5E3PA

Crystal strcuture of dapd from corynebacterium glutamicum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
284
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 92
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3pA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3pA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3pA01
4R36A 2OI5A 3I3XA 1KHRA 3BSYA 5AFUU 3P47A 1OCXA 2IUAA 5DEMA 4N6BA 4G3PA 5ADXU 3VBKA 1QRGA 3FSXA 5DEPA 3VNPA 3EH0A 3KWDA 1MRLA 1QRLA 2OEGA 4M98A 2IU9A 3FSBA 1KRRA 4FCEA 2JF2A 2XATA 1YP2A 3BRKX 4G3SA 4N27A 2GGOA 4H7OA 3GVDA 4KQLA 4KPZA 1HV9A 2WLDA 4E79A 3FSYA 4EA8A 2QIAA 3FSCA 3TWDA 1YP4A 4J09A 4R37A 3GUEA 1THJA 3EEVA 3R5DA 4M28A 2GGQA 2JF3A 3ST8A 1HM8A 4N69A 2Q4JA 3IXCA 2QIVX 4HUSA 3KWEA 3TISA 3TV0A 1QRFA 3DHOA 3VBJA 1XHDA 4KPXA 2IU8A 4E6TA 1HM9A 3MQHA 3R5BA 3OTZA 4J18A 2ICXA 3OTMA 3NZ2A 4E75A 1V67A 1XATA 2TDTA 2VD4A 3DK5A 1FXJA 3SRTA 4EGGA 2VHEA 4MYOA 1QREA 3R5CA 4HZDA 3I3AA 1TDTA 3FS8A 4M2BA 4EA7A 4MFGA 2OI7A 3IGJA 3EG4A 5L6VA 4E1KA 3FTTA 3TIOA 5E3RA 5DG3A 1J2ZA 2RIJA 3R0SA 3P1BA 2V0KA 2OI6A 1KRVA 2NPOA 1G95A 5AFUV 4ISXA 1KQAA 5E3QA 1FWYA 4KNRA 4MZUA 3V4EA 3R3IA 1T3DA 3D98A 3TK8A 5ADXV 1SSMA 1SSQA 2V0IA 3FOQA 2WLFA 3OU9A 3HSQA 3VBNA 4EAAA 3BXYA 4EQYA 4EA9A 1SSTA 3BFPA 3R8YA 4AA7A 3GOSA 3OW5A 3DJ4A 3FWWA 3VBLA 1V3WA 2V0LA 4DCLA 3D8VA 3VBMA 3ECTA 2P2OA 3PMOA 4N6AA 3F1XA 4R7PA 5F42A 1HM0A 3CJ8A 2OEFA 1S80A 4HCQA 3TDTA 3VBPA 4M2AA 4K6RA 4KNXA 3C8VA 3R5AA 4IHHA 4AAWA 4HURA 3T57A 1KK6A 2V0JA 5E3PA 1KRUA 1KK5A 1QRMA 3SPTA 1MR9A 1MR7A 4G3QA 1KK4A 3BSSA 2QKXA 4G87A 4M99A 5L6SA 2IC7A 3Q1XA 2W0WA 2W0VA 4AC3A 3R3RA 2FKOA 2V0HA 3OUPA 2ICYA 4E6UA 2WLCA 3R1WA 4EABA 4IHFA 1YP3A 2I5KA 3HJJA 3MC4A 3VBIA 2AQ9A 1Z90A 1KGTA 2WLEA 2WLGA 3BSWA 4M9CA 5U2KA 1KGQA 3KWCA 1LXAA 1QQ0A 3R2WA 4IHGA 3JQYA 3MQGA 4HZCA 1G97A
