  1KRV A;  5L6S A;  4AA7 A;  3GVD A;  1KQA A;  1MR9 A;  1Z90 A;  3NZ2 A;  4KQL A;  1XAT A;  5DG3 A;  3EEV A;  3VBJ A;  4E6T A;  5L6V A;  1V3W A;  3OTM A;  1FWY A;  1HV9 A;  1KGQ A;  2OI7 A;  3T57 A;  3BSW A;  1KRR A;  3BRK X;  4E75 A;  2WLF A;  3TK8 A;  2W0V A;  3VBK A;  3ECT A;  2JF2 A;  1HM8 A;  3FOQ A;  4EQY A;  4FCE A;  3BSY A;  2WLC A;  4KNX A;  3HSQ A;  4N27 A;  3MQH A;  1QRE A;  3F1X A;  4M98 A;  2AQ9 A;  5E3P A;  5U2K A;  3DJ4 A;  2FKO A;  1QRM A;  1QRG A;  1S80 A;  2VD4 A;  2WLE A;  4HUR A;  1LXA A;  3P47 A;  3VBL A;  5ADX U;  2OEF A;  2V0J A;  4IHF A;  3R3I A;  2WLG A;  3BXY A;  3KWE A;  4J09 A;  3VNP A;  5ADX V;  4R36 A;  4M28 A;  3FSX A;  2V0I A;  4K6R A;  3C8V A;  4HCQ A;  4EA8 A;  1V67 A;  1FXJ A;  1KK5 A;  1TDT A;  3FSB A;  4EA9 A;  3VBN A;  4HZD A;  3CJ8 A;  1QRF A;  2IU8 A;  3MC4 A;  4N6B A;  3VBP A;  4IHH A;  4AAW A;  4M2B A;  3D8V A;  3R1W A;  3VBM A;  2GGQ A;  1THJ A;  2QIA A;  4IHG A;  3FSC A;  1J2Z A;  1YP4 A;  2JF3 A;  3EH0 A;  3FWW A;  4R37 A;  5DEM A;  3V4E A;  3MQG A;  4EAA A;  4R7P A;  2V0L A;  3FSY A;  2VHE A;  3SPT A;  3TIO A;  5E3Q A;  4E1K A;  3R2W A;  1HM9 A;  4MYO A;  1KK4 A;  2V0H A;  3HJJ A;  4EAB A;  3IGJ A;  5F42 A;  3OU9 A;  3OTZ A;  3TDT A;  4G3Q A;  3SRT A;  5AFU V;  3TV0 A;  4N6A A;  2W0W A;  1SST A;  1QQ0 A;  4E6U A;  1XHD A;  3PMO A;  2Q4J A;  2P2O A;  1OCX A;  2GGO A;  2NPO A;  2QIV X;  4M9C A;  1YP3 A;  4MZU A;  3ST8 A;  2OEG A;  2OI6 A;  4EA7 A;  3R3R A;  3IXC A;  1HM0 A;  4H7O A;  3P1B A;  4HZC A;  3Q1X A;  1SSM A;  3FS8 A;  4E79 A;  2OI5 A;  3KWD A;  2WLD A;  3R0S A;  4G87 A;  2QKX A;  4EGG A;  2IC7 A;  3TIS A;  1QRL A;  5DEP A;  5E3R A;  3I3X A;  4AC3 A;  3R5A A;  3BFP A;  4KPX A;  5AFU U;  2IUA A;  2IU9 A;  2V0K A;  3OUP A;  3BSS A;  1T3D A;  1MR7 A;  3R5C A;  4DCL A;  3GUE A;  4G3P A;  1KGT A; 
#chains in the Genus database with same CATH topology
