5E3PA

Crystal strcuture of dapd from corynebacterium glutamicum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
284
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
total genus 92
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3pA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3pA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3pA01
4R36A 4MFGA 3P1BA 2OEFA 4E6UA 2QIVX 1MR9A 3ST8A 3FSYA 2RIJA 3KWCA 1FWYA 1S80A 2ICYA 4FCEA 4KPXA 3VBIA 1KGQA 3C8VA 3CJ8A 3D8VA 3R1WA 3PMOA 4IHFA 3FSXA 3OTMA 3BRKX 1KQAA 2V0HA 3IXCA 2XATA 3I3AA 4M28A 1QREA 5L6VA 3R8YA 2ICXA 3JQYA 1TDTA 3GUEA 4J18A 4N27A 4HUSA 4N6BA 3EH0A 1SSMA 4HCQA 1MRLA 4KPZA 1KRUA 3OUPA 1J2ZA 3VBLA 4EA9A 2I5KA 1QRFA 5F42A 3OW5A 3R5DA 3R3IA 4G3SA 1KHRA 2W0WA 4MZUA 1KK6A 2TDTA 2AQ9A 3MQHA 1YP4A 4MYOA 2GGOA 2GGQA 1MR7A 3BSYA 3FSCA 5DG3A 1T3DA 4EABA 3IGJA 1SSQA 4KNRA 2Q4JA 2WLDA 3TDTA 4E6TA 5L6SA 4M2BA 1QRMA 2FKOA 3R5AA 1G97A 1HV9A 1XHDA 3BSWA 4M99A 5E3PA 3VNPA 4EA7A 4HZCA 3KWEA 3SRTA 2WLFA 1XATA 1HM0A 4E75A 4EAAA 1HM9A 2OI6A 4G3PA 4M98A 3DJ4A 3EG4A 3R5BA 2V0KA 2P2OA 5E3QA 4KNXA 1SSTA 3FOQA 4M2AA 3VBPA 1V3WA 4J09A 1KGTA 2JF2A 3R2WA 4EQYA 3MQGA 2V0LA 3KWDA 3FSBA 4N69A 4M9CA 1YP3A 1KK5A 4IHGA 4AAWA 2W0VA 1QQ0A 3ECTA 4R7PA 1QRLA 2QIAA 2QKXA 3BXYA 4KQLA 3VBNA 1KK4A 4K6RA 4E79A 1KRVA 1THJA 3MC4A 4ISXA 1HM8A 5DEPA 1YP2A 4AC3A 3T57A 5AFUV 4EGGA 3F1XA 2IC7A 4HURA 4HZDA 3FTTA 4H7OA 3TISA 2IUAA 2OI7A 5ADXU 3EEVA 3Q1XA 3I3XA 2WLEA 3BSSA 3DHOA 3R0SA 3OTZA 3V4EA 2NPOA 3FWWA 5DEMA 2VHEA 3GOSA 1KRRA 3VBJA 3NZ2A 4E1KA 3FS8A 4AA7A 4G87A 2V0JA 5E3RA 3DK5A 2JF3A 2OEGA 4G3QA 3R5CA 3BFPA 4N6AA 2IU9A 4R37A 3SPTA 3VBMA 3TV0A 1LXAA 1OCXA 4DCLA 5ADXV 4IHHA 2V0IA 1V67A 2IU8A 2WLGA 2OI5A 1G95A 3HJJA 3TIOA 3TK8A 3P47A 2VD4A 3D98A 3GVDA 3HSQA 3VBKA 2WLCA 5AFUU 4EA8A 3R3RA 5U2KA 3OU9A 1QRGA 1Z90A 3TWDA 1FXJA
chains in the Genus database with same CATH superfamily
3BSNA 1VHIA 3OFFA 4M5NA 5AXMA 2MQPA 1YRXA 4F3QA 4E6UA 3FGVA 1CJVA 1RXOB 4LF6J 1K7VA 5KG7A 2XULA 1SGQI 2DGVA 3C15B 4Y3CA 3RAQA 2SGFI 4R5PB 1N56A 3M8YA 1HQEA 3I4PA 3L9ZA 2CJAA 2C2ZB 4BHQA 5M2RA 2ZM6F 1Y1BA 2BJ3A 3G6XA 3CC4S 2R8HA 5L6VA 3JSMA 2I2YA 1DTQB 3EYZA 2IM1A 1UMJA 2KVIA 2DNZA 5FUWA 2B4OA 4FP9A 4NPOA 1MMNA 4QR0A 3R6LB 5T7LB 3KLGB 2R7QA 1FJGF 1XK8A 1NJWA 4LFCJ 2ZHOA 2DRDA 3PACA 3TVKA 4CH0S 2P9GA 4NX9A 3PV8A 4DR4F 1QRFA 1C1BB 1J5OA 3KK3B 1JJHA 2V2VA 4A24A 2X3DA 1HI1A 1B99A 1JQGA 3KLIB 4DL7A 1YP4A 5KFZA 2AJFE 2R2RA 3BGRA 3NMAA 2FLNA 2V68A 3EM1A 3FQLA 2V34A 1OY6A 5K5MA 1HHSA 4ELTA 3TDTA 1Y4ZB 1REVB 2KDOA 3H25A 4WTOB 1TAQA 3K0JA 2UUBF 4M2BA 3UQSA 2R8GA 2XYGB 2FKOA 1SGYI 2K9HA 2EFQA 2VKZG 4HACB 4NLOA 2C28A 3OHBA 1TOTA 1BQNA 2ZH5A 1FJGJ 2OD6A 2H48B 4RW9A 4EAAA 3TUZC 2IBKA 2ZVIA 3P3DA 2Y0BB 4MPIA 1RWVB 2CNOB 1HHQA 3MCNA 1IBLJ 3DJ4A 4ED2A 2AEJA 2PI5A 3DYAB 4ZJQA 4V19X 1T9WA 2A2CA 3MR7A 1X4BA 4NLXA 4X4OA 3CMES 1MSWD 2ZBRA 3A12A 2EKYA 4Y2AA 3NGKA 1ITPA 5F41A 1WACA 1ZPWX 3LANA 4M5KA 1KQGB 1SQFA 2HSEB 4IG3A 2C2RA 3KWMA 4AAWA 2QLFB 3GE9A 1OIAA 2BX6A 1BUXA 3QO9B 3HH2C 1F2HA 1U0HB 4DUZJ 4EZ9A 3QT6A 4IYQA 2WBRA 2SGEI 2PSZA 4LIWA 3QATA 4FNHA 3HHLA 1L0SA 4FYXB 5DEPA 1RDRA 4OZJA 1H0ZA 2QL5B 1UEKA 4F67A 3CC2S 3VALA 3C3LA 1PYOB 2QL9B 2NZ4A 2ORWA 1RBAA 2L9WA 1C0TA 3DI6B 1KVJA 2O1PA 2VQFF 1JLFB 3ILIA 2PMWA 3G82A 1JLGB 5HANA 4DMZA 4DL3A 3EXCX 3TNVA 3MAAA 2BVZA 4CO5A 1Z7KB 5FUVA 2GFFA 4OLPA 2G2YA 5ETQA 4DXLA 2R7RA 2ARPF 1PG5B 4K4TA 3TAQA 1M8BA 2GNKA 3OUYB 2RQCA 3VBJA 2LQJA 4DV4J 1SL0A 2D41A 3I0SA 2CPIA 1NK4A 1Q81T 4Y0FA 2CNLB 2FTRA 2FHKA 2W24A 2Y8YA 2RB7A 3TW0A 4F2RA 2YX7A 1NNDA 3I0SB 3T6BA 5DG7A 1ZETA 4OHVA 1IBKJ 3OH1A 2ZNZA 2XB2D 2ENNA 2AHOB 2VPXB 2CQ1A 5DM6Q 2OKQA 3CD0A 1C4CA 7AT1B 4YR0A 3GV5B 3LPEA 4MFBA 2IU8A 1YDLA 1U1NA 2QZ8A 1WUUA 2MZQA 4PG5A 2ACYA 1X4EA 2MSSA 3CCRS 3GLJA 4K0KF 5KT6A 2CQGA 2GX8A 5K9FA 2WTFA 1SGPI 1B0PA 4DF8A 2P8IA 3W7BA 3MCSA 3SSSA 1H38A 3BH6B 4P2XA 4WE1A 1AA1B 1RKIA 2GJIA 3ADAC 5E41A 3PW4A 2V4QA 3GIJA 4B9MA 3PXGa 5C42A 1FKOA 4OYBA 3MMCB 4DR2F 5KT2A 1IR0A 3HVTA 2FVRA 4YHHF 2YQ3A 1NU4A 1OY9A 1S80A 2FDNA 3JQJA 4ED3A 1HIYA 3BH7B 2M8DB 1KGQA 2IVFB 1S9GA 3I56S 3IG1B 2FIUA 3V6JA 3D1HA 3I5BA 2QFJA 4DUYF 3M9MB 2N71A 1LFWA 1YJVA 4WFXA 4OHZA 1A0OB 3BO4A 4OX9J 4DR6J 3Q8RB 3PRVA 1SXLA 2XMJA 3MEGB 4QR2A 4RW7A 2XI2A 3U1LA 4ZIWA 2DK2A 3SCKE 3BQ2A 1FERA 4DL2A 3GUEA 1XR5A 1N33F 1HYSB 2XEXA 4I69A 2JL9A 5IS2A 5H9EK 3JSYA 3HSZA 4NA1A 5C7PA 4HCQA 4Y6IA 1BGXT 3DOMA 3MCMA 1KRUA 1FJCA 2W0TA 2YUUA 2IA0A 4PAAA 4TU9A 2LEBA 4OFZA 1HL6A 1L3UA 4FF4A 1WEXA 2V8GA 1TMJA 4KC5A 1PCAA 2HHHJ 3WX4A 3NL0A 2VPZB 2E7WA 4LVOP 3BO3A 5LL6d 2LEPA 2POKA 1BWEA 1WD6A 2H1YA 2K3IA 4X4UA 3NOCA 1S1XB 1WC1A 1VGYA 4J9MA 1MR7A 1TL1A 2WONB 5CABA 2D3UA 5DS7A 4ANDA 4DQPA 5L1LA 3K5MA 2L9NA 3SGQI 3I96A 4NL5A 4C4WA 1WNEA 2WLDA 3NKYA 4DV3J 4KHPJ 2UUWA 4KY3A 5F3ZA 4LF4J 2HHQA 1D3WA 4MIWA 2YKPA 3G8QA 2AYGA 4B3OB 3C16B 2CWFA 3HFVA 3V5RA 1NSAA 3W8GA 1BMOA 1IM4A 3JTNA 4M99A 2QTWA 1EP4A 4UOCA 4USKA 1DLOB 3K89A 2PC6A 3OBIA 4LR9A 5A0YA 3BBCA 2VB6A 2OI6A 2NU2I 3N6LA 4PEOA 