chains in the Genus database with same CATH superfamily
4R36A 3SI8A 4IRKA 2BOAA 4QU6A 5LL6d 3MDFA 1LWCA 4EBCA 2IVFB 1S1TA 5B09A 2JXDA 1H73A 5J2NB 4RNOA 4CLTA 3I6PA 2NR0A 5DDOC 1AZSB 2E1MC 3RBZA 3FK4A 2TDTA 4EGGA 2G0CA 4TN2A 1UFKA 5DO2A 2HVEA 3M8QB 1HNVB 4DX5A 3W1YC 2NPIA 4LR9A 5KT7A 3HD2A 2VDHA 2ZH6A 3AOAA 2RSQA 1UMJA 4DV2F 3OGZA 3M30A 1MT1A 2R7UA 3BM7A 3B4VC 2RKIA 1XERA 3M32A 1V9OA 2AWZA 2EKYA 4LQ9A 2KMOA 1MU2B 1M8BA 4DQPA 1Z2IA 4UXJA 1EX8A 1M5KC 5L6SA 3G82B 2OPRB 1Z2FA 1Q4RA 2QL7B 1N33J 4F67A 4K50A 3QT6A 1KSPA 5JVGQ 2DHHA 4K0KJ 3IXQA 4FVMA 5D4PA 2WVDA 1X7VA 3M2VB 2XNQA 2CPYA 3QQCD 3K5MA 4ZP7A 4DLEA 2KXNB 2ZH4A 4YB7A 2G9OA 5KFUA 4RW8B 3ONQA 2R2TA 4CLLA 2EFGA 3HP6A 3DRXA 2GGPB 3QFWA 1AUDA 2WCXA 1D0EA 1RTZA 1U09A 4B9TA 1RTDA 1RHQB 3KKFA 2OH2A 2AEJA 1B0VA 3GSIA 5AXNA 1SL2A 2AF6A 4NLGA 1HWLA 2C3PA 1IBKF 4DV7J 3R5CA 1CLFA 2P6SA 4MFGA 1YTPA 3IM9A 2XS5A 1TBRR 4ECVA 3V6DA 3L09A 4Y2AA 1N5VA 4NCAA 3CGIA 2F5GA 2IA6A 3D98A 2CQGA 2PEBA 3FVYA 4PQUB 3A1YG 4X4TA 3L95X 1RAHB 4HT7A 4TY9A 2EBGA 3GIRA 1S4EA 4B3SF 3GYXB 1T05A 3CT9A 4K5RA 1BMQB 1TBQR 1HBUB 5HATA 4ZPCA 1RT6B 1OWXA 3UGLA 3EMTA 1X9SA 3FC3A 2D7SA 2B8QA 3MM8A 3E2IA 2D9OA 4TXSA 2VOOA 4JCVE 3ZZYA 3J7AN 3FEYB 1PAUB 2ZUAA 5B0BA 1YJNS 3OJUA 4KO0B 3MXHP 2QSWA 1FHTA 4YP3A 2IU9A 3RRGA 1HWKA 3LUYA 2ATCB 2QYGA 3TUIC 1TAQA 2KZZA 2DK2A 2XZWA 1HM8A 2RU9A 1OY8A 2HFUA 4N77A 4FF4A 2HURA 5EDWA 4E6TA 4WYWA 1V67A 1FDNA 5C5JA 1WG5A 2NXEA 3IC1A 3MMBA 3ZZPA 2JRSA 5J2MB 2OSRA 1CULB 3G9CA 2VICA 3M6WA 2PN6A 2PQ8A 2GVDB 2XSJA 2Z2LA 1LFWA 4MMOA 3VTIA 3H25A 2HRYA 3HHLA 4ID5B 2ALYB 3UW1A 