 4KPZ A;  3I3A A;  3DK5 A;  3OW5 A;  3VBI A;  4HUS A;  3GQ7 A;  4G3S A;  1KRU A;  3KWC A;  2I5K A;  2TDT A;  1SSQ A;  3DHO A;  2XAT A;  3GOS A;  1KHR A;  2RIJ A;  3R8Y A;  1KK6 A;  3D98 A;  1G97 A;  3JQY A;  1EWW A;  4M2A A;  3TWD A;  3EG4 A;  4KNR A;  1G95 A;  1YP2 A;  2ICY A;  4ISX A;  4N69 A;  3FTT A;  1MRL A;  4MFG A;  4J18 A;  3R5B A;  3R5D A;  4M99 A;  2ICX A;  1KRV A;  5L6S A;  4AA7 A;  3GVD A;  1KQA A;  1MR9 A;  1Z90 A;  3NZ2 A;  4KQL A;  1XAT A;  5DG3 A;  3EEV A;  3VBJ A;  4E6T A;  5L6V A;  1V3W A;  3OTM A;  1FWY A;  1HV9 A;  1KGQ A;  2OI7 A;  3T57 A;  3BSW A;  1KRR A;  3BRK X;  4E75 A;  2WLF A;  3TK8 A;  3OH2 A;  2W0V A;  3VBK A;  3ECT A;  3OH1 A;  2JF2 A;  1HM8 A;  3FOQ A;  4EQY A;  4FCE A;  3OH4 A;  3BSY A;  2WLC A;  4KNX A;  3HSQ A;  4N27 A;  3MQH A;  1QRE A;  3F1X A;  4M98 A;  2AQ9 A;  5E3P A;  5U2K A;  3DJ4 A;  2FKO A;  1QRM A;  1QRG A;  1S80 A;  2VD4 A;  2WLE A;  4HUR A;  1LXA A;  3P47 A;  3VBL A;  5ADX U;  1N4I A;  2OEF A;  2V0J A;  4IHF A;  3R3I A;  2WLG A;  3BXY A;  3KWE A;  4J09 A;  3VNP A;  5ADX V;  4R36 A;  4M28 A;  3FSX A;  2V0I A;  4K6R A;  1L0S A;  3C8V A;  4HCQ A;  4EA8 A;  1V67 A;  1FXJ A;  1KK5 A;  1TDT A;  3FSB A;  4EA9 A;  3VBN A;  4HZD A;  3CJ8 A;  1QRF A;  2IU8 A;  3MC4 A;  4N6B A;  3VBP A;  4IHH A;  4AAW A;  4M2B A;  3D8V A;  3R1W A;  3VBM A;  2GGQ A;  1THJ A;  2QIA A;  4IHG A;  3FSC A;  1J2Z A;  1YP4 A;  2JF3 A;  3EH0 A;  3FWW A;  4R37 A;  5DEM A;  3V4E A;  3MQG A;  4EAA A;  4R7P A;  2V0L A;  3FSY A;  2VHE A;  3SPT A;  3TIO A;  5E3Q A;  4E1K A;  3R2W A;  1HM9 A;  4MYO A;  1KK4 A;  2V0H A;  3HJJ A;  1Z2F A;  3IGJ A;  5F42 A;  3OU9 A;  3OTZ A;  4EAB A;  3TDT A;  4G3Q A;  3SRT A;  5AFU V;  3TV0 A;  4N6A A;  2W0W A;  3OGZ A;  3SUC A;  1SST A;  1QQ0 A;  4E6U A;  1XHD A;  3PMO A;  2Q4J A;  2P2O A;  1OCX A;  2GGO A;  2NPO A;  2QIV X;  3OH3 A;  4M9C A;  1YP3 A;  4MZU A;  3ST8 A;  2OEG A;  2OI6 A;  4EA7 A;  3R3R A;  3IXC A;  1HM0 A;  4H7O A;  3P1B A;  4HZC A;  3Q1X A;  1SSM A;  3FS8 A;  3GQA A;  4E79 A;  2OI5 A;  3KWD A;  2WLD A;  3R0S A;  4G87 A;  2QKX A;  4EGG A;  2IC7 A;  3GQ9 A;  3TIS A;  1QRL A;  5DEP A;  5E3R A;  3GQ8 A;  3I3X A;  4AC3 A;  3OH0 A;  3R5A A;  3BFP A;  4KPX A;  5AFU U;  2IUA A;  2IU9 A;  2V0K A;  3OUP A;  3BSS A;  1T3D A;  1MR7 A;  1M8N A;  3R5C A;  3GUE A;  4G3P A;  4DCL A;  1KGT A; 
#chains in the Genus database with same CATH homology
