3TV0A

Structure of dynactin p27 subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
143
Chain Sequence
SVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNIKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 6
publication title Dynactin targets Polo-like kinase 1 to kinetochores
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 49
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tv0A00
1YP2A 4N6BA 1MRLA 4AAWA 5DEMA 1QQ0A 2WLDA 2OI6A 3R5DA 1V3WA 3BFPA 3I3XA 2QIVX 3FSYA 2ICXA 1HM9A 2WLFA 1KK6A 4R37A 3R5AA 3VBMA 1MR7A 3R1WA 3IGJA 4AA7A 3SRTA 4EQYA 3DHOA 3VBNA 1LXAA 4AC3A 1T3DA 4HCQA 2JF2A 3I3AA 4KNRA 3GUEA 3FTTA 2AQ9A 4KPXA 4M99A 4M28A 1SSMA 3V4EA 1OCXA 4M9CA 2QIAA 2RIJA 2W0WA 3BXYA 2GGOA 3R2WA 3OU9A 1MR9A 3FSCA 1SSQA 5E3RA 1KHRA 3OUPA 3EG4A 2V0KA 3EH0A 1YP3A 3NZ2A 3DK5A 2GGQA 4HUSA 1HM0A 3IXCA 2WLCA 1Z90A 3DJ4A 2IC7A 1TDTA 3FOQA 2V0IA 2IU8A 1G95A 1HV9A 1KK4A 3JQYA 4M2BA 3BSWA 4J09A 4MYOA 1SSTA 3FSBA 1KGQA 4HZDA 1V67A 2P2OA 3FS8A 3ST8A 3VBIA 4DCLA 2VD4A 4FCEA 1QRMA 3GVDA 1KGTA 4N27A 4R7PA 4IHGA 2OI5A 3Q1XA 5E3PA 1YP4A 4G3SA 2JF3A 3D98A 3HJJA 4MFGA 5ADXV 1THJA 4E1KA 1G97A 1QRLA 4M2AA 5F42A 4EGGA 2FKOA 4H7OA 3VBKA 3R0SA 2WLGA 5DEPA 5E3QA 2ICYA 3BRKX 3BSSA 2VHEA 1KQAA 2V0LA 3R3IA 3R3RA 4G3PA 2WLEA 5AFUV 4EA7A 1KRUA 4E79A 3TWDA 3R5CA 2W0VA 3P1BA 4KNXA 3VBJA 2OI7A 3KWDA 4IHFA 4EABA 4IHHA 2Q4JA 3MQGA 3P47A 3TIOA 3ECTA 4R36A 3CJ8A 4M98A 4MZUA 1FWYA 1QRFA 3R5BA 5DG3A 4ISXA 2V0HA 4J18A 2QKXA 4K6RA 3MQHA 1KRVA 1XHDA 2XATA 4G87A 3D8VA 3FSXA 5U2KA 2OEGA 5ADXU 1QRGA 3F1XA 3TK8A 3SPTA 1KK5A 3FWWA 3MC4A 4EA9A 1QREA 2I5KA 2NPOA 3R8YA 5L6VA 3TISA 3OW5A 3PMOA 4HURA 3VNPA 4N6AA 3VBLA 4EAAA 1S80A 1XATA 4HZCA 2IUAA 4KQLA 3VBPA 1FXJA 3HSQA 1J2ZA 4E75A 5AFUU 3TV0A 2TDTA 2V0JA 4E6UA 4E6TA 1KRRA 1HM8A 3KWCA 3KWEA 4N69A 3TDTA 3EEVA 4G3QA 4EA8A 3OTZA 2OEFA 3GOSA 2IU9A 4KPZA 3C8VA 3T57A 5L6SA 3OTMA 3BSYA
chains in the Genus database with same CATH superfamily