3UOEA 1IBMJ 2J0XA 3I96A 2XTJP 3IG1B 2HZVA 2W0VA 1NDCA 3VV2B 1VQMS 2BYCA 4F3OA 3THPA 2HHHJ 1JMTA 1RT5A 5DG7A 2C3UA 1BXNA 2XYHB 2DXDA 2ZH3A 3RUBL 2JVOA 4KFBB 1JLBB 1S77D 5I42A 4F25A 1LW2B 2I0XA 3DU6A 1S6QB 4ICLA 2W8LA 2WGCA 2NCKL 4NYZA 1SGEI 1NJXA 5SZTA 2Q4JA 1ICEB 4ZLPA 5EUHA 2MPUA 3MCMA 1F9FA 1W4RA 2MKHA 3FS8A 4NLUA 4KSEB 3V6KA 1RDRA 2IYGA 2DD8S 5E3RA 4ED0A 3KUHA 1U1PA 2NU0I 1XNQJ 2HQDA 3C16A 3NCPA 1Q79A 1IVZA 3BH6B 1UA0A 4LIWA 1SGDI 1YK9A 1U1OA 2X3TA 2NLWA 1F3VA 1U2FA 2DRBA 4C8ZA 1MG7A 3PNIA 2OTJS 3DI6B 4B3MF 3WDOA 2F7VA 1YHQS 2HYIB 5K20B 1SJ3P 2Z2YB 4E2FB 2HMIB 5A0YB 5LJ5Y 2B9WA 3WIVA 1TMMA 4JI5F 4ZLJA 2VDIA 2LEOA 2JL9A 3J7YU 4LRFA 3EJMA 5LXYA 4YHHJ 2C28A 1M0SA 3NMRA 1UHAA 1UJ6A 3JSMA 3UWTA 1DLOA 4GVBA 1F6TA 3UN3A 3LA0A 2R7XA 3TO8A 3MPYA 1N48A 2Q43A 4E75A 2DISA 2DIPA 2VQFF 1SI9A 4EU0A 4PG8A 3HULA 2DVIA 2UZ3A 2VRWB 2CPHA 3K17A 3WHIA 4UXHA 1HNIB 2ZHBA 2V6AA 2ZM6J 2FNFX 3AQOA 2PA8D 3PEJA 2W7PA 1WSVA 1M8NA 1SIZA 1HWJA 3MF5A 2XLJA 4X66J 3MEDA 2DNNA 4CM2A 3MOZA 5D0EA 2VG6A 5DLGA 2WVCA 2CJBA 3G4SS 2IMOA 2VBXA 4MFBA 1CC7A 4J9NA 5J8FA 2ZVSA 1ZAWA 4ZVFA 5HBMB 4DL5A 4W4MA 5KFRA 2BE7D 3QT7A 4ZP6A 4N6BA 4IUFA 1UWBB 3GQ9A 1RISA 4G6VB 3D54A 2CJSC 5F8LA 1S76D 1VDDA 2XWXA 2OI2A 3GCXP 9WGAA 1T9XA 3KUEA 4LMZA 2DNHA 1HMVB 3TISA 4IOCQ 3KLGB 1D1UA 2BABA 4LFAF 3HZEA 3E2EA 3TZYA 4HTIA 2VFUA 1CVJA 4ZITA 3AJ1A 5L6VA 2F9JA 3EZUA 1P1LA 2WRMA 4RLEA 2B4VA 3HXMA 4L72B 3OH1A 2XMVA 4B9SA 1S48A 3O44A 4NLDA 1LQ9A 4A8MP 1XTZA 3V4MA 2G2YA 5JVHQ 4DS4A 3DYAB 1LFPA 3NS5A 3TEGA 2HWHA 2CQPA 2R3VA 3Q22A 3HDSA 2IAJB 1CBKA 1VDHA 2PMHA 8AT1B 2L3MA 2GVZB 1SKWA 4G1QA 1NHVA 2ACYA 5L39A 3DOLB 4DR2F 5HROA 3LAMA 3DLKA 4ETXA 2XMWA 4CO0A 2JFKA 4FVCA 3BBFA 1LWXA 1PO6A 