4CLPA 1NJYA 4NRTA 1VC6A 4PG6A 4FBUA 1GXLA 2YXLA 3IWXA 3MM6B 1HJAI 2V0KA 1ZM2A 1WHYA 2GGPA 2G9OA 4BLGA 2P2OA 5E3QA 4WP3A 3BSOA 5DGAA 4DQIA 2RE1A 4UY85 2VDIA 4ZJOA 2D3O1 2U2FA 1XN9A 3CMQA 4ZJLA 2DYAA 3N0VA 5LXYA 3UGIA 1X4DA 2B8QA 3C6TA 4A4JA 3MR6A 1OWXA 1HKAA 2MKYA 5KFNA 4R25A 4LF5J 1KK5A 1IY5A 2ZITA 3H98A 3KFWX 3QGPA 6FD1A 1YSJA 1T9TA 4R7PA 4KQLA 2OGUA 2QKXA 1LWCA 3ITHA 3I9ZA 5AT1B 4ZVPB 4ECUA 3OR1A 4B17A 1N34F 2WRMA 3QAUA 3HVRA 2DO4A 3ZTOA 2DKVA 3DHWC 4ISXA 4NYZA 1U1KA 4JV5J 1GMUA 4ZPTR 2VPYB 4ZP6A 3MFHA 1FKPB 2W9CB 3UEJA 1N36J 4JI5J 2F3CI 4N76A 2IM0A 3FEYB 1LW0A 1SV5A 4H7OA 3ENWA 4KH0B 5KFTA 1U8SA 4DV3F 2XSJA 1Y8FA 3DOLA 1XNRF 1Q8IA 4Z7YA 4X64J 2GVDB 4EK2A 2RNEA 3LQVA 3UFCX 4N41A 2XZWA 1KRRA 1R6VA 1LEOA 5B0CA 3J80Y 1HARA 3CDEA 4RW6A 1IKWB 4E1KA 1MWQA 1S7IA 2X1BA 4I6YA 2YNGB 4RUBA 3SIPB 3E3XA 1VDHA 2DRBA 2JEGA 4JI3F 5AE3A 4OYOA 5D3GA 4NZ6A 4DOZA 4FN5A 1FDNA 2ASYA 1IBMF 3CD5A 1VIOA 4IOBA 2KMPA 1FWLA 4ZVGA 2CQDA 1XNRJ 4DR7F 1SKWA 3TZWA 2QN6B 2AJ0A 4QIGA 3VV2B 2K7JA 2WLGA 2HWIA 3TK8A 2JFDA 2HW3A 2DGQA 4CLKA 4UQGA 2ZKTA 3MPDA 3VBKA 1KFDA 4C3MA 4IDKB 1VQYA 3UR0A 4U67Q 5GMEA 2YWFA 4IUFA 4JV0A 4K8RA 2B3TB 2UXBJ 2ZC3A 1AN1I 2AJ2A 2BANB 4O3PA 2FJXA 1HEVA 2AZ3A 5L46A 1VQ9S 3GFZA 2FJVA 3K8VA 2CRLA 2FVQA 1C1CA 2JRSA 2JC1A 3HFZB 2Z30B 4KR0B 4OQJA 3IBWA 1S79A 2DH9A 2GJFA 2YKMB 3U02A 2VG6A 2JDJA 2J8SA 1IQTA 3EUNA 1KN6A 4EO8A 5LJ5Y 2V5HG 3M2UB 2IM2A 3R1WA 3NAIA 1NH8A 1N0UA 4IHFA 1R6YA 2BMBA 2C3PA 2F9DA 2VC0A 4LBHA 2J9DA 3H90A 3UDEA 1S0MA 5DAEA 3DLKB 4L9MA 1TDTA 3K5OA 5D4PA 5JVGQ 1S97A 3HSGA 5DETA 5C2GA 4Y2KA 1IBKF 1ZH5A 5H9FJ 3KLHA 4EZ6A 4CTAA 4CO4A 2I5KA 1X60A 3H5UA 2M9KA 4KFBA 1MWZA 3IRXB 4E98A 3IR6B 1KHRA 2W0WA 4PWDA 5F0UA 1SUQB 4IRKA 2RU3A 4ECYA 3M8QA 3BSYA 2C2EA 4JI2J 2BRLA 4YB1P 2QRRA 2DGUA 2OTLS 1TL3B 2C3YA 2V53A 3HHKA 2IC3B 4K2XA 2ZH6A 5THWA 3PIPQ 3LGMA 4HI2A 3MCOA 4ILRA 1JLBB 3KHGA 5FUYA 2JHEA 4EA7A 1ZA1B 3DLJA 3ISND 4OHWA 1M5KC 1JNRB 1XATA 4QPTA 4XDDA 3GONA 4QZVB 1VQ7S 4LFBF 5IV3A 2BW7A 3OTDA 5KG1A 1JKHB 3T3FA 4C8KA 1PGZA 3KTQA 4X4NA 4PQUB 2MZSA 2VG5B 1LWXA 2W25A 5IOLA 3QPIA 5J1EB 3M8WA 2Z57B 3Q0AA 1I1GA 2A6MA 3M8SA 3M4XA 1EETA 2H5JB 2W9BB 1JLEB 1WKJA 4Y00A 4B9VA 4K5RA 5BJRA 2SGQI 2JEIA 3L3CA 3FSBA 1T3OA 4CRJA 4IHGA 1S6PA 2VL1A 2PO4A 2W0VA 3MMAB 2EG2A 3R97A 5KFHA 1WOSA 3ENQA 1QRLA 3CF5Q 1RT4B 2JLEA 4W98A 4IQXA 1HD1A 3QJPA 4K7QA 4ZCLA 4LF8J 5DG8A 4X65J 4K4XA 1SI9A 3R7SB 3UI3A 2AX0A 1TBQR 1OVOA 3P6YC 4JI7F 4DL6A 1FCAA 3VZHA 1F2GA 2VA3A 1V1HA 4HZDA 3GQAA 1XBTA 2B9XA 3HZEA 4AL6A 3V6HA 1KKHA 4FF1A 3M30A 3C66A 3VZIA 3QFHA 3Q1XA 1LK5A 1TKXB 1HHTP 4X4SA 5HP1B 2WLEA 1FTCA 2CJKA 2GQ2A 3R0SA 2NCKL 3OTZA 1TK0A 4JI3J 2GVZA 4ITSA 4LR7A 2HPUA 4I4BA 4ZPBA 3OSNA 5B0BA 4QBUA 5MAOA 4W90B 2QYGA 3AJ2A 1W2IA 2DO0A 3BPDA 2CAJA 2G1DA 1IKYB 4M5GA 3UW1A 4DV7F 2F4VJ 3HFKA 4DR7J 2CQHA 2G2OA 4DR4J 1IBMJ 3VAFA 1OPIA 4N8NA 8ATCB 2PI4A 5GADU 4OHYA 4TLQA 1L3VA 2MKIA 2E1PA 1NUEA 2ZUGA 1MJBA 3MM9A 2BM0A 2CWXA 5LT5A 1X9MA 3NGTA 2D9OA 4R0EA 4KO0B 3DKDA 4WIIA 4ZPAA 3MI7X 3UPFA 1IUJA 5KFDA 5D4OA 2IYIA 4OYAA 5B09A 3JB9k 1Q16B 1XWLA 1WORA 5KG0A 1HPZB 4LSLA 1DAXA 3TARA 4JBCA 2YY3A 3TA0A 2J0QD 2B8TA 4I7FB 1PJ6A 3OU9A 2PDAA 5DQHA 4RNFA 1R79A 2BQ3A 3TWDA 2QGFB 1C0TB 1WSRA 2YQ0A 3PX4A 2DTJA 2XI3A 3QSYB 3BZQA 3D6HB 1KFSA 3IS9B 4ETXA 4OV1A 4QW9A 4IRCA 3TUJC 1OPZA 4ECRA 1LWFB 5KG4A 1GXTA 1FVQA 1Z2ZA 2RH3A 2F5GA 3D3BJ 3D5MA 2L3MA 4FXVA 3RW6A 1LWFA 2FJAB 2CWGA 3A1YG 1P6TA 2UU9J 4Y2MA 2UUCF 1UVLA 4J5OA 3RAMA 2CKWA 2NQPA 2AGOA 2WSEC 4IG3B 4PQAA 2AEFA 1P9ZA 2KT2A 5DO2A 1QREA 3ISNC 4ZK7M 1OSCA 4NLRA 3MDFA 4F3MA 1VCTA 2VV5A 3K5PA 3PYEA 3DCAA 3NMRA 1NPKA 2DXFA 2HZAA 3LO3A 3P96A 1LW2A 4NLQA 2FNFX 4ECWA 1OS5A 3O1LA 1RA7A 3BDEA 3EZOA 3KJFB 3W5YA 1ZZFA 3M8RA 3KHRA 1K73T 1RAOA 1XQIA 3R3IA 2SGPI 3I4HX 4DX7A 4DR1J 3LGNA 2JEFA 1UVNA 3VAMA 3KLEB 4DSLA 4UZBA 2M4MA 3DLGA 1QDUB 2IVYA 2JX2A 2V8DA 3ZNJ1 1FRLA 1RT7A 2HWHA 2LCWA 3RZAA 1Y3KA 1RT7B 3I6PA 2QA4G 3DDKA 2XCAA 5CAAA 1J27A 4CIOA 3H5YA 1RWWB 1S1TA 3QTLD 3CTRA 4ZPDA 1WWHA 4LVNP 4C8ZA 1RWNB 2X52A 1U7LA 2CYYA 4R8UA 4OX8A 2N4DA 5C25A 2JSXA 1V3SA 9WGAA 3V6KA 3MD1A 1N88A 1WI6A 3K59A 2DXDA 5CA5A 2PGCA 5IWAJ 2E9RX 1NXIA 5GAGU 3PW0A 2K2PA 2ROWA 1PCEA 2MPUA 2ZUAA 4RW8B 2X7IA 1VDDA 1GTEA 2K06A 4A8MP 3VDPA 1IR1A 1UW9A 2XRCA 3D1OA 1N8RT 3JSMB 2BQUA 1R31A 2LB7A 2YNFA 1J5EF 1L3KA 1RAJA 2V4JA 2C2OB 3QAEA 3HF5A 2C1EB 3QIPA 4AE5A 3KWDA 4DFMA 5HI7A 4GKJJ 2DNGA 3BBFA 1KVKA 4F0HA 1DQAA 2H5EA 5KFMA 4DR2J 3T1HJ 1FWPA 4WZQA 4E1RA 2VFSA 2KZMA 1MN7A 3Q22A 3DRRA 3FZ2A 3TUPA 2WZ1A 2LUYA 3IGNA 2VOPA 3TVZA 4K4YA 2DR9A 2DH8A 1RLDA 4GMKA 1UVMA 5K8PA 3TO7A 3AD8C 2W9AA 3HHDA 3SUCA 4ZMMA 3KMQA 4WF9Q 4FF3A 5LMNF 1FNOA 4USIA 2M8HA 4F4AA 1RACB 3QWPA 2W2PP 4OYIA 1QUVA 1SVDA 4QIWD 3B4MA 4SGBI 1TL4A 2J7UA 3D66A 3B6BA 3OT9A 4DF4A 4LQ3A 4LIRA 3GIKA 2MGZA 1X4CA 1N52B 4PXCA 1UHAA 4L73A 4Q8FA 2Z58B 1X4HA 2OAUA 1RAHB 1S6OA 4NCGA 5CQGA 3UGDA 4RU9A 1KQFB 4YS2A 3MFIA 3OGZA 2EK1A 4O44A 3UCGA 4E1PA 3I0RA 2YWKA 4JI5F 3CDBA 2HK3A 3Q8VA 3BBBA 2RKIB 4U9RA 1IWAA 4J37A 3VGTA 4J91A 