1YP2A 4N6BA 1MRLA 3OH3A 4AAWA 5DEMA 1QQ0A 2WLDA 2OI6A 3R5DA 1V3WA 3BFPA 3I3XA 2QIVX 3FSYA 2ICXA 1HM9A 2WLFA 1KK6A 4R37A 3R5AA 3VBMA 1MR7A 3R1WA 3IGJA 4AA7A 3SRTA 4EQYA 3DHOA 3VBNA 1LXAA 4AC3A 1T3DA 3OH1A 4HCQA 3GQAA 2JF2A 3I3AA 4KNRA 3GUEA 3FTTA 2AQ9A 4KPXA 4M99A 4M28A 1SSMA 3V4EA 1OCXA 1L0SA 4M9CA 2QIAA 2RIJA 2W0WA 3BXYA 2GGOA 3R2WA 3OU9A 1MR9A 3FSCA 1SSQA 5E3RA 1KHRA 3GQ9A 3OUPA 3EG4A 2V0KA 3EH0A 1YP3A 3NZ2A 3DK5A 2GGQA 4HUSA 1HM0A 3IXCA 2WLCA 1Z90A 3DJ4A 2IC7A 1TDTA 3FOQA 2V0IA 2IU8A 1G95A 1HV9A 1KK4A 3SUCA 3JQYA 4M2BA 3BSWA 3OH4A 4J09A 4MYOA 1SSTA 3FSBA 1KGQA 4HZDA 1M8NA 1V67A 2P2OA 3FS8A 3ST8A 3VBIA 4DCLA 2VD4A 4FCEA 1QRMA 1Z2FA 3GVDA 1KGTA 4N27A 4R7PA 4IHGA 2OI5A 3Q1XA 5E3PA 1YP4A 4G3SA 2JF3A 3D98A 3HJJA 4MFGA 5ADXV 1THJA 4E1KA 1G97A 1QRLA 4M2AA 5F42A 4EGGA 2FKOA 4H7OA 3VBKA 3R0SA 2WLGA 5DEPA 5E3QA 2ICYA 3BRKX 3BSSA 2VHEA 1KQAA 2V0LA 3R3IA 3R3RA 4G3PA 2WLEA 5AFUV 4EA7A 1KRUA 4E79A 3TWDA 3R5CA 2W0VA 3P1BA 4KNXA 3VBJA 2OI7A 3KWDA 4IHFA 4EABA 4IHHA 2Q4JA 3MQGA 3P47A 3TIOA 3ECTA 4R36A 3CJ8A 4M98A 4MZUA 1FWYA 1QRFA 3R5BA 1EWWA 5DG3A 4ISXA 2V0HA 4J18A 2QKXA 4K6RA 3MQHA 1KRVA 1XHDA 2XATA 4G87A 3D8VA 3FSXA 5U2KA 3GQ7A 2OEGA 1N4IA 1QRGA 5ADXU 3F1XA 3TK8A 3SPTA 1KK5A 3FWWA 3MC4A 4EA9A 1QREA 2I5KA 2NPOA 3R8YA 5L6VA 3TISA 3OW5A 3PMOA 4HURA 3VNPA 4N6AA 3VBLA 4EAAA 1S80A 1XATA 4HZCA 2IUAA 4KQLA 3VBPA 1FXJA 3HSQA 1J2ZA 4E75A 5AFUU 3TV0A 2TDTA 2V0JA 4E6UA 4E6TA 1KRRA 1HM8A 3KWCA 3KWEA 3OGZA 3OH0A 4N69A 3TDTA 3EEVA 3GQ8A 4G3QA 4EA8A 3OTZA 2OEFA 3GOSA 2IU9A 3OH2A 4KPZA 3C8VA 3T57A 5L6SA 3OTMA 3BSYA
chains in the Genus database with same CATH topology
1YP2A 4N6BA 1MRLA 4AAWA 5DEMA 1QQ0A 2WLDA 2OI6A 3R5DA 1V3WA 3BFPA 3I3XA 2QIVX 3FSYA 2ICXA 1HM9A 2WLFA 1KK6A 4R37A 3R5AA 3VBMA 1MR7A 3R1WA 3IGJA 4AA7A 3SRTA 4EQYA 3DHOA 3VBNA 1LXAA 4AC3A 1T3DA 4HCQA 2JF2A 3I3AA 4KNRA 3GUEA 3FTTA 2AQ9A 4KPXA 4M99A 4M28A 1SSMA 3V4EA 1OCXA 4M9CA 2QIAA 2RIJA 2W0WA 3BXYA 2GGOA 3R2WA 3OU9A 1MR9A 3FSCA 1SSQA 5E3RA 1KHRA 3OUPA 3EG4A 2V0KA 3EH0A 1YP3A 3NZ2A 3DK5A 2GGQA 4HUSA 1HM0A 3IXCA 