1DTQB 4ANDA 4HH0A 2OPQB 4J37A 1NH7A 5HJYA 1CJTA 4H4OB 3EX7B 2DR6A 2WBRA 2XMUA 3FZBA 4KB7A 3T41A 2RRNA 5KT2A 1PILA 3QO9A 1Q53A 5GAGU 2NXUA 2DRAA 2IDEA 3K59A 3IA0A 4R8UA 2J6SA 3TO9A 4ECRA 4Z7CA 2AJ2A 3QJJA 2MQMA 4U96A 4DV3F 1IUJA 1KR4A 2W2OP 2DNLA 1Q8BA 2G2OA 2QLFB 9RUBA 3HX9A 2RVJA 2N1AB 3OVOA 2BQUA 2IJFA 1FX4A 3FZ2A 3M1VA 2GS8A 4I6AA 3C8VA 1VC0A 1S72S 1ZAVA 4O23A 1RYSA 2MZJA 2N7YA 3GFYA 4O4RA 3VAGA 5KAKA 3BSWA 1TUGB 4P7VA 3CCTA 5G0RB 3MQGA 1S6UA 4ELTA 6FD1A 2IBKA 3BSYA 1N5TA 1UVIA 3CCMS 2ASJA 5DEPA 1S79A 1X4CA 1Q81T 2OKQA 2CJKA 3I87A 3IRXA 1CEZA 1H0ZA 2XG8A 1NJWA 2GMHA 1U49A 4FNHA 3KHHA 1N52B 4C2MA 1TL4A 1BD6A 2ORVA 4CO3A 1IW4A 2YKMA 3QNWB 2Y1JA 4KGMA 1U8WA 2CPIA 3GFZA 1BQNB 4F3QA 4FNIA 1J5OB 5GMEA 2K3IA 4O3QA 5DG3A 1V1IA 1T9TA 2A18A 4ZK7M 2V0IA 2EC2A 2J9DE 3J7ZT 4AA7A 2JC1A 2CPJA 5DZ7A 5IV4A 2WSEC 4OI6A 1FWKA 1KBEA 2CQ2A 4R7PA 3PTWA 3CCSS 2OEFA 1TUWA 1QSYA 4A8FA 2DYAA 1FYBA 3DMJB 2ZC3A 1ZM9A 4WKYA 3VGVA 1K7UA 1SV5B 4M5IA 1FXRA 3DRYA 1U0HB 4B3OB 4NOHA 2GV1A 3BQ2A 4DLGA 1NRKA 3KWCA 3D0GE 3JQYA 3J7YI 2OELA 1HKAA 4ZVHA 3OL9A 1UVGA 1XEZA 2ZJQQ 2CVEA 4ZLNA 2HHWA 2DY1A 3EZOA 4ZP9A 3BO2A 4M94A 4KPZA 3G86A 1RGVA 1ZAXA 3NS7B 1TL1B 2YWWA 3BF4A 1U1QA 5ETMA 2MZQA 2J6UA 5HAOA 4YR3A 3EZ5A 4J5OA 4PG4A 3Q0AA 1PPFI 2EBEA 2M9KA 2F4VF 2IA0A 1UJ5A 3J7A1 5L9XA 3R0SA 5A8WB 4PCQA 5I3UB 2ZZMA 2BMBA 2GMLA 4OHWA 4C3MA 3HSQA 1P27B 1EAYC 2WSCC 3D3CJ 3RRHA 4UQTA 4QWCA 1L3SA 4LF6J 5AT1B 3OXFA 1TK5A 2IYIA 1EQMA 4HURA 3SV4A 1KHWA 4ZPTR 3OR1A 2LXFA 4I7FB 2KT5A 1P9ZA 3ZZTA 2CWXA 4OYWA 1X9WA 5FUWA 1WKJA 2YPZA 2VA3A 5KFQA 2RMLA 4W98A 3QWPA 5M2UA 1JIHA 4A8WA 1VQSA 2E5HA 3E59A 1LR8A 3K5NA 3NNCA 3HT3A 4NYPA 3Q8VA 1IWGA 3CJKB 4OI4A 3ZTQA 2ZBRA 2LQ9A 3M8PB 