1Y00A 5CZXA 3FMWA 2F7VA 4NZ7A 3VGSA 1UJ6A 3PDNA 2LU1A 4EO6A 3TJ9A 5HQLA 5HBMA 4YEAA 4KSEB 3TQ1A 2V63A 2FJWA 3AXMA 2W4CA 2E9ZA 2HMIA 1Q5YA 1IKVB 3D54A 2VD4A 1NMEB 3VAGA 3R5JB 5F8NA 2I5JA 1U24A 1AYEA 4O0NA 2HNZA 3KG4A 3KK2B 5HLFB 2QLBB 1HBNB 3IBCB 3DLKA 3NCPA 3NGSA 4IQMA 5A8RB 4X4QA 1M5OC 4B9SA 3BF4A 4AYBD 1FD8A 1JXVA 1RTHA 1SH3A 2YPYA 2W7PA 2Z2MA 1W2BR 1N5YB 2VOOA 4ED4A 1WTBA 2HHVA 1RHMB 3HLUA 4H4OA 4YY3J 3R6GB 2YKMA 5DZ6A 2M2BA 2NLWA 5CH7B 4OZLA 3JAMY 4MT1A 1LR9A 1C1CB 4Q8EA 4WFYA 3PNIA 1VRTA 1S6PB 1CT0I 1M1GA 2A18A 3MMAA 4IFYB 4QYRA 4LFAJ 1OSDA 1PBUA 3W60A 2ZE2B 1FX4A 1EQMA 1S99A 3AOCA 2IRUA 4HHJA 2BXJA 4RUAA 1RYRA 1JLQB 2BZ2A 3AFGA 3MR2A 1BQMB 1U1QA 3DLHA 2QA2A 4Q45A 1F5CA 1HBOB 3HT3A 4HUSA 4OX7A 4YN3B 4K59A 1MMLA 2RVJA 1CC7A 4MKYA 2E29A 3OTCA 4YDDB 1R8BA 2NYIA 2XG8A 3CCTA 3LP2B 1HNIA 2M52A 4KH1B 5DZ7A 1RT2A 2RQMA 5I3UB 4P72A 3V2UC 2KYXA 1PBAA 3R2DJ 2PFFB 4G3SA 1P9GA 3PJ9A 2CDRB 2GKVA 2B8PA 2HVDA 1S72S 3FSCA 2B0GA 3HHEA 2RUGA 4PYAA 3MTJA 4HYKA 4GC7A 3EGVA 2V2ZA 4IR1A 1UVJA 2G0IA 4NLTA 4USVA 4JI6F 4DN0A 3NY0A 5DLFA 2QPOA 1X5SA 3ISZA 2EWHA 1GT8A 3M8ZA 5L6SA 4FNIA 4DL0C 2XNRA 1WHWA 1Q8KA 4OX9F 1X31C 1HV9A 3PHTA 1MJ9A 1YJNS 3VNPA 1YGYA 2N4CA 3R9LA 1S9FA 4HZCA 3KWEA 1QJHA 2CUYA 3DMJB 1D9FA 1M1HA 1K47A 1JLQA 1XBWA 1IKXB 1QUPA 2DNRA 4G3PA 3BR8A 4RKUC 4CP5A 5IM0B 4A8QA 2R2SA 1NK7A 2HEKA 1S6QA 2KL8A 4OLOA 2ZM6J 3ILOA 1QAIA 4ECXA 1NPRA 2E44A 2FY1A 4ELVA 3UN3A 1VFJA 2HGNA 2CQCA 2KB2A 3I5CA 4EBCA 4A8KA 2AYBA 5C24B 2G0JA 1HNVA 4NXNF 2KTQA 1UVGA 2J9RA 2ZH7A 3CCWA 1JLAA 4ZN3A 2XMKA 2CQIA 1RU1A 3I32A 4AL5A 1FRKA 3T6JA 3M2UA 2V6AA 4OI3A 2QQDA 1JLAB 1DURA 2DGXA 2RT3A 4KHRA 2WHOA 4E79A 1B4SA 3C19A 2FGCA 2I5JB 5KFOA 3MC4A 3KHLA 4GC6A 2Y8WA 2ZH2A 5JMNA 1TMMA 2KZZA 3UD5A 1YP2A 2XMMA 2XYPB 3IO1A 3Q8UA 1N5QA 3WIUA 3CXCR 4B9NA 4N77A 4HURA 3N28A 3SDEB 1N54B 3M2VA 4O3QA 3VF0B 4ZPWR 2JYYA 4FPIA 5F9LA 1X9SA 2VFTA 2OI7A 1FRXA 2G2ZA 5I3PA 2XC9A 1TKZB 3V6DA 1VIXA 3KUHA 1S0NA 4FPRA 3M2RB 1TUGB 4JI2F 5L8RC 3DRXA 3G2XA 3D28A 3GR1A 4F50A 4WP4A 1NRKA 3AOAA 5HATA 3FBEA 2VG5A 4X84A 4ZVUB 5L38A 4WFNQ 2P6TA 4AQYF 3S6EA 2MZRA 2VQFJ 1CSOI 2Q6BA 2Y1IA 3H59A 1NPPA 3B4DA 4X62F 2R9LA 1HMVA 5A2QY 1Y10A 4A48A 3BJIA 2QEXS 1VS3A 3H20A 2ZH9A 2E9TA 1GAOA 2HURA 4GKKJ 2OP5A 1FDAA 3TV0A 1JLBA 1VRQC 1RUSA 2CZ4A 3IR7B 2EVZA 3TA1A 1NDPA 1R43A 2C42A 4FDFA 4HTIA 3DOMB 4F7VA 2HFUA 4DSIA 4NEZA 1G95A 3P47A 3HZGA 4P10A 2JVOA 1H7XA 2WLCA 3DOLB 2GKRI 4M5IA 3CCSS 2MKKA 1BHNA 4HKQA 1FXRA 1SV5B 1HQUB 2MQMA 3LAKA 2E66A 1FXJA 1RABB 2VC1A 3VAIA 1U6ZA 4DX5A 4IG0A 4PABA 3PM9A 2LEAA 4ZS6A 1SBRA 4PWDB 2BACA 1V1IA 2FJBB 5ETRA 4Z2XA 4TU7A 3V6DB 1HW9A 1RGVA 4IO1A 3IRXA 1K7UA 3PFEA 2IYGA 1UWBB 4KKOA 2N7YA 3CW2C 2MJUA 2J87A 1WC5A 3HVTB 3M7VA 3HKWA 3VBIA 5LMUJ 3AT1B 4NLDA 3BYRA 2LQ8A 3HKZD 5GAGI 2W2OP 9ATCB 2BE2B 2YKNB 1DARA 2R7SA 3I3AA 3IRWP 3NBPA 3TX0A 4LQ9A 3FC9A 4G65A 3MEDB 3KUGA 3G6ES 3R1HA 1D9AA 4PWWA 2XLKA 1HFEL 4N6BA 1VQPS 1H98A 4CLTA 1WG4A 2MXYA 4TYAA 2ASDA 4DG1B 1VC5A 2DH7A 1JMTA 1WEZA 2LFVA 3KLFB 2GJ2A 4CO1A 5J2QB 1WG1A 2CWHA 2YVSA 2HHXA 4WFAQ 2RKIA 1VK3A 1TVRA 1ZAVA 4A8SA 2V2KA 4URSA 4IG0B 1NZAA 2MHEA 4NI2B 1PTQA 1OQ6A 2BANA 1WI8A 4KBIA 2LP4A 3BO2A 1RA6A 2BUNA 2JH3A 3I87A 1YI2S 4QU7A 3IA0A 4EYHB 4E6TA 2HNYB 2CJBA 2OEKA 2Z56B 4M5DB 2XNQA 2X3TA 2WCYA 2N3LA 4O4RA 1X0PA 4WFZA 3EPIA 2NU4I 4WYLA 2ZHBA 5CYQB 3RBDA 4DR5J 1CJUB 4DS4A 1B64A 2IA6A 3BSWA 1YBUA 2L7XA 3L7PA 5J1NA 2HQFA 4DU7A 1HM9A 1HQ2A 3DRYA 1RWMB 3DLLQ 1FE0A 5F0WA 2KMOA 2KHDA 2YBVA 4I68A 4ZVOB 2ZBPA 5L1KA 4NA3A 1KBFA 2B43A 3PX6A 1IXKA 4ZP7A 3UNGC 5BXIA 3DRRB 4KPYA 4J09A 3GQ7A 1M90T 1U0HA 4ZCMA 2N52A 2ERWA 3CCMS 4EQYA 3HX9A 1T7PA 4M5JA 1VR6A 2DGOA 2AIRB 2YX1A 3PRDA 1ULNA 4CLFA 1N6QA 1F9HA 1CULA 1HBUA 1NLKL 2BABA 2C3OA 2QLJB 3A4TA 2OMLA 3JTPA 2MKHA 4WXWA 4ZPCA 3OTOJ 1ZYQA 3EDRB 3W9JA 4CT9A 3BJYA 4C98A 1U49A 1RU2A 3K17A 3TX8A 2DR8A 2HVHA 5HMXA 3GG1A 4I7FA 2ZVSA 2W9CA 1KWMA 4WIQA 2CNNB 1OQ3A 3EZ5A 1JJ4A 3W2WA 2DR5A 4IFYA 1N32J 2H4YB 3J81Y 2AF6A 3MM7A 1GFWB 1K0TA 1EB0A 1TUVA 2KXHA 3D6TB 1NBEB 3HJVA 3HULA 4P2FA 6AT1B 5FLXU 1HR0F 3QT5A 4O4GA 5GADI 3Q23A 2CVEA 1R0BG 3NS7B 4LRAA 2BJ8A 2QT7A 2CFXA 2HBRB 3LGHA 4PG4A 3PW7A 3SQGA 2E1CA 1FE4A 5KFPA 1TVRB 4P52A 2CNKB 1TKTB 2E5LJ 1RT5B 4DSFA 1FK9B 1XMOJ 3M32A 3MM8A 3GOSA 1FDBA 3ZTRA 2AP6A 4GO5X 1RT5A 1ZAXA 3ENAA 5HQMA 4J9KA 2XMUA 1KQSR 4DG1A 1S77D 3NRBA 1GK8A 2OI2A 3FSIA 2NSBA 4DFPA 1B7YB 3UE2A 4ZP9A 1IKXA 2JF3A 4DV1F 2HS0A 3MURP 4DV6F 1SL1A 4J9LA 4NYOA 1EP4B 2AKWB 2BEFA 3D7SB 2XQCA 2MZTA 1RSCA 2BE2A 4ZA1A 2I1RA 1TBOA 1V67A 4C7QA 2K7KA 5IT9U 8AT1B 5F8IA 2A1BA 3W2WB 2JLFA 3A8JA 2XCPA 1PC5A 4DUYJ 3FRYA 2DY1A 2IMWP 3EICA 3E2IA 2YX4A 1VISA 2LQ9A 1HWKA 1Q0NA 2CPXA 2DB1A 3M05A 4PXDA 2MDAA 1PJ5A 1VQKS 2R8KA 3HHNB 4JI1F 4R36A 1WDDA 3M6UA 1FFSB 4NLWA 5EWEA 3CO0P 4NXMF 4OI0A 1FYBA 1UFLA 4L3KA 1F6TA 1Y3JA 2U1AA 4H54A 3VWSA 1RKJA 1VQ5S 2OIHA 4O0IA 5GAEI 4DPTA 1RAEB 2X1GA 4A8FA 3L7UA 1HNIB 4RW4A 3AQPA 1UL3A 2OEMA 2BUSA 3TEGA 3F73A 4ELUA 3OXLA 1Q53A 2ZWOA 5F8LA 3ET6B 3MD3A 5E7OB 3D67A 5KFYA 1TFWA 