 4KPZ A;  3I3A A;  3DK5 A;  3OW5 A;  3VBI A;  4HUS A;  4G3S A;  1KRU A;  3KWC A;  2I5K A;  2TDT A;  1SSQ A;  3DHO A;  2XAT A;  3GOS A;  1KHR A;  2RIJ A;  3R8Y A;  1KK6 A;  3D98 A;  1G97 A;  3JQY A;  4M2A A;  3TWD A;  3EG4 A;  4KNR A;  1G95 A;  1YP2 A;  2ICY A;  4ISX A;  4N69 A;  3FTT A;  1MRL A;  4MFG A;  4J18 A;  3R5B A;  3R5D A;  4M99 A;  2ICX A;  1KRV A;  5L6S A;  4AA7 A;  3GVD A;  1KQA A;  1MR9 A;  1Z90 A;  3NZ2 A;  4KQL A;  1XAT A;  5DG3 A;  3EEV A;  3VBJ A;  4E6T A;  5L6V A;  1V3W A;  3OTM A;  1FWY A;  1HV9 A;  1KGQ A;  2OI7 A;  3T57 A;  3BSW A;  1KRR A;  3BRK X;  4E75 A;  2WLF A;  3TK8 A;  2W0V A;  3VBK A;  3ECT A;  2JF2 A;  1HM8 A;  3FOQ A;  4EQY A;  4FCE A;  3BSY A;  2WLC A;  4KNX A;  3HSQ A;  4N27 A;  3MQH A;  1QRE A;  3F1X A;  4M98 A;  2AQ9 A;  5E3P A;  5U2K A;  3DJ4 A;  2FKO A;  1QRM A;  1QRG A;  1S80 A;  2VD4 A;  2WLE A;  4HUR A;  1LXA A;  3P47 A;  3VBL A;  5ADX U;  2OEF A;  2V0J A;  4IHF A;  3R3I A;  2WLG A;  3BXY A;  3KWE A;  4J09 A;  3VNP A;  5ADX V;  4R36 A;  4M28 A;  3FSX A;  2V0I A;  4K6R A;  3C8V A;  4HCQ A;  4EA8 A;  1V67 A;  1FXJ A;  1KK5 A;  1TDT A;  3FSB A;  4EA9 A;  3VBN A;  4HZD A;  3CJ8 A;  1QRF A;  2IU8 A;  3MC4 A;  4N6B A;  3VBP A;  4IHH A;  4AAW A;  4M2B A;  3D8V A;  3R1W A;  3VBM A;  2GGQ A;  1THJ A;  2QIA A;  4IHG A;  3FSC A;  1J2Z A;  1YP4 A;  2JF3 A;  3EH0 A;  3FWW A;  4R37 A;  5DEM A;  3V4E A;  3MQG A;  4EAA A;  4R7P A;  2V0L A;  3FSY A;  2VHE A;  3SPT A;  3TIO A;  5E3Q A;  4E1K A;  3R2W A;  1HM9 A;  4MYO A;  1KK4 A;  2V0H A;  3HJJ A;  4EAB A;  3IGJ A;  5F42 A;  3OU9 A;  3OTZ A;  3TDT A;  4G3Q A;  3SRT A;  5AFU V;  3TV0 A;  4N6A A;  2W0W A;  1SST A;  1QQ0 A;  4E6U A;  1XHD A;  3PMO A;  2Q4J A;  2P2O A;  1OCX A;  2GGO A;  2NPO A;  2QIV X;  4M9C A;  1YP3 A;  4MZU A;  3ST8 A;  2OEG A;  2OI6 A;  4EA7 A;  3R3R A;  3IXC A;  1HM0 A;  4H7O A;  3P1B A;  4HZC A;  3Q1X A;  1SSM A;  3FS8 A;  4E79 A;  2OI5 A;  3KWD A;  2WLD A;  3R0S A;  4G87 A;  2QKX A;  4EGG A;  2IC7 A;  3TIS A;  1QRL A;  5DEP A;  5E3R A;  3I3X A;  4AC3 A;  3R5A A;  3BFP A;  4KPX A;  5AFU U;  2IUA A;  2IU9 A;  2V0K A;  3OUP A;  3BSS A;  1T3D A;  1MR7 A;  3R5C A;  4DCL A;  3GUE A;  4G3P A;  1KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...