2MZ1A 5KFHA 1CJKA 4G3IA 3NEKA 4DU8A 2KT3A 2OPSB 3TW0A 5T7LB 2AEFA 4RWXA 1FXJA 4NASA 4F2SA 1N33F 3AXMA 3DHXA 3KLFB 4DF8A 3P96A 2ROEA 2RNEA 3KNAA 2CG8A 3HHLD 1I51B 4K0KF 1QTNB 3TVZA 1T3DA 2KFYA 2G13A 1RTHB 3ULHA 1R79A 1S10A 3SDEA 2Y0MA 2XMMA 3CJ0A 3UCGA 4CT9A 4UY8T 4NA3A 1Y9OA 3K58A 2HNDB 2BJ3A 2V9KA 5L1LA 2MSSA 3H5UA 2VG5B 1WORA 1X5SA 2RS8A 4KQZA 1T3NA 2K2PA 3RB4A 3T19A 1UZDA 4DV7F 2JLFA 4P10A 2BANA 5DM6Q 7FD1A 1KBFA 3L3CA 1KTVA 2MKJA 1HI8A 2BW7A 4YS2A 3B78A 1X4HA 2WZ1A 4L9MA 1TKTB 5EWGA 2K8GA 3PHEA 2ZKTA 4P74A 3ST8A 2FC9A 5GAGI 4FN5A 3VAJA 1VJQA 3MGJA 1WC4A 4A47A 2MHEA 1YGYA 4PR6A 3PJWA 4U7UD 1QREA 5E3AA 2AYEA 1NK8A 1R3NA 1CGJI 5F9LA 2C3MA 5J2NA 1SQEA 1JNRB 2R7TA 1XNRJ 1CQMA 4DSKA 1G7CB 2MXYA 4DFMA 3BR8A 2BUNA 3UFCX 3HPOA 3CD0A 1YJWS 1AZSA 1NCLA 2FDNA 3GV8B 1CJUB 3JAMY 3NRBA 1K7VA 3OR2B 4C7QA 1NO8A 4KH0B 5IQ6A 3T5JA 1EB0A 1BWVA 2RB7A 2FKOA 2UVWA 1RAIB 2CNKB 3QJPA 1YDLA 1H7WA 1Q86T 4PXDA 4OZ1A 5DEMA 1RFHA 1MU2A 3R3TA 5CYJA 3A3OB 3G82A 2VC1A 4ITSA 3MMCA 1RAGB 2BEFA 3R2CJ 3GUEA 1WTJA 4JI4J 2BJEA 2FZGB 3CJ3A 4Q2LA 1HPZA 2BACA 5K8OA 1IBMF 2UZAA 2A6MA 3KXDA 2HAIA 3FEZA 1GMUA 4QIEA 4KYZA 1SGNI 1TL3B 1W2BR 1WF0A 1HR0J 1P1TA 4C48A 3SQGA 1D09B 2HHHF 2L48A 2FY8A 3NS6A 1WHYA 3E01B 1XMBA 3D0IE 4DR3J 4J91A 1SSMA 2FYXA 5IOLA 5EX3A 2RRAA 1YJUA 2ZOFA 1LR9A 4RBVA 1V3ZA 1JLQB 1H3DA 2W2PP 1XR7A 2W7AA 1R7IA 1FVSA 4CO1A 4CDIA 4QCLA 4PQUA 3H4BA 2AZ1A 1D9DA 4H4MB 4MH8A 5KG2A 1XIQA 2VJUA 1IBCB 1WHXA 3PW5A 1AUSL 1G97A 3PR4A 3NNAA 2G2ZA 1WELA 2B6AB 3K0JA 3HK2A 1FRHA 4UXIA 1XNQF 3MD3A 3JQJA 4PQAA 1WUUA 1FWPA 3QRRA 1R8AA 3N28A 4EYHB 1U25A 3IGVA 4C6AA 3W3SA 4ILRA 1UVLA 3CMES 5DQGA 2BM0A 3HZGA 2VPWB 3R5GA 2ZBIA 1TKDA 1JLCB 3PYGA 3M2UB 2YQ3A 3FUYA 