3SEOA 3AA9A 1UP1A 4Q7AA 5L1JA 1H72C 3RB3A 2EFGA 1UA0A 1FJ7A 1BQMA 1S9EA 2GIRA 2VBXA 1N13A 3OL6A 5JUMA 1RZMA 2OH2A 2QL7B 4WZMA 5KFVA 4N27A 1CJUA 4DPXA 1QLNA 2UV8A 4JV2A 2M7SA 4GO7X 2M3DA 1Y5NB 1NJIT 3OXFA 3SCJE 4KO0A 1RT1B 3UVJA 5F42A 2FJEB 3OW5A 4N47A 1I94F 4J9QA 4DSEA 3AXKA 3UDLA 1UWAA 4OX6A 5ETOA 2AD9A 4B3MJ 4ZHRA 3M2RA 2HFZA 2VG7B 3FRZA 1RAFB 3NXZA 3W61A 5KOWA 3SV4A 2BJ9A 5DGBA 3EJMA 4WE1B 3ZC4A 5ETPA 3G86A 2GO9A 3Q8YA 3DNCA 3ZZYA 3GIMA 3PTWA 5J2QA 3MECA 2Q4JA 2YWGA 5M2PA 1U47A 4C8OA 4FS1A 2VZ9A 2G0CA 1RLCL 1B0VA 1HLWA 2V9KA 2XMWA 4OZ2A 4ZCIA 3RUBL 3KLGA 1N4IA 5J8CA 2F1FA 3TI0A 3O6QA 4HHHA 3RR8A 1APSA 2NUHA 4E75A 3HSJA 3DLEB 4ZLLA 5HAOA 1BLUA 4CLLA 5IT4A 1WF0A 2VG7A 3BPSP 4DUZF 2ASLA 2UVVA 4CCHA 4O44B 2XS7A 1F1BB 2H3EB 2V94A 1W26A 2W01A 2UP1A 1G2EA 1H7WA 4P74A 1B3TA 2PMHA 2MHNA 4O4GB 1S10A 2F40A 5EX3A 1R8PA 2NR0A 2DR6A 4M8LA 2MGZB 4NRUA 2ROPA 2GZOA 2OTJS 1H2UX 2B4UA 3MAAB 1U25A 2WBMA 1TK5A 1EETB 1XERA 2IRYA 3V4IB 2DVIA 4C6AA 2KCXA 1L3TA 2OPPB 1S9EB 3HO1A 3H8YA 1VI7A 4OYMA 3J7AN 1W25A 2IJRA 2HHSA 1N6QB 2HNDB 2MLXA 4YR2A 3Q83A 1SC3B 2JNJA 1AT1B 1XA6A 4EBDA 4EU0A 5A76A 4JI7J 3TISA 1GMWD 2WK4A 1PC4A 2CWKA 4IH7A 4GKKF 4QCLA 3C14B 1D0EA 4Y2CA 5F8GA 4X65F 4NOHA 3I3XA 3S8SA 4M94A 1NHVA 1OYDA 1RWKB 1T02A 3D0IE 3N79A 4ED8A 3RR7A 3KJQB 2HIYA 2AYMA 3IP0A 5IT9Y 3C2PA 1N33J 4YB7A 1PSDA 4Y34A 5CYQA 2BKOA 1Q8BA 1RISA 4J9UE 4RNNA 3HMJG 1H0HB 3CE8A 3B54A 4ZDNA 2CADA 2IAJA 2NSCA 3DM2B 3UFFA 2MLYA 3QT8A 3OVBA 4U7CA 3NAHA 2BJ1A 4KFBB 2IU9A 1UETA 4ATNA 2Q66A 2G1HA 3HT0A 3W66A 3CJ5A 2GCFA 4LF8F 3EGWB 3EPGA 4RL1A 1RT3B 2I6WA 1HWLA 2WVJA 5J2PB 4UTGA 3TIOA 4DR3F 1IKYA 1EX8A 1X4AA 4YDXA 3HSQA 3N01A 5K8OA 3OHAA 5BYRA 4X4RA 2V1CC 1KHWA 1UAWA 3MAHA 1EJ7L 1FVSA 4MTPA 4KRWA 3RAXA 2NYHA 3HDSA 4C0HA 2R2TA 1W3SA 4GI3C 3SQGB 3G71S 1TKXA 3IAM9 3H42A 1FTRA 2HGMA 1MR9A 3A8IA 5H9FK 3FJ2A 4LF7F 2PT0A 3HI9A 2EFPA 1LW2B 3MM7B 2ZZMA 4F04B 2VASA 2QLXA 3BN7A 1VQLS 1VBXA 5T7LA 1R8HA 2AX1A 3FSXA 2B6AB 2UZ3A 2CA9A 4F4KA 5HBMB 2O3DA 3VQSA 1YK9A 4HTJA 5IC4B 1RYSA 2Y1RI 3LPYA 2Y9HA 1KOOA 2GMJA 1K1SA 4N8OA 2ICXA 5KFSA 2HLTA 3X3UA 3JSBA 3VHQA 2B0UC 3QGHA 4Q5VA 2UUAJ 1R27B 4QR1A 1RT6B 2H65B 3CO9A 3DDIA 3FEZA 2DPIA 2HVIA 3EH0A 2PEBA 1SSMA 2BW2A 2QSFA 3G9CA 3DGPA 3F44A 1RHKB 3CJQA 3GTYX 4ALZA 4FKDA 1Y7PA 2XZDB 3OR2A 3NNCA 4I2QB 1Y5IB 2BV3A 1ZPVA 1FNMA 2F9JA 2L08A 2P2CB 4UZCA 4LREA 4USUA 4U96A 5KT5A 4X66F 1S1XA 3D6FB 1L5UA 1CJTB 3SFUA 2CVIA 2QA4S 3MUTP 1NK0A 1X9WA 1SGNI 2HBYB 4NLYA 3TOAA 2HFVA 3CDAA 2CIMA 3GSIA 1U1RA 3IGJA 5AXKA 4F3OA 2HRUA 2L48A 3NG8A 2HQIA 2L41A 2Z2ZA 3QIDA 1KP6A 1XEZA 3GQCA 3T19A 1T9XA 2QJ3A 3KJVB 5KT3A 4I2QA 2M0GB 2XSJB 2D3ZA 2JLGA 1AFJA 4ES2A 1AZSB 5ADZA 1RWXB 1Y1CA 2DITA 2NXEA 5KFIA 1QVGR 4NI2A 2DEJA 2ZE2A 4I56A 4WK3A 2HS4A 2GIFA 2VF3A 3R5BA 2AU0A 3HJFA 1GMWA 4G1QA 3MGJA 2V4JB 4TN2A 1CEZA 1SSTA 1IBLF 3HM9A 3FVYA 3QAHA 3PO4A 2EW9A 3DXSX 3J81j 3W9HA 4A8WA 4WBFA 1KGTA 2JF2A 3TO6A 2WCXA 2HFSA 4RO0A 4XDCA 4YB5A 3TVYA 3KLFA 1Q7YT 3MQGA 4JI0J 1N5YA 4RW8A 1H3DA 3C6TB 3PCOB 2NPIA 2WSCC 4ZVFA 2Y0MA 1KTQA 4KB7A 2DKOB 2XTJP 2WW8A 1WKLA 4K6RA 3SQOP 2J9EA 1E6VA 3FBFA 5T14A 1EKRA 3CCQS 3NCRA 4PZVA 3WDOA 4MK8A 1NK5A 3NCQA 4RZRA 2ORVA 1NDKA 4RR5A 3V81A 2IC7A 3M6VA 3QRPA 1UWBA 5JHWC 2DNLA 3RBXA 1TV6B 1U4BA 3AH6A 1WC0A 4PKDB 3KLVA 3ZZ0A 3MR3A 2CPHA 3EEVA 3T5LA 1N48A 2DR7A 4USHA 1SIZA 4LUBA 3DLGB 4UUWA 1JLEA 1EZZB 1ROFA 2DBBA 2AMCB 3WIVA 3OVSA 2XGPA 2MB0B 2F3JA 5G4DA 4FYVB 4URGA 1HQUA 4YY3F 5KFKA 2AJQA 1UUCA 2FVSA 2MEWA 3UVJB 3R3TA 1T9VA 4R0JA 1J2VA 2RQKA 5F8MA 3NWRA 4IDKA 2WVEA 4AA7A 4HGUA 2GVIA 3IXQA 1JKHA 4KHMA 2ADCA 1N36F 3N6NA 4MKVA 1T94A 1D09B 1ZAWA 1ICEB 4ECTA 3V4MA 3RBEA 3FNNA 4F4XA 3VBMA 3R5CA 2BE7D 1G3OA 3GFXA 4GRSA 3W62A 4LMZA 2AW0A 4JV5F 1B0TA 1OCXA 2LLZA 4C2MA 3NP5A 4IHHA 1Q4RA 1SQGA 3D00A 2CDQA 5BYSA 4NLPA 2I38A 2IVMA 4NMLA 2BOPA 1IKWA 5KFGA 2XMAA 2XLIA 1SC6A 2O01C 3R3RA 2ODDA 3OR2B 3CVKA 3P4UB 4RW4B 5DJBA 5FIIA 4DL4A 1XMQJ 1PYSB 1G4CA 1Y11A 2NS1B 3VVTA 3WZ0A 4HVZA 5L9NA 5KFJA 1CQMA 4K5SA 2HNDA 2FHOB 1O6XA 3GQ8A 2OPRA 2VFVA 3M9OB 4DCOB 1S20A 2KJVA 3VE5A 2R8JA 4YR3A 4B3TJ 4HT7A 5E33A 5LMNJ 2FC9A 2DHAA 4C8NA 3LP0B 4DZ6A 3GPAA 4C9DA 4LBIA 1KQKA 3D3CJ 3AY0A 4RBUA 3KLHB 4OMFG 2ZH8A 2VFRA 2KRRA 5EDWA 4BCAA 1T8EA 2ZFHA 1DS2I 2ILZA 2MKCA 3RTVA 2DNQA 2C2MB 4KPCA 4LF6F 4ILMA 2GIQA 5J1PA 5DQIA 4L76A 3QQCD 3UD3P 2CPFA 4PCQA 3JQYA 5DDQC 3OL8A 1ULKA 3N5BA 4PWUA 3H2VE 1HA1A 4ZITA 4R8UB 4CZCA 5K14B 2KM8C 1RK8A 1KVIA 3BKUA 2XWYA 3R2CJ 1WGCA 3UOEA 1REVA 1WEYA 2VG6B 1EARA 2N17A 5F8HA 2J0SD 5JXSA 3T1HF 3GFHA 3W65A 4DR6F 4NXMJ 3ULHA 2F4VF 4QWBA 1RWUA 3OLAA 4CH1A 2V69A 4I64A 4QIVA 2EFOA 4JI1J 4MZUA 2O66A 5J8FA 2WSFC 3ZZZA 4B08A 2AQ9A 3G8SA 3NGUA 2LEOA 2GGQA 3PJXA 2DNKA 3WC0A 4EWTA 2H4WB 2OD1A 3MXHP 3MECB 3UEYA 2V0NA 2LVWA 2MMYA 1TELA 2NPFA 3MPYA 5SUHA 2DJWA 2M88A 5EWFA 3JYTA 1R0AA 4J90A 1RHUB 3QNWB 4CQ1A 2MQLA 2ZJQQ 1G97A 1LWEB 3FZBA 2VHGA 1TGSI 3IFEA 1VQOS 3MPVA 4NCGB 1DRZA 4CYUB 3G82B 5DM7Q 2A0FB 4C8YA 2OUGA 3SRTA 1UZHA 1FRMA 5HVGA 3GCWP 1RT4A 4DS5A 1LV5A 2UXCJ 