2WLCA 1Z90A 3DJ4A 2IC7A 1TDTA 3FOQA 2V0IA 2IU8A 1G95A 1HV9A 1KK4A 3JQYA 4M2BA 3BSWA 4J09A 4MYOA 1SSTA 3FSBA 1KGQA 4HZDA 1V67A 2P2OA 3FS8A 3ST8A 3VBIA 4DCLA 2VD4A 4FCEA 1QRMA 3GVDA 1KGTA 4N27A 4R7PA 4IHGA 2OI5A 3Q1XA 5E3PA 1YP4A 4G3SA 2JF3A 3D98A 3HJJA 4MFGA 5ADXV 1THJA 4E1KA 1G97A 1QRLA 4M2AA 5F42A 4EGGA 2FKOA 4H7OA 3VBKA 3R0SA 2WLGA 5DEPA 5E3QA 2ICYA 3BRKX 3BSSA 2VHEA 1KQAA 2V0LA 3R3IA 3R3RA 4G3PA 2WLEA 5AFUV 4EA7A 1KRUA 4E79A 3TWDA 3R5CA 2W0VA 3P1BA 4KNXA 3VBJA 2OI7A 3KWDA 4IHFA 4EABA 4IHHA 2Q4JA 3MQGA 3P47A 3TIOA 3ECTA 4R36A 3CJ8A 4M98A 4MZUA 1FWYA 1QRFA 3R5BA 5DG3A 4ISXA 2V0HA 4J18A 2QKXA 4K6RA 3MQHA 1KRVA 1XHDA 2XATA 4G87A 3D8VA 3FSXA 5U2KA 2OEGA 5ADXU 1QRGA 3F1XA 3TK8A 3SPTA 1KK5A 3FWWA 3MC4A 4EA9A 1QREA 2I5KA 2NPOA 3R8YA 5L6VA 3TISA 3OW5A 3PMOA 4HURA 3VNPA 4N6AA 3VBLA 4EAAA 1S80A 1XATA 4HZCA 2IUAA 4KQLA 3VBPA 1FXJA 3HSQA 1J2ZA 4E75A 5AFUU 3TV0A 2TDTA 2V0JA 4E6UA 4E6TA 1KRRA 1HM8A 3KWCA 3KWEA 4N69A 3TDTA 3EEVA 4G3QA 4EA8A 3OTZA 2OEFA 3GOSA 2IU9A 4KPZA 3C8VA 3T57A 5L6SA 3OTMA 3BSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP2 A;  4N6B A;  1MRL A;  4AAW A;  5DEM A;  1QQ0 A;  2WLD A;  2OI6 A;  3R5D A;  1V3W A;  3BFP A;  3I3X A;  2QIV X;  3FSY A;  2ICX A;  1HM9 A;  2WLF A;  1KK6 A;  4R37 A;  3R5A A;  3VBM A;  1MR7 A;  3R1W A;  3IGJ A;  4AA7 A;  3SRT A;  4EQY A;  3DHO A;  3VBN A;  1LXA A;  4AC3 A;  1T3D A;  4HCQ A;  2JF2 A;  3I3A A;  4KNR A;  3GUE A;  3FTT A;  2AQ9 A;  4KPX A;  4M99 A;  4M28 A;  1SSM A;  3V4E A;  1OCX A;  4M9C A;  2QIA A;  2RIJ A;  2W0W A;  3BXY A;  2GGO A;  3R2W A;  3OU9 A;  1MR9 A;  3FSC A;  1SSQ A;  5E3R A;  1KHR A;  3OUP A;  3EG4 A;  2V0K A;  3EH0 A;  1YP3 A;  3NZ2 A;  3DK5 A;  2GGQ A;  4HUS A;  1HM0 A;  3IXC A;  2WLC A;  1Z90 A;  3DJ4 A;  2IC7 A;  1TDT A;  3FOQ A;  2V0I A;  2IU8 A;  1G95 A;  1HV9 A;  1KK4 A;  3JQY A;  4M2B A;  3BSW A;  4J09 A;  4MYO A;  1SST A;  3FSB A;  1KGQ A;  4HZD A;  1V67 A;  2P2O A;  3FS8 A;  3ST8 A;  3VBI A;  4DCL A;  2VD4 A;  4FCE A;  1QRM A;  