3PACA 5J1EB 2C42A 3VBNA 3D0HE 4ILMA 1SGQI 1RSCA 3F44A 4Y2CA 1KFDA 2OMLA 3UN2A 3BQ0A 1UETA 2BKPA 4ZCIA 4C0HA 2AJQA 3MFIA 2QT7A 3I0RB 1VK3A 5J2MA 1TKZB 1CULA 4EMDA 1OJ4A 2OEKA 5E41A 1X4FA 1IY5A 1IKYA 5EX0A 1S9EB 4WFZA 1RWVB 4JI6J 4DL4A 3PJ9A 1TK8A 3L7UA 3R27A 3ILOA 1FWLA 3H0PA 3LWMA 2M7SA 5HVHA 2P6TA 4DR4J 4A8KA 1ZTWA 3KHLA 1V3SA 1DS3I 2XO6A 3OLBA 5HP1A 4X66F 2QYCA 4RX6A 4YDXA 4NLYA 2I5JB 2V8PA 2GW8A 2D3UA 2HS3A 1MJAA 4USUA 3IRWP 2Z58B 4KFBA 3HJFA 1JLBA 3TAQA 4M2BA 1BLUA 1S6QA 2YWHA 2OVOA 5F8JA 2PMWA 4X4OA 1RCXB 1FWYA 2J87A 3I9ZA 2AYMA 4C8KA 3LH2S 1MMDA 2HFZA 1UAWA 3CJTA 2EI5A 2C2KB 4NYOA 2L7XA 3DLBA 1S7IA 2DIUA 3DOMB 2DB6A 4B02A 4WP3A 4KC5A 4M99A 3W5XA 2CQHA 1Z90A 4N7TA 2JWNA 3KLVA 1VISA 2NYHA 1WSRA 1GX6A 5HO4A 3BDEA 2LQJA 4NXNJ 3DI6A 2YH1A 4N27A 3O2IA 2HLUA 5A0YA 4PWWA 3W62A 4WJBA 4AT1B 2J8AA 4I2PA 2GO8A 2MJNA 3UVJA 4OZNA 3PRVA 1NH8A 2HNZA 3EPGA 5ETVA 2J9RA 1EZZB 2D3ZA 5IZHA 1VRTB 1SC6A 5JMNA 1N34J 2WLFA 3DHWC 4QYZJ 4OYAA 1HFEL 4IOBA 4NWBA 4F4AA 2RAQA 5M2RA 1GH8A 1FCAA 1B7FA 1WOPA 1NHUA 5HQLA 5A8KA 2MSTA 2ZWPA 1HNIA 1UCNA 2MYFA 3E51A 4AL5A 1U2RA 1WC3A 5D3GA 4QIFA 4CH7A 2RQKA 1S9FA 1JLEB 3UO0A 2NSCA 2QJ3A 3WC2A 2HFSA 3CD6S 2PFFB 2IM2A 5L9NA 4HACB 4ZIWA 2KXFA 4JI7J 4J9RA 1MMLA 1XQIA 1O6XA 2DNYA 1Q7YT 3J81j 2H5EA 3BYRA 5KFXA 1UWBA 4ZDNA 2WOMB 2BW2A 3QT5A 2HHXA 4IH7A 1K0TA 1RQ0A 2B8TA 4MYOA 2B4PA 2A0FB 2B4UA 5K14B 3GJQB 1RAFB 4CLPA 1QLNA 3ENWA 3DN9A 3KLGA 2ZOMA 1TU0B 3RBEA 1RADB 4EAAA 4QWBA 3KLEB 2VPXB 1FRMA 1E6VB 4O4GA 4BDPA 1ZTTA 1RTIB 1DJ0A 2PDAA 2PIIA 1RLCL 2VF3A 3CW2C 2QA2A 2R7SA 2DHAA 3TQ1A 3KJVB 2LEPA 2QL5B 4NX9A 5J2QB 4WFNQ 3OTOJ 2CVIA 3CJQA 4DV1J 3KG4A 1R0AB 3KK3B 2C2DA 2W8KA 3QWUA 4DN9A 2GC8A 5AFUU 3LW5C 2M2BA 3EM1A 