1DS3I 1MWYA 1RFHA 3VTIA 4YHHJ 4G3IA 4ZN1A 2EEYA 3SEKC 2YNGA 2L9DA 3KJVA 1NSKL 2SXLA 3AB2B 4KNXA 2JVRA 3W64A 3OFGA 3O2IA 4UOHA 4XPCA 2RQ4A 2QE5A 1SCJB 3CNQP 2E5IA 3C15A 3K8WA 1SH2A 3X1LB 3LP2A 3R2WA 1QAXA 5L39A 3IWNC 4X66J 1EAYC 5CXTA 3ET6A 4KGKA 3JAMU 4DV4F 3W5ZA 2PQ8A 1HYSA 2DEIA 4RPFA 1RHQB 3GJSB 3P45B 3PR4A 4X2BA 1KHVA 1TBNA 1Z2LA 1T05B 1KRVA 2UVWA 1FT8A 1S5ZA 3GB0A 5GMKa 1XMQF 4U95A 1JX4A 2MLZA 3PW2A 3IG1A 3CPWR 3WBZA 4UXIA 3BKTA 4AC3A 2AJ4A 4WP8A 4C3LA 4IH6A 3KNAA 1RWPB 1QSYA 1VQMS 4DR1F 1NDCA 1WSVA 1YRTA 2PEHA 2E1RA 5J2MA 1C4AA 1FKOB 1I94J 3LUYA 1RTHB 4P75A 2LDIA 2X3GA 1GX6A 2ROGA 2CZVC 3PKYA 4RU2A 4E2FB 5CD4H 1NO8A 2YWEA 4WK1A 1ZOTA 3RW7A 1QE1B 2XHCA 2B9YA 2Q1LA 2ZOGA 4CTAB 4DZDA 2GGPB 2KH9A 4ES3A 2PN6A 2Y1JA 1VQ4S 3MM6A 2DNYA 3BGLA 3QT7A 4P71A 4ZVEA 1BWVA 1QE1A 2XSFA 2ZOMA 4HH0A 3SPTA 3FCVA 4A8OA 4O3SA 3M32B 1SJ1A 3MM8B 1NM2A 3BQ0A 1J5OB 4EBEA 2HK2A 3AD9C 2DY9A 2HQGA 4KGZB 1CHOI 2B5JA 4MK9A 4Q44A 2JA1A 4MH8A 1HPTA 2E1MC 4M5MA 1O51A 2OI5A 3BR9A 5D77A 5HVHA 1NZ8A 2DNHA 5A8WB 3D98A 4UQTA 5AXNA 2ZJPQ 1RADB 1TTHB 4UXHA 4BC7A 3H4DA 4DLEA 3MEKA 1RT1A 3TYTA 3THVA 4K4SA 2W4PA 2IIHA 2UUBJ 1WF2A 2LA4A 4X4PA 4DFJA 1S76D 4ILLA 4FYDA 4NLSA 1S4FA 2DNPA 3GOXA 4IR9A 1UTAA 2MY7A 1U5KA 5ETTA 5CYJA 2WVFA 4JV1A 2IBOA 4PPDA 2KG1A 4FYWB 4JI4F 3DRPB 1WHVA 4OI6A 2RHQB 1LFPA 5E3AA 1X5OA 4PQUA 1CULB 1HBUB 5D0HA 3IWLA 3TWZA 1VBZA 4B9LA 2B4VA 3K5NA 5KFCA 3OH2A 4JI8J 1CC8A 3JQKA 4OYWA 3GIRA 1QY7A 3MTKA 4AXJA 2CJQA 5KAKA 1HWIA 3W5XA 3TOBA 1NJZA 5M2UA 3ETMA 2Q43A 4H4KC 2C2NA 4ZLPA 2G4BA 1ELOA 4MJKA 4I1TA 4DV0J 5D4LA 3AQOA 3E01A 3H40A 2MTLA 5EN1A 3IM9A 1IN0A 2CXEA 3EZUA 3FBBA 2XO6A 5HN0A 2KFNA 5IXUA 4CM2A 4DNCA 3R5DA 1EWWA 1SC1B 2DHSA 3U27A 1KR4A 3KYLA 4C3KA 1KK6A 1Y0HA 4Q0BB 4YB6A 3BEGB 3PEJA 1NHKL 1YRUA 1TKZA 2ZKUA 1T3NA 1T3DA 1URNA 4N56A 3MM9B 2W7AA 2OVOA 5IT0A 2ELIA 1A7GE 4DQSA 3O3LA 3UCZP 2MQOA 2DHHA 3O8WA 2Z2LA 1GX5A 1XR7A 1YX2A 2DGSA 3VAKA 3R5AA 1Z1ZA 4MFBB 3P8BB 3G6VA 4LRDA 1VQSA 1AB8A 3UNYA 4Q2LA 1U0SA 1TL7A 2CJYB 3EVWA 1U1PA 1F3FA 1LWCB 1RTJB 2JJ4D 3CJ4A 2BBEA 3D9BA 1KEKA 1MW7A 2E7XA 2FYXA 4XIUA 2W8LA 2ZH3A 2O5DA 5HP1A 1DQ8A 4ERDA 3FFIA 4K0KJ 5KG2A 3D0GE 2V2QA 3AB4B 1PAUB 3M30B 2MQQA 3VBPA 2GS8A 2WB4A 3QSIA 3OUYA 4NLVA 5JJBA 1YIJS 3CDUA 5B0GA 1DQ9A 2JFKA 4QW8A 5KFWA 1S0OA 4OZ3A 5GVQA 5AJ3F 4QU6A 1S6QB 3LOUA 4N69A 1BMQB 1ZBTA 4PXBA 3R7NB 3EGNA 4P9SA 1VC0A 3CD6S 5HMYA 3C6UA 4USWA 2KXFA 1SJFA 5A0YB 2KKHA 4LRFA 3OH0A 5LOQA 4DN9A 2FVPA 1MG7A 4LJMA 3TOQA 2HZVA 1HQEB 2GHPA 3B78A 2EFVA 1SGEI 2PIIA 3CWJA 4P7TA 4JUZA 4LF7J 1S57A 2R7VA 3Q86A 1CSJA 2C2DA 1Q95G 4LT6A 2DD8S 2CPJA 2WOMB 2ZBCA 4XO0A 3P49B 3IM8A 4OZNA 4E0DA 4DSKA 3K7RA 1Z4UA 5ETVA 2EBEA 2A10A 2LA6A 3QWUA 5E3CA 4WCEQ 2R7WA 4NXNJ 2BM1A 3DHOA 2DNMA 3HCXA 3OH4A 3FWWA 2ZZNA 1XJWB 2HYIB 2VHEA 1CE3A 3CMAS 1ZTTA 2OPSA 5KG5A 4MYTA 4L72B 1FX2A 3NLCA 2R7XA 1YJWS 2EG1A 2HNYA 1FARA 2RRBA 3T41A 3M1VB 2OEGA 4TY8A 4HDHA 4E8UA 3BFPA 1RCOB 2IY5B 1ZM9A 3CCLS 1NB2A 4TXSA 1XTZA 1QM9A 1H6KX 1NUBA 4CT8A 3KG0A 4F0KA 1FRHA 3DN9A 4HACA 3J80U 2ASJA 1X4SA 3GJTB 3ELHA 1DY3A 1CT2I 1VRTB 3GVDA 3U7JA 2DXEA 1HNWJ 4GVBB 3SYZA 4WKRA 1RTIB 1WG5A 2FY8A 3M2VB 3N6MA 4FVCA 4RUCA 5A2QU 2V9WA 2B7BB 1MU2B 4F2SA 1K0VA 2GVZB 1R0CB 2KT5A 4H4OB 1C2PA 3OV7A 4CLWA 1Z2FA 2FLOA 4ZIVA 5A6PA 2QLWA 1A9NB 4IOCQ 4DWIA 3DC2A 3OTEA 4CLYA 2E5LF 1SJRA 2XYHB 2R4FA 4W92B 2EC2A 4KPXA 1XC9A 5AE2A 1IKVA 2PD1A 3CJ8A 2JZ5A 3D8VA 1PYTA 3MPWA 1S1VB 4URQU 3BRKX 2IJFA 1KQAA 3O44A 4MIBA 3T9NA 1QD1A 1DTQA 1S59A 2UV8G 4CLSA 5KOXA 1RCXB 4KKOB 4YFUA 4ECZA 3J81U 3OXGA 1S49A 1WKKA 2J9DE 1SJQA 3DOKA 3HVWA 4DX8H 4I67A 4J18A 4OIXA 4DV2J 2X1FA 3C16A 4ED0A 1QAJA 1N34J 2B4PA 3BREA 3FFIB 3MEEB 1N5TA 4P2SA 3KDNA 1HNZJ 3OUPA 2LKZA 2RD5C 4A47A 1RTJA 3OTOF 3POTA 1VLYA 3FQKA 3CCES 3R5GA 1MJAA 2OFHX 1FF2A 1N4LA 1E6YB 1CPZA 3PZPA 1V9OA 1Y5LB 3HPOA 4AT1B 4B9UA 4ER8A 4PG7A 1FNXH 2KG0A 4B3MF 1UVFA 1YJRA 2KMRA 2HHWA 1G6BA 1M8NA 2MZJA 2N1AB 4DSJA 4OL8A 2VU5A 5CCMA 2VONA 3DFEA 3ZXWA 1F9FA 3A3PB 1CJTA 1U2RA 5A8KB 5AE1A 1RBOB 4V19J 4Q0BA 3BKFA 4ANEA 3EVMA 1Q5VA 4TQSA 1VQ6S 2J8AA 1JK9B 1XHDA 5I3UA 2AGQA 2NXJA 1XMBA 2J0XA 1HM0A 5KG6A 1VBKA 3UN2A 3I55S 2Z2YB 4OI2A 4FXDA 4LF1A 3ZO7A 4KJIA 2HVEA 2ZBIA 1HBMB 3QIPB 3CCJS 1HBOA 2QQEA 5CZVA 1JB0C 4F26A 2OSQA 2P6SA 4Q2MA 3GV8B 2BJEA 2AZ1A 2O67A 3PR5B 3PYGA 4A8XA 1K7TA 1M0SA 3TAMA 2I9SA 5KT7A 4DV7J 1NSPA 2MJNA 2X51A 4DFKA 1CT4I 1NDLA 3M8PB 3DDNA 3G96A 3NNAA 1KD1T 3ECTA 1TZ0A 2ZDPA 2QIAA 1HW8A 4M1KA 1OMUA 4RW9B 5D0GA 4KHPF 1KK4A 2J0WA 2P9CA 3NOGA 5KFAA 3US5A 3CUNA 2JW6A 2C3UA 4ICLA 2MKSA 3FMBA 3H2LA 5GAHU 3EX7B 5H9EJ 1TURA 1TKDA 1F9EB 3FCHA 1NB7A 4F4ZA 1PAEX 4X4TA 3L4BC 3CJKA 4AMLA 2IRXA 1NK6A 1HNVB 5FD1A 1MNEA 3FTTA 3CXLA 2HNZB 3A8KA 3ZZRA 1WOOA 4YUDA 2QA1A 4RNMA 3KK2A 1O5JA 1GH8A 1D8ZA 2F4FA 2ZOFA 4G1PA 2HMIB 3TJAA 1O0PA 5J2NB 2KFYA 1FEHA 1M5HA 4EEYA 1TUSA 2L8EA 3BSSA 5J2PA 3BGUA 4ZP8A 4BWJA 1X0FA 1OMSA 2QMUB 1J5EJ 5DEMA 5BYQA 3G4SS 4O23A 2WB1D 4U8VA 3NZ2A 1H74A 3CEDA 2C2KB 1SL2A 1PIEA 2CQ3A 3DM2A 4M5LA 5F3TA 4DU8A 5IWAF 5DDPC 3PYFA 2XY6A 1G1XA 3IBFB 1GXUA 5DRKA 1SPBP 3UCUP 5U47A 3WQPA 3DK5A 4KIAA 1HD0A 4R37A 5HJXA 4ZKAA 2R7UA 1U02A 4F0MA 1YHQS 4I2PA 4F4WA 2C3MA 1RHJB 4ZVQB 5ADXV 1XX6A 3ZTPA 3GILA 2BDPA 4LFBJ 1RAGB 3A3NB 3G6YA 1UFKA 1CQNA 1Q1KA 1P27B 1V5IB 2DIUA 2Q6CA 3DU5A 1S1UA 1Q8LA 3HHLB 2DCUB 3MMBA 4CNZA 3TAPA 1Q86T 1L3SA 4RBVA 1RT2B 2V8PA 1LR8A 4OI4A 4CO2A 1Z90A 4DV5J 2RS2A 2ALZA 1TK8A 3G8TA 7FDRA 4BC9A 3N4WA 1R89A 1FXLA 4ID5B 3FEXB 1SGRI 1YLXA 2LXUA 1DBDA 3BM7A 4G6VB 2GMHA 3CCUS 2XS2A 2GHVC 1TQLA 2FZGB 1FHTA 2FB0A 3N5FA 4FCEA 2CPEA 1RAIB 2BOAA 5KFRA 3TANA 1Q82T 1VOMA 4LSNB 2FHJA 5BR8F 3M9NB 3GMGA 3UD4P 1PTRA 2V50A 2XY5A 1N32F 4OV6A 1P1LA 2XATA 1U1MA 4M28A 2FLLA 4RBTA 1HWUA 2RDIA 3UWTA 1VRUB 1JNZB 2LQ5A 2YQPA 1C0UB 2OPQB 3K57A 3R1LA 4ZLJA 2WVCA 3RB4A 1P1TA 3U1MA 4LRCA 2YNHA 3P5TL 2DT9A 2QQCA 3DLEA 4KGVB 3PIOQ 4DQRA 2B9WA 1F0XA 3CSKA 2ALYB 5CCLA 3OL0A 4NMXA 5HLFA 5C25B 4LF9J 2HAFA 3AHPA 4QYZJ 4WYWA 2BRKA 2ZH4A 1GMVA 3OFEA 2EKNA 3SFGA 2LQBA 1H2VZ 4PXEA 4BWMA 1YTYA 3M6WA 2F8EX 5D15A 2QV6A 3DU6A 1DLOA 1JJCB 2P6AC 3MOZA 2RU9A 2JOQA 5HJYA 4DR3J 1IM6A 2I0XA 1CVJA 3I0RB 2CPYA 4UW2A 1NHUA 2DNNA 2Y1LB 3UR3C 4UOGA 3TZZA 2XMTA 1ZM3A 4CDIA 2ZC4A 4K4VA 1DFDA 2NU0I 3TEHB 2YNIB 2ABYA 3HHLD 1IJEB 4HLBA 2BR0A 1U45A 3IN5A 2V67A 3E59A 1FAQA 3CJSA 3ETOA 3H4BA 2XY7A 4PUOA 4X4VA 3LALA 3OPKA 3CJKB 3SV3A 1Q9BA 4DJBA 2FZCB 4AD6A 1CS4A 4NEYA 4CLUA 1WC6A 2ZZTA 4MYUA 4JI8F 3GV7B 2ZD1B 1JLGA 1T11A 4L74A 4CI0B 3FOQA 3C46A 1U48A 3R27A 4J7CA 3QJJA 2EC0A 3CJ0A 2QYCA 1U6FA 3LW5C 3MM5B 2F8HA 1T9YA 3K58A 4F36A 4O3OA 3GU0A 2GV1A 1PILA 3VQTA 1T0TV 4LRBA 3QGGA 4M9CA 1YP3A 3B4VC 3MHYA 4ZVSB 2RRAA 4J9OA 2PA3A 1RBLA 3BXYA 2CQPA 4KV8B 2V1CA 2R8IA 1S7HA 2VQEF 3GSDA 1FKAF 1U09A 4XTTA 2QSWA 4NCAA 3CB4A 1NSQA 2EPIA 5FLXY 3CT9A 3LTOA 4JCVE 5LMUF 3IS9A 3MZIA 1UCNA 4O3NA 1TL5A 5AFUV 4TVAB 4O3RA 2D9PA 2YNFB 3SCIE 3GP9A 4LF2A 2AWZA 3KUEA 1P8GA 4OYPA 1GQEA 3CULA 4J9PA 2XZTB 1ZTWA 1AXQA 1HPZA 4LSLB 3L7OA 5KFBA 5C2CA 1FDDA 2EBGA 1R7IA 3DRSB 3F41A 2R7OA 4RWXA 1PJUA 5HMZA 1PJ7A 2XBPA 3DGVA 4M63A 4F4YA 4USMA 3T1YJ 1K8AT 1YZ6A 1FI4A 2H9ZA 4LF5F 5IQQA 2E5HA 1NKBA 2BJ7A 2HHPA 3TP2A 3P5BP 4LF9F 2HQCA 1UVKA 3ZFVA 2V0JA 2FVCA 4FF2A 2KXNB 2OO4A 1DTTA 5ETKA 1ULRA 1JXEA 3RJMB 4OHXA 5ETLA 5B0AA 4FKYA 2FUG9 5D0EA 2A2DA 3NGRA 4CH7A 4FVMA 2VPWB 4U6PA 2XM3A 3KLEA 2RHSB 2OD4A 3UDVA 5J2NA 3MUMP 5AFUU 2JZMA 2ILYA 5LSLA 3MWBA 5AJ3J 3QYYA 1WF1A 1BUSA 3QRRA 3J7ZT 1TP7A 2CQ4A 4LF4F 2NXNA 2UXDF 1S1VA 5HO4A 1TBRR 3ZTQA 3FBCA 3OL7A 5FUXA 3N9UC 7WGAA 1U2CA 1TFYA 3AJ1A 2FHJD 1JLFA 2RAQA 2YQ1A 3FSYA 3PG9A 3D1QA 4ICLB 4DL5A 4B3RJ 3OJSA 1MLAA 1F60B 4A8YA 4C11A 1PKUA 1RWOB 2VDHA 4OVOA 3LA0A 2OU2A 5HQ8A 1ZS6A 4TNOA 3M8PA 3PMOA 1VYAA 4Y65A 3TR5A 4EMDA 3BSAA 1Q78A 1R0RI 1MU2A 2KHCA 3KOAA 1U6BA 1B7FA 3THTA 5KFLA 5D3GB 1CJKB 2QIFA 4LR8A 1MROA 1KOHA 1KLMB 3SCLE 2E5JA 3BS9A 3DHXA 3GJQB 4LSNA 1QVFR 4U7UK 3NWGA 4P73A 2H54B 1DZ5A 1MRLA 1YTPA 2AEMA 2GQCA 4TYBA 3W9IA 5KFQA 5MLCV 2M70A 4F02A 1FO1A 2DRAA 1YVFA 1UKUA 2UZAA 4DI6A 1MMDA 4WJBA 1YBAA 4C97A 4ETZA 3KG1A 5LSOA 3RRHA 2VODA 1UPMB 2TDTA 2AT1B 2DGWA 2OHDA 4ID5A 4M5DA 4AFFA 4MYOA 1WTJA 3UN5A 2UXCF 1YJTA 5DG3A 4CNYA 3BYPA 3SZ2A 2NU1I 4K4ZA 4CWBA 1LW0B 1UEUA 2FJDB 1BXNA 4RX6A 3MMBB 2ZDOA 3UO0A 3G87A 1IY6A 3T5HA 1LKZA 2FQQB 3VR1A 3QLHB 1OMTA 3OTBA 5KT4A 3H0PA 4MK7A 1X7VA 1W7WA 4DV1J 2E73A 2BKNA 5E3PA 2DIVA 2QO3A 2KT3A 2ZBQA 3AOBA 3KDOA 1PO6A 3MAQA 1O8BA 1TU0B 2YTCA 3TO9A 4QWAA 4ECQA 4WU3A 5ETSA 5FDLA 4M98A 1T03B 2RF2B 1EQ0A 4W4MA 1VBYA 2FPHX 1P9QC 1S6UA 2KYZA 1HWJA 2R3VA 3EDQB 4IFVB 1R8CA 4OJ1A 3UGLA 5F9NA 1NKEA 3NBPB 2K1RB 4RWWA 4U7UD 2E7VA 1U26A 4USTA 1XNQF 2LDYA 1NCLA 5KTQA 5F8JA 3SI8A 5SZTA 1HR0J 3NEKA 3W2VA 4DEZA 3VBNA 2YH0A 3IGVA 4RLEA 2HIQA 4FYYB 3B8HA 2QC3A 3PHEA 4Y28C 4NASA 1THJA 3F0NA 4YP3A 3LH2S 4C0BA 4QPXA 1SJ4P 3J7YU 4B3SJ 1N0VC 1HM8A 2QQ0A 5I3QA 2J76E 5KFUA 1SKSA 1MN9A 2W9BA 3RB0A 4ID8A 4B3OA 4K50A 3CIMA 5K8MA 3D6MB 2ADBA 4B02A 4C0OC 3FUYA 1CGJI 1TL7B 2HFNA 1NXUA 2LXIA 1SKRA 1G7CB 4DUTA 5B0DA 5ADXU 1TL1B 2WONA 4KGMA 3CJTA 1A6LA 3S01A 4D3GA 3KKFA 4A46A 2UUTA 3KMSA 2ZJRQ 3CC7S 1K1QA 4H4MA 3QZ7A 4MMOA 4RNHA 1WC4A 2QMWA 3VGVA 1RT3A 3D68A 4TLRA 2FD2A 4EI2A 4DQQA 1TAUA 2XLJA 1YITS 4PRFA 1AFIA 3W63A 5CYMA 1S1WB 4NYPA 5RUBA 1HMVB 2N7CA 2QMXA 3FCWA 1WJ9A 4LBPA 4KGXB 4N5SA 3KXDA 4OJ3A 1AW0A 1TL3A 3CDWA 4I0WA 5L1IA 5ETMA 1OYEA 2NREA 5BR8J 1YQHA 2KRBA 3KNGA 3TZXA 4OZ1A 5A6WA 4JOUA 1HNXF 4B3SF 1XNQJ 3M8QB 2J7KA 3F56A 3RBZA 1AUDA 2IMOA 1SUQA 2CZ9A 3LWLA 2RJZA 1X5TA 3HJJA 1Q7LB 2RS8A 4P2MA 1H2TZ 1WHXA 2BA9A 1S9GB 2CPDA 3ZZOA 5B08A 4NCBA 1YKWA 3JQMA 2D1CA 2IM3A 4V1Ak 4F8RA 1NH7A 1CLFA 4KV8A 2VKRA 4DPWA 4IH5A 2J7WA 2BQRA 1IVZA 4MKBA 4DV5F 4MFGA 1AUSL 1UEVA 3P1BA 2CPZA 2HFOA 3CIZA 4CM0A 1FWKA 3MOJB 1JLCA 3RRKA 3JS9A 3ST8A 1PPFI 2P9EA 2CJ9A 2OPPA 4PR6A 1HI8A 1FWYA 1SC4B 1T9UA 4JI0F 3V4IA 4B9TA 3CJRA 3SBMA 2EI5A 2CG4A 3RGIA 5HROA 2FLPA 5IZHA 3I9V9 2FZKB 4GVLA 2K8GA 5I42A 1CGII 2V0HA 4C8MA 3Q8QB 2MQ8A 2F8MA 5ETNA 2W8KA 3KHHA 3R8YA 1IW4A 3K5LA 2A6OA 4G1IA 4ZLNA 3W2VB 4J9SA 2MYFA 