3GVD A;  1KGT A;  4N27 A;  4R7P A;  4IHG A;  2OI5 A;  3Q1X A;  5E3P A;  1YP4 A;  4G3S A;  2JF3 A;  3D98 A;  3HJJ A;  4MFG A;  5ADX V;  1THJ A;  4E1K A;  1G97 A;  1QRL A;  4M2A A;  5F42 A;  4EGG A;  2FKO A;  4H7O A;  3VBK A;  3R0S A;  2WLG A;  5DEP A;  5E3Q A;  2ICY A;  3BRK X;  3BSS A;  2VHE A;  1KQA A;  2V0L A;  3R3I A;  3R3R A;  4G3P A;  2WLE A;  5AFU V;  4EA7 A;  1KRU A;  4E79 A;  3TWD A;  3R5C A;  2W0V A;  3P1B A;  4KNX A;  3VBJ A;  2OI7 A;  3KWD A;  4IHF A;  4EAB A;  4IHH A;  2Q4J A;  3MQG A;  3P47 A;  3TIO A;  3ECT A;  4R36 A;  3CJ8 A;  4M98 A;  4MZU A;  1FWY A;  1QRF A;  3R5B A;  5DG3 A;  4ISX A;  2V0H A;  4J18 A;  2QKX A;  4K6R A;  3MQH A;  1KRV A;  1XHD A;  2XAT A;  4G87 A;  3D8V A;  3FSX A;  5U2K A;  2OEG A;  5ADX U;  1QRG A;  3F1X A;  3TK8 A;  3SPT A;  1KK5 A;  3FWW A;  3MC4 A;  4EA9 A;  1QRE A;  2I5K A;  2NPO A;  3R8Y A;  5L6V A;  3TIS A;  3OW5 A;  3PMO A;  4HUR A;  3VNP A;  4N6A A;  3VBL A;  4EAA A;  1S80 A;  1XAT A;  4HZC A;  2IUA A;  4KQL A;  3VBP A;  1FXJ A;  3HSQ A;  1J2Z A;  4E75 A;  5AFU U;  3TV0 A;  2TDT A;  2V0J A;  4E6U A;  4E6T A;  1KRR A;  1HM8 A;  3KWC A;  3KWE A;  4N69 A;  3TDT A;  3EEV A;  4G3Q A;  4EA8 A;  3OTZ A;  2OEF A;  3GOS A;  2IU9 A;  4KPZ A;  3C8V A;  3T57 A;  5L6S A;  3OTM A;  3BSY A; 
#chains in the Genus database with same CATH topology
 1YP2 A;  4N6B A;  1MRL A;  3OH3 A;  4AAW A;  5DEM A;  1QQ0 A;  2WLD A;  2OI6 A;  3R5D A;  1V3W A;  3BFP A;  3I3X A;  2QIV X;  3FSY A;  2ICX A;  1HM9 A;  2WLF A;  1KK6 A;  4R37 A;  3R5A A;  3VBM A;  1MR7 A;  3R1W A;  3IGJ A;  4AA7 A;  3SRT A;  4EQY A;  3DHO A;  3VBN A;  1LXA A;  4AC3 A;  1T3D A;  3OH1 A;  4HCQ A;  3GQA A;  2JF2 A;  3I3A A;  4KNR A;  3GUE A;  3FTT A;  2AQ9 A;  4KPX A;  4M99 A;  4M28 A;  1SSM A;  3V4E A;  1OCX A;  1L0S A;  4M9C A;  2QIA A;  2RIJ A;  2W0W A;  3BXY A;  2GGO A;  3R2W A;  3OU9 A;  1MR9 A;  3FSC A;  1SSQ A;  5E3R A;  1KHR A;  3GQ9 A;  3OUP A;  3EG4 A;  2V0K A;  3EH0 A;  1YP3 A;  3NZ2 A;  3DK5 A;  2GGQ A;  4HUS A;  1HM0 A;  3IXC A;  2WLC A;  1Z90 A;  3DJ4 A;  2IC7 A;  1TDT A;  3FOQ A;  2V0I A;  2IU8 A;  1G95 A;  1HV9 A;  1KK4 A;  3SUC A;  3JQY A;  4M2B A;  3BSW A;  3OH4 A;  4J09 A;  4MYO A;  1SST A;  3FSB A;  1KGQ A;  4HZD A;  1M8N A;  1V67 A;  2P2O A;  3FS8 A;  3ST8 A;  3VBI A;  4DCL A;  2VD4 A;  4FCE A;  1QRM A;  1Z2F A;  3GVD A;  1KGT A;  4N27 A;  4R7P A;  4IHG A;  2OI5 A;  3Q1X A;  5E3P A;  1YP4 A;  4G3S A;  2JF3 A;  3D98 A;  3HJJ A;  4MFG A;  5ADX V;  1THJ A;  4E1K A;  1G97 A;  1QRL A;  4M2A A;  5F42 A;  4EGG A;  2FKO A;  4H7O A;  3VBK A;  3R0S A;  2WLG A;  5DEP A;  5E3Q A;  2ICY A;  3BRK X;  3BSS A;  2VHE A;  1KQA A;  2V0L A;  3R3I A;  3R3R A;  4G3P A;  2WLE A;  5AFU V;  4EA7 A;  1KRU A;  4E79 A;  3TWD A;  3R5C A;  2W0V A;  3P1B A;  4KNX A;  3VBJ A;  2OI7 A;  3KWD A;  4IHF A;  4EAB A;  4IHH A;  2Q4J A;  3MQG A;  3P47 A;  3TIO A;  3ECT A;  4R36 A;  3CJ8 A;  4M98 A;  4MZU A;  1FWY A;  1QRF A;  3R5B A;  1EWW A;  5DG3 A;  4ISX A;  2V0H A;  4J18 A;  2QKX A;  4K6R A;  3MQH A;  1KRV A;  1XHD A;  2XAT A;  4G87 A;  3D8V A;  3FSX A;  5U2K A;  3GQ7 A;  2OEG A;  1N4I A;  1QRG A;  5ADX U;  3F1X A;  3TK8 A;  3SPT A;  1KK5 A;  3FWW A;  3MC4 A;  4EA9 A;  1QRE A;  2I5K A;  2NPO A;  3R8Y A;  5L6V A;  3TIS A;  3OW5 A;  3PMO A;  4HUR A;  3VNP A;  4N6A A;  3VBL A;  4EAA A;  1S80 A;  1XAT A;  4HZC A;  2IUA A;  4KQL A;  3VBP A;  1FXJ A;  3HSQ A;  1J2Z A;  4E75 A;  5AFU U;  3TV0 A;  2TDT A;  2V0J A;  4E6U A;  4E6T A;  1KRR A;  1HM8 A;  3KWC A;  3KWE A;  3OGZ A;  3OH0 A;  4N69 A;  3TDT A;  3EEV A;  3GQ8 A;  4G3Q A;  4EA8 A;  3OTZ A;  2OEF A;  3GOS A;  2IU9 A;  3OH2 A;  4KPZ A;  3C8V A;  3T57 A;  5L6S A;  3OTM A;  3BSY A; 
#chains in the Genus database with same CATH homology