4G1PA 1Z7KB 2E5GA 3C14B 4WU2A 1C4CA 2GIFA 4DPUA 3BV8A 2IAJA 1L0SA 3G6ES 5C25B 1TL7B 2GVZA 3C6TB 4J9MA 1VOMA 2CJ9A 1WF1A 4OZ0A 1NDLA 1RWXB 3DOLA 2JVRA 4G1IA 5F9NA 2AKWB 3GB0A 3EWGA 2FJXA 1TDTA 1DTQA 4Q0BB 3SEKC 3FTTA 1NUEA 4FPRA 1VGYA 3W63A 3DLEA 2J9CA 1LWCB 4H4OA 1TAUA 2O1PA 4OLOA 5H9FJ 4X65J 1FTRA 2ZHAA 2R8GA 4OI0A 1Y7PA 3IO1A 4DR5J 5H9EJ 2CQ0A 4B3RJ 3WBZA 4RPFA 1L3KA 5FUVA 1JB0C 2H3EB 3NGTA 3LTOA 2SGEI 4X84A 2XBPA 3GOXA 2DO4A 1X31C 3KUGA 2VD3A 3N4WA 4P6QA 3M9MB 5HI7A 4CRJA 2XQCA 2QQCA 2O01C 1X4GA 2EFQA 3MUVP 1M90T 1TQLA 3M30B 3TOQA 4C8LA 1Q7LB 1B3TA 3D6FB 5FLXU 4DN0A 2V50A 3S1TA 1GTEA 5D78A 3D28A 4R37A 1U6BA 2V4JB 2GGQA 4ENOA 4LF6F 2LB7A 1PCEA 4AQYF 3KWEA 3D9BA 1MWZA 1GTHA 3T5KA 1BY9A 4WKRA 3KJQB 4F4XA 4MT1A 2LVWA 5BJRA 5GAHU 2WVEA 2IM1A 5EN1A 3BSNA 4MKAA 2XLIA 2NXNA 1S6OA 1Z4UA 4V1Ak 1ZETA 1C4AA 1BQNA 3O1LA 1J5OA 1S0VA 2HFVA 5FJ4A 2XY7A 5CYQA 1BUXA 2POKA 1Y10A 3N9UC 4Z2XA 4LSZB 3BB5A 2JJ4D 1T9UA 2QC3A 2YWGA 1U1RA 2BJ9A 3JYTB 4RUCA 3R5JB 2XNRA 3PO4A 1LEOA 2OEMA 3IP0A 2AX1A 4H4KC 3GYGA 4F7VA 1OQ6A 5K9FA 3IBWA 4USKA 2E9ZA 2VUGA 2RQ4A 1U0HA 2ZH9A 4B3OA 1QY7A 3P45B 2JF3A 2K3KA 2CJAA 1FRJA 2R8IA 3WC0A 1LV5A 1BWEA 3MM8B 3W9HA 3KNGA 4ED2A 2VHEA 3TOAA 3UR3C 5GAEU 4J9KA 1JJ2R 2BE9B 2JEJA 1Q1KA 3OHBA 3TI0A 1QTMA 2YX7A 1IM6A 1C0UA 3ZZZA 1PAEX 3CDWA 2MZTA 2CXEA 4EQYA 1CGII 5A6PA 2B0GA 1Q78A 3FMBA 2FHJA 1KK5A 1WDDA 2ZWOA 4OFZA 1YZ7A 3UPFA 2H51B 5A8WA 5I3UA 3EDQB 3Q1XA 1BGXT 1Q9BA 2ICYA 2ZUGA 3PYEA 3MMBB 4F4ZA 3ENVA 3CWJA 3TZXA 4HDHA 4RNMA 5F0UA 3PXGa 2AJ4A 1HIYA 1XNRF 1V1HA 3C3LA 3OFFA 3CJ5A 2GGOA 1FKOB 4J9VA 1U2CA 2HBQB 1UP1A 2EXUA 2DPIA 1TBNA 1UW4A 3HHLB 3TJ9A 5KFAA 1VBZA 2QIVX 4E1RA 2WVJA 3DHOA 3BN4A 1HD1A 1YTYA 2FVPA 2MTLA 