1P9YA 3E2EA 3AJDA 3GZ7A 4ED5A 2AV5A 1B70B 4ANCA 3KK1B 4IOAQ 4QYZK 5G0RB 1S4EA 9RUBA 5IM0A 1WKXA 3CJ2A 4Z7CA 3T1AA 2LMIA 3DMJA 1J2ZA 3VBLA 3OVAA 4UUXA 2HAIA 2KM8B 3FK4A 3K2YA 1SKUB 3KJNB 2HHTA 1WDTA 4Y2IA 1U1LA 2GO8A 4HR2A 3QMQA 2M5YA 4J9RA 2GGOA 2QX0A 1UA1A 1TIHA 2SGDI 3AA8A 1VJQA 2ATCB 4EYIB 2XGQA 1SSQA 4KYZA 4OZ5A 3T5KA 3OSPA 2WVBA 2DHGA 3AAWB 2HG4A 2F65A 5CHCB 1M5PC 1LOUA 1TR0A 1ACMB 4WXOA 2B9EA 2Y3YA 1RQ0A 1FFGB 2UVOA 3H5SA 4Z37A 1V5VA 4AQYJ 4QWDA 3OLBA 3EG4A 5HVFA 4J9NA 4NA2A 4D3HA 3EXYA 3IMQJ 4B3TF 4DPUA 1V3WA 1YJ7A 2UUCJ 5HSPA 1T05A 1VLOA 2DNOA 4FXWA 5GAHI 1FKPA 2WW4A 1W4RA 2GIVA 2FHMA 2OFGX 2W2NP 4KAIA 1LK7A 5EX0A 4UOFA 3S1TA 5K20B 2N3OA 3ENVA 2BYCA 1KLMA 3THPA 2HHHF 2BJDA 1CJKA 1UJ5A 2GAHC 1X5PA 2YWHA 3BGOP 2WOMA 3OR1B 5B0FA 3TO8A 2BE9B 2DCLA 5GAEU 3GQ9A 1HI0P 3ITHB 2VJUA 3MMCA 4HH1A 3EWGA 5B7WA 5H1SV 2UU9F 5C42B 2QG9B 5T41A 4QQBA 1URRA 8RUCA 3VCDA 1VQ8S 3Q89A 4QIEA 3OJUA 4DR5F 1CG2A 2ACMA 2W2QP 3ILLA 5AXLA 1F5AA 1HBNA 3ZNUA 3TZYA 3QFWA 3JXOA 4I2PB 5DQGA 3BQ1A 2E5RA 5D0RA 1ZM4A 2VBWA 4N7TA 1NK9A 1KRPA 2YNIA 2NUUG 3BGRB 2YKAA 1LWEA 3JTOA 5A8WA 3T1YF 3LP1B 3TUIC 1VK8A 4I6WA 1IWGA 2VQEJ 3WX8A 2OLWA 1WTFA 1M1KT 2NPOA 1YZ7A 3A8EA 1R0AB 1S48A 3KK3A 4BS2A 1CBKA 2K1RA 1C1BA 3ONQA 2IHR1 3GR0A 3LWMA 2LXFA 4KQZA 5G0RA 4EFAC 3PRBA 2HQ3A 4XPEA 2MZ1A 3KK1A 3BGFA 5E3RA 1RB0A 2F63A 5LM7E 3VAJA 2V8VA 1SB6A 1KONA 3ILJA 4DV0F 3PFOA 4MIAA 4K4UA 2J6SA 1FK9A 1FY7A 4DCLA 2CQ0A 1TKTA 4OI1A 2V0IA 1U8WA 1RI7A 3QLHA 3S7RA 2ZHAA 2UVUA 3LAMA 2CG8A 3A13A 3ZZUA 4BDPA 2P5VA 4DBQA 5D8HB 2PA8D 1C0UA 2OPQA 2HWTA 2Q79A 3GWCA 3I5AA 5U2KA 4ZVRB 2EXUA 2MSTA 3OVOA 3DI6A 2YPZA 4WKYA 4ED7A 1NKCA 4OJGA 3QZ8A 1NEEA 4WTYA 1CJVB 1WC3A 3EMTA 3RYLA 1R8AA 4UF4A 1JWWA 3EGZA 2OEFA 2AYEA 1KBRA 2IPOB 2N82B 5ITHA 4J9VA 1EKSA 3J7A1 2R7TA 2RIJA 3MEGA 4RW7B 3GIIA 1Z2IA 4LFCF 4RNOA 1BC6A 4ED6A 4X64F 4U8YA 2HGLA 1KTVA 1SGDI 2K3KA 2VRWB 2X1AA 3C8VA 2AJ1A 1FEEA 3J7YI 4NZ0A 5HK4A 3OTMA 2DPJA 4B3RF 3IXCA 3PEHA 3H5XA 1RAAB 1VMBA 2BKPA 4WFBQ 2JWNA 2GHWA 3C8YA 2XMVA 5EUHA 2G13A 1FRJA 3DYAA 3FDSA 4TKTA 3D4JA 4NLUA 3MMJA 1UPPA 4WPAA 1N5SA 1SH0A 2E1AA 3SSRA 4QWEA 3AD7C 4KPZA 4FS2A 4C11B 1S1WA 4EA9A 1H73A 1BQNB 3OH3A 5HL7Q 1OJ4A 3NS5A 2OJ3A 2ZD1A 1S0VA 1V3RA 3HVAA 3L95X 1S1TB 4H4MB 4HT5A 4MAKA 4WP9A 5IC6B 5KFXA 1QSSA 2GA7A 3EE3A 1VQNS 1LNQA 3VGUA 4YQWA 4HL9A 4BBYA 3UDCA 1RE1B 1AROP 3OD2A 3ZZPA 2OZUA 1V3ZA 5L9XA 1UZDA 3TQEA 3QGIA 2OSRA 2RUSA 3NNHA 3E51A 1RHRB 3IAS9 2WAQD 4P7VA 3PKMA 5K8NA 3SSQA 4FBTA 3HP6A 2WLFA 5E2QA 5E0OA 2LECA 2IDEA 1D8YA 2KI2A 4HI1A 2KMQA 1K44A 5I42B 1WGTA 3LP1A 2W7OA 4ED1A 1NAQA 5HROB 2ATLA 2HZCA 4PYDA 4TU8A 3D2WA 4OYZA 3HHLC 4F25A 3Q8PB 4IO9Q 4M2AA 2OMOA 3MEDA 3PO5A 1D9DA 2YH1A 2B51A 2A20A 2ZWPA 3GCXP 3H7HB 4WU2A 3SXLA 3PVXA 2XS5A 2YKNA 1UW4A 1JLCB 3E8OA 4C48A 1IR2A 2XO7A 4K2JA 4R5PA 3T9ZA 5FDLB 5J2MB 1VRUA 4M95A 2J6TA 5LXRA 3HD1A 3BSCA 2RDJA 4UY8T 4AUKA 4ES1A 3QO9A 2AQ4A 3VDUA 2HRYA 4AL7A 2VA2A 2UXBF 4K4WA 5JVHQ 3DXBA 2D7SA 1LXNA 3CCVS 2ERRA 2DISA 3PY8A 2KN4A 1U2FA 3B82A 1VJWA 4EGGA 2Z4PA 2UVRA 2EK6A 2HBZB 1KNZA 3EVOA 1FESA 2HBQB 1LR7A 1AZSA 2IUAA 2XWXA 1OY8A 1UVIA 3I31A 2KU7A 4JI6J 1GEHA 1X4FA 2B56A 4MKAA 4UXJA 4ZVTB 4DV6J 4PG8A 1BY9A 1KMAA 2APOA 2VH7A 2OEJA 3HXMA 5KFEA 4DLGA 2EFNA 3SGBI 2W4DA 2ZH1A 3RB6A 1YJ9S 3QJLA 2RILA 3W8PA 1S1UB 1FRIA 3FS8A 2NXUA 3CCZA 3W3SA 4C8LA 4G87A 1CS4B 4KE5A 2R2UA 4OZ0A 1KLNA 4PUOB 3J7Z5 4QOTA 4G3QA 4ZCKA 4TQRA 4N6AA 1YU6C 2GKTI 1ZA2B 2V8HA 3GG0A 3POTB 4OJHA 4CYUA 2VJVA 3PX0A 6FDRA 3QBCA 1U1OA 2KO1A 2Y0SD 3A3OB 1I51B 4IRDA 3DGPB 4USJC 4JI4J 3KLIA 1WOPA 1YBTA 3FC3A 3MEEA 4KT0C 3TA2A 4EGLA 1HNXJ 1REGX 1XMOF 3JYTB 2XHWA 3R7BB 1EHWA 3Q2TC 3IR5B 2Z8QA 1IBCB 3MPUB 3DOKB 2VICA 4LFAF 1QRGA 2GC8A 4YOEA 1UFWA 3SDEA 2RMLA 1BQXA 3BDPA 1KBEA 1ULMA 2B6AA 2MKJA 2RSQA 4L6V3 2D3OR 3OQ2A 3U1NA 3O5TB 3PJWA 2YKQA 2WGCA 3T5JA 5B0EA 2QIVX 2DB6A 3RRGA 3IC1A 1NK8A 2AGPA 5KG3A 2DHXA 5E5NA 3D0HE 3KWCA 2OELA 3GYXB 2VIHA 2ICYA 3M6XA 1GTHA 2A3JA 4IFVA 4RUHA 4ECSA 4NE9C 5EHHA 5DDOC 5D78A 2JXDA 2RF2A 5K14A 3DLBA 5D4NA 4QWCA 1T03A 4HHUA 1Q79A 2KVQE 4M5HA 3GFYA 1LXJA 2CQBA 3CGIA 3HSDA 5D6GA 3AODA 5J1EA 1HDLA 2I8EA 5C24A 1RTIA 5HMWA 2HQDA 2COLA 2Q3PA 1VHFA 2ZEJA 3OW2R 1OYVI 1JIHA 2KJWA 3NS6A 4FZVA 1M8CA 4G1QB 1NJXA 2IDLA 4AXIA 1YJUA 3Q2SC 3HK2A 4UT4A 1IQZA 2FC8A 1BE4A 5I4MA 2MQNA 2NU3I 2RDDA 5CD4A 3LP0A 3Q8SB 1RJJA 2PFDA 1FJEB 4LSZB 4IKAA 3M1VA 4TY8B 2CJSC 3ICLA 4DPYA 4DCJB 1RTDA 2IC3A 2OPRB 2IAJB 3MQHA 2YKOA 3DRSA 3GYNA 4ZOSA 3SMZA 4ENOA 1HNZF 2KFZA 2VD3A 4DHVA 1K9MT 1I5OB 3MR5A 4ECVA 2R42A 1BD6A 4EABA 4H4KA 4S0MA 4DV2F 7FD1A 1F3VA 1M5VC 1XR6A 4KNRA 3HD2A 1SIWB 1ZZNA 1LQ9A 2H51B 1KS2A 3E01B 2GW8A 1FXDA 4HDGA 2HRTA 1QRMA 1RTDB 3BN4A 5CYMB 5EGYA 5IFMA 1MROB 2MY8A 2W2MP 3RG6A 5IV4A 4JYAJ 2LYVA 1T95A 1FD2A 2J5AA 2VBZA 1YG0A 2RRNA 3MUVP 4NWBA 2PMZD 3BB5A 4CLZA 1OO0B 5EWGA 2PE8A 5FJ4A 3VAHA 1F5BA 2DIPA 2LU2A 1QSLA 3OL9A 2ZNYA 3PYDA 1E6YA 3CJ3A 1RT6A 2C22A 2J6UA 5LJ3Y 5DDRC 1QTMA 4GKJF 1JJ2R 3MM5A 2DGTA 2NXCA 3L09A 4HEA9 1MT1A 3DRPA 2V4RA 5GMDA 4CO0A 