 1YP2 A;  4N6B A;  1MRL A;  4AAW A;  5DEM A;  1QQ0 A;  2WLD A;  2OI6 A;  3R5D A;  1V3W A;  3BFP A;  3I3X A;  2QIV X;  3FSY A;  2ICX A;  1HM9 A;  2WLF A;  1KK6 A;  4R37 A;  3R5A A;  3VBM A;  1MR7 A;  3R1W A;  3IGJ A;  4AA7 A;  3SRT A;  4EQY A;  3DHO A;  3VBN A;  1LXA A;  4AC3 A;  1T3D A;  4HCQ A;  2JF2 A;  3I3A A;  4KNR A;  3GUE A;  3FTT A;  2AQ9 A;  4KPX A;  4M99 A;  4M28 A;  1SSM A;  3V4E A;  1OCX A;  4M9C A;  2QIA A;  2RIJ A;  2W0W A;  3BXY A;  2GGO A;  3R2W A;  3OU9 A;  1MR9 A;  3FSC A;  1SSQ A;  5E3R A;  1KHR A;  3OUP A;  3EG4 A;  2V0K A;  3EH0 A;  1YP3 A;  3NZ2 A;  3DK5 A;  2GGQ A;  4HUS A;  1HM0 A;  3IXC A;  2WLC A;  1Z90 A;  3DJ4 A;  2IC7 A;  1TDT A;  3FOQ A;  2V0I A;  2IU8 A;  1G95 A;  1HV9 A;  1KK4 A;  3JQY A;  4M2B A;  3BSW A;  4J09 A;  4MYO A;  1SST A;  3FSB A;  1KGQ A;  4HZD A;  1V67 A;  2P2O A;  3FS8 A;  3ST8 A;  3VBI A;  4DCL A;  2VD4 A;  4FCE A;  1QRM A;  3GVD A;  1KGT A;  4N27 A;  4R7P A;  4IHG A;  2OI5 A;  3Q1X A;  5E3P A;  1YP4 A;  4G3S A;  2JF3 A;  3D98 A;  3HJJ A;  4MFG A;  5ADX V;  1THJ A;  4E1K A;  1G97 A;  1QRL A;  4M2A A;  5F42 A;  4EGG A;  2FKO A;  4H7O A;  3VBK A;  3R0S A;  2WLG A;  5DEP A;  5E3Q A;  2ICY A;  3BRK X;  3BSS A;  2VHE A;  1KQA A;  2V0L A;  3R3I A;  3R3R A;  4G3P A;  2WLE A;  5AFU V;  4EA7 A;  1KRU A;  4E79 A;  3TWD A;  3R5C A;  2W0V A;  3P1B A;  4KNX A;  3VBJ A;  2OI7 A;  3KWD A;  4IHF A;  4EAB A;  4IHH A;  2Q4J A;  3MQG A;  3P47 A;  3TIO A;  3ECT A;  4R36 A;  3CJ8 A;  4M98 A;  4MZU A;  1FWY A;  1QRF A;  3R5B A;  5DG3 A;  4ISX A;  2V0H A;  4J18 A;  2QKX A;  4K6R A;  3MQH A;  1KRV A;  1XHD A;  2XAT A;  4G87 A;  3D8V A;  3FSX A;  5U2K A;  2OEG A;  5ADX U;  1QRG A;  3F1X A;  3TK8 A;  3SPT A;  1KK5 A;  3FWW A;  3MC4 A;  4EA9 A;  1QRE A;  2I5K A;  2NPO A;  3R8Y A;  5L6V A;  3TIS A;  3OW5 A;  3PMO A;  4HUR A;  3VNP A;  4N6A A;  3VBL A;  4EAA A;  1S80 A;  1XAT A;  4HZC A;  2IUA A;  4KQL A;  3VBP A;  1FXJ A;  3HSQ A;  1J2Z A;  4E75 A;  5AFU U;  3TV0 A;  2TDT A;  2V0J A;  4E6U A;  4E6T A;  1KRR A;  1HM8 A;  3KWC A;  3KWE A;  4N69 A;  3TDT A;  3EEV A;  4G3Q A;  4EA8 A;  3OTZ A;  2OEF A;  3GOS A;  2IU9 A;  4KPZ A;  3C8V A;  3T57 A;  5L6S A;  3OTM A;  3BSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...