1CT0I 3TJAA 3M05A 4AXJA 5FDLB 1RT5B 2V1CC 3MAHA 2MMYA 5IT4A 3CJKA 5DGAA 1EJ7L 3M8PA 2RILA 3U02A 1OPZA 4MKVA 5CABA 3CB4A 5EGYA 5K5MA 4KNRA 5BYRA 3TK8A 5D15A 2OPSA 3PKMA 2QQ0A 2XS2A 3FCVA 4I4BA 4KGKA 2RE1A 2J5AA 1ULRA 4PYDA 3KLFA 4DCPB 4YB1P 2PO4A 4JI4F 4NA2A 1K44A 2ENNA 4DV4J 4LF9J 3FBCA 2FLNA 1UEVA 1XMQJ 1RTHA 4LVNP 2UUTA 4LJMA 3FDSA 2HNDA 3C16B 3RBDA 2E1RA 4X4SA 2VG5A 3OQ2A 3PCOB 4DR3F 1F1BB 4DV5F 2YH0A 4F0HA 3EEVA 2QPOA 4TYBA 1CG2A 3GQ8A 2J6TA 3VBJA 1S0NA 2I6WA 1HM9A 3B54A 2K1RA 2NQPA 2YNFB 2FLOA 1TKTA 1VK8A 3EG4A 2V63A 2PA3A 2RS2A 4Y6IA 4J9SA 3H5XA 4ZA1A 5J1NA 2P2CB 1DBDA 1OIAA 1NPKA 4ECXA 4U8VA 1PCAA 3GG1A 1TKXA 1YG0A 2QMUB 1DLOB 3L9ZA 2HSEB 1VHIA 2F4FA 3CJ2A 3NCQA 4KNXA 1S6PB 3TRGA 4HH1A 2DR7A 2H1YA 4L6V3 3CCES 3HHEA 3MM9B 3H59A 3DGVA 3Q2SC 2XMAA 1N56A 1LNQA 2VIHA 2G1DA 2ZITA 4FF2A 3AQPA 2FVSA 4DCOB 4Y65A 3FRZA 1KHRA 1FFGB 3PW4A 3H40A 1N5YB 1QDUB 3P5BP 2DHSA 1FRIA 3MAAB 2Q66A 1KOHA 4E8UA 3DLGA 1HLWA 1KWMA 3CIMA 4ED7A 5J2PB 1NK0A 1RCOB 3OL8A 1NUBA 2VBYA 5GAHI 1EP4A 3KK1A 4ZVEA 3OPKA 1LXNA 2OSQA 3QAHA 4OLPA 2HEKA 2HWIA 2EFOA 2MQQA 3TIOA 3JB9k 4M5JA 5E3QA 1WHWA 4GKJJ 4JI6F 3VGSA 4XAKA 3OUYB 2V4RA 2OO4A 2LECA 4L3KA 1TFYA 2MKIA 2NUHA 4TY8A 3PMOA 4DR4F 4DBQA 3S01A 3T57A 5E3PA 3GIJA 3D68A 1UEKA 4EK2A 4P72A 5IM0B 4Q5VA 2XS7A 8ATCB 3MCOA 3W2WB 4O3RA 1NSPA 4V19J 1WTFA 2ZDPA 1S1XA 4ECQA 3SYZA 4U8YA 2FUG9 2YX1A 3GG0A 2Y1IA 4RBUA 2UXDF 2OIHA 3K89A 4MKBA 2ZJRQ 2JF2A 4ZN1A 2FGOA 2PE8A 2AZ3A 3PM9A 5F41A 3J80U 2R2RA 3W9JA 3W64A 1GNKA 5GAEI 2KU7A 5FUYA 3MR2A 4KPXA 4KY3A 2HZCA 4EZ6A 4DSLA 4F2RA 3OXGA 4X4UA 2XULA 2JEIA 2C2MB 2QGFB 4DX8H 3DLKB 3SXLA 1JLGA 5ETRA 2LCWA 2YTCA 3QAUA 5CD4A 1FY7A 1Y5IB 1KNZA 4EA9A 2QG9B 3SSQA 2CNNB 4NXNF 4