1EIYB 2GMLA 3WC2A 3C6UB 3NGDA 1QTNB 1TUWA 2V0LA 2VFUA 4KTQA 1HNWF 3FKBA 3VVUA 1UJ4A 1QQ0A 2GAGC 1X4GA 1FA0A 2WVDA 1TV6A 5DLGA 1KC8T 2JEJA 1V6HA 2VUGA 5IQ6A 1JXLA 2HVZA 1KSPA 5DG9A 1YWXA 2CJXB 2HS3A 3H2UB 3ZTSA 5LSRA 3TJQA 1XIQA 3V81B 1S12A 1D1UA 2HHUA 1QAYA 3RU0A 2HLUA 1SJ3P 2FGOA 2W1BA 3CD7A 2CQ2A 3ZZTA 3T57A 2YWWA 1E6VB 2B5JB 2J9CA 3F1XA 4QIFA 2M5XA 4I6AA 4TY9A 1GNKA 5A8RA 4Q43A 3MF5A 3TJ8A 1DTTB 4FKXA 3JSRA 3QRQA 4JYAF 3Q24A 3GJRB 1DJ0A 3PW5A 1KDNA 2ENZA 2GQQA 2H5IB 3KY9A 4WWSA 3V4EA 2VBYA 4XAKA 4ZPVR 3TAMB 1Y9OA 4CO3A 1I6JA 3LF0A 4EUVA 1X8DA 4GVBA 5C5JA 2Z0GA 4ZVHA 4DDFA 3TRGA 1X74A 2YNHB 4JB8B 2IJNA 4RJVA 1HBMA 2B7CB 1SQEA 4DPOA 1IJFB 4DCPB 4ZHRB 2NZCA 1M5SA 4OYXA 1RTZA 3GYGA 4RW6B 4P6QA 4YMEA 3OFHA 1I3OB 2IFXA 1N5VA 2JC0A 4B6DA 4X62J 1LXAA 4DX6A 4NLGA 4JP8A 3I82A 2UUAF 3WHIA 2D69A 1FFWB 2GVDA 4XK8C 3BV8A 4L3NA 1RP5A 5A8KA 2RC4A 2E5GA 2HKEA 4L75A 3W1YC 4QJVA 1DHMA 2OPSB 2ROEA 3C14A 4PPZA 4EA8A 1R3NA 2UXDJ 5KFFA 1WELA 2D74B 2QFIA
chains in the Genus database with same CATH topology
3BSNA 3OFFA 5AXMA 2MQPA 1YRXA 4F3QA 4E6UA 3FGVA 5KG7A 2XULA 2DGVA 4Y3CA 3RAQA 4R5PB 1N56A 1HQEA 3I4PA 2CJAA 4BHQA 5M2RA 2ZM6F 3G6XA 3CC4S 2R8HA 5L6VA 3JSMA 2I2YA 1DTQB 3EYZA 2IM1A 1UMJA 2KVIA 2DNZA 4FP9A 2B4OA 4NPOA 4QR0A 1MMNA 3KLGB 5T7LB 1FJGF 2R7QA 1XK8A 1NJWA 2ZHOA 3PV8A 3PACA 3TVKA 4CH0S 2P9GA 4NX9A 4DR4F 1QRFA 1C1BB 1J5OA 3KK3B 1JJHA 1HI1A 3KLIB 1YP4A 5KFZA 2AJFE 2R2RA 3BGRA 3NMAA 2FLNA 3FQLA 4ELTA 5K5MA 1HHSA 3TDTA 1Y4ZB 1REVB 2KDOA 3H25A 1TAQA 3K0JA 2UUBF 4M2BA 3UQSA 2R8GA 2FKOA 2EFQA 2VKZG 4NLOA 2C28A 3OHBA 1BQNA 2ZH5A 2OD6A 3TUZC 4RW9A 4EAAA 2IBKA 3P3DA 3DJ4A 4ED2A 2PI5A 4V19X 3DYAB 2A2CA 4NLXA 1X4BA 4X4OA 3CMES 1MSWD 2EKYA 4Y2AA 3NGKA 5F41A 1WACA 1ZPWX 3LANA 1KQGB 4IG3A 2C2RA 3KWMA 4AAWA 3GE9A 1OIAA 3QO9B 4EZ9A 4IYQA 2WBRA 2PSZA 4LIWA 4FNHA 3HHLA 5DEPA 1RDRA 4OZJA 3C3LA 3CC2S 4F67A 3VALA 2NZ4A 2L9WA 1C0TA 3DI6B 2O1PA 2VQFF 1JLFB 4DL3A 4DMZA 1JLGB 3EXCX 3TNVA 2BVZA 4CO5A 2GFFA 4OLPA 2R7RA 4K4TA 3TAQA 2GNKA 3OUYB 2RQCA 1SL0A 3VBJA 2LQJA 1Q81T 2D41A 3I0SA 2CPIA 1NK4A 4Y0FA 2FTRA 2FHKA 2W24A 2RB7A 3TW0A 4F2RA 2YX7A 1NNDA 3I0SB 3T6BA 5DG7A 1ZETA 4OHVA 2ZNZA 2XB2D 2VPXB 5DM6Q 2CQ1A 2OKQA 3CD0A 1C4CA 4YR0A 3GV5B 4MFBA 2IU8A 1U1NA 2QZ8A 2MZQA 4PG5A 2ACYA 1X4EA 2MSSA 3CCRS 5KT6A 2CQGA 2GX8A 5K9FA 4DF8A 1B0PA 3W7BA 3MCSA 3SSSA 1H38A 4WE1A 1RKIA 2GJIA 5E41A 2V4QA 3GIJA 4B9MA 3PXGa 5C42A 1FKOA 3MMCB 4DR2F 5KT2A 1IR0A 3HVTA 2FVRA 4YHHF 2YQ3A 1NU4A 2FDNA 1S80A 4ED3A 2M8DB 1KGQA 2IVFB 1S9GA 3I56S 3IG1B 2FIUA 3V6JA 3D1HA 3I5BA 2QFJA 4DUYF 3M9MB 1LFWA 1YJVA 4WFXA 4OHZA 3BO4A 3Q8RB 1SXLA 2XMJA 3MEGB 4QR2A 4RW7A 2XI2A 3U1LA 3BQ2A 2DK2A 3SCKE 1FERA 3GUEA 1XR5A 1N33F 1HYSB 2XEXA 4I69A 2JL9A 5IS2A 3JSYA 4NA1A 4HCQA 4Y6IA 1BGXT 3DOMA 1KRUA 1FJCA 2IA0A 4TU9A 2LEBA 4FF4A 4OFZA 1HL6A 1L3UA 1WEXA 2V8GA 4KC5A 3WX4A 3NL0A 2VPZB 2E7WA 4LVOP 3BO3A 5LL6d 2LEPA 2POKA 1BWEA 1WD6A 4X4UA 2K3IA 1S1XB 1VC0A 1VGYA 4J9MA 1MR7A 1TL1A 2WONB 4DQPA 2D3UA 5DS7A 5L1LA 3K5MA 2L9NA 3I96A 4NL5A 4C4WA 1WNEA 2WLDA 3NKYA 2UUWA 5F3ZA 1D3WA 4MIWA 2YKPA 3G8QA 2AYGA 4B3OB 3V5RA 1IM4A 3JTNA 4M99A 4UOCA 1EP4A 1VC5A 1DLOB 2PC6A 3OBIA 5A0YA 2VB6A 2OI6A 3N6LA 1NJYA 1VC6A 4NRTA 4FBUA 4PG6A 1GXLA 3IWXA 3MM6B 3KLGA 2V0KA 1ZM2A 1WHYA 2GGPA 2G9OA 5DGAA 2P2OA 5E3QA 3BSOA 4DQIA 4UY85 2RE1A 2U2FA 1XN9A 3N0VA 5LXYA 1X4DA 3C6TA 4A4JA 3MR6A 1OWXA 5KFNA 4R25A 1KK5A 2ZITA 3KFWX 3H98A 3QGPA 6FD1A 1YSJA 3ITHA 4R7PA 4KQLA 2QKXA 1LWCA 3I9ZA 4ECUA 3OR1A 4B17A 1N34F 2WRMA 3QAUA 3HVRA 2DO4A 3DHWC 1U1KA 4ISXA 4NYZA 4ZPTR 2VPYB 3MFHA 1FKPB 2W9CB 4N76A 2IM0A 3FEYB 1LW0A 1SV5A 4H7OA 3ENWA 5KFTA 4DV3F 1U8SA 2XSJA 3DOLA 1XNRF 1Q8IA 2RNEA 3LQVA 3UFCX 4N41A 2XZWA 1KRRA 5B0CA 3J80Y 2KFYA 1HARA 3CDEA 4RW6A 1IKWB 4E1KA 4I6YA 2HHHF 2X1BA 2YNGB 3E3XA 2DRBA 2JEGA 4JI3F 5AE3A 5D3GA 4NZ6A 4DOZA 4FN5A 1FDNA 2ASYA 1IBMF 3CD5A 1VIOA 4IOBA 4ZVGA 4ILLA 2CQDA 4DR7F 1SKWA 2AJ0A 4QIGA 2K7JA 2WLGA 2HWIA 3TK8A 2JFDA 2HW3A 2DGQA 4UQGA 2ZKTA 3VBKA 1KFDA 4C3MA 4IDKB 1VQYA 3UR0A 4U67Q 3X1LB 2YWFA 4JV0A 2B3TB 2ZC3A 2BANB 4O3PA 2FJXA 1VQ9S 2FJVA 3GFZA 3K8VA 2CRLA 2FVQA 1C1CA 2JRSA 2JC1A 4KR0B 4OQJA 3IBWA 1S79A 2DH9A 3U02A 2YKMB 1IQTA 2VG6A 2JDJA 1KN6A 3EUNA 4EO8A 5LJ5Y 2V5HG 3M2UB 2IM2A 3R1WA 3NAIA 1NH8A 1N0UA 4IHFA 1R6YA 2C3PA 2VC0A 2F9DA 4ZP6A 4WFBQ 2J9DA 4DL2A 1S0MA 3DLKB 1TDTA 3K5OA 5D4PA 5JVGQ 1S97A 5DETA 4Y2KA 1IBKF 1ZH5A 5H9FJ 3KLHA 4EZ6A 4CTAA 4CO4A 2I5KA 3H5UA 2M9KA 4KFBA 1MWZA 3IRXB 4E98A 3IR6B 1KHRA 2W0WA 4PWDA 5F0UA 1SUQB 4IRKA 2RU3A 4ECYA 3M8QA 3BSYA 2C2EA 2BRLA 4YB1P 2QRRA 2DGUA 2OTLS 1TL3B 2C3YA 3HHKA 2IC3B 4K2XA 2ZH6A 5THWA 3PIPQ 3LGMA 4HI2A 4ILRA 1JLBB 3KHGA 2JHEA 4EA7A 3DLJA 3ISND 4OHWA 1M5KC 1JNRB 1XATA 4QPTA 4XDDA 4QZVB 1VQ7S 4LFBF 3OTDA 3T3FA 5KG1A 1JKHB 4C8KA 3KTQA 4X4NA 4PQUB 2MZSA 2VG5B 2W25A 5J1EB 3QPIA 3Q0AA 1I1GA 3M8SA 3M4XA 1EETA 2W9BB 1JLEB 4B9VA 4Y00A 2JEIA 4K5RA 5BJRA 3L3CA 3FSBA 1T3OA 2WTFA 4IHGA 1S6PA 2VL1A 2PO4A 2W0VA 3MMAB 2EG2A 5KFHA 3PW4A 3ENQA 4IQXA 1QRLA 3CF5Q 1RT4B 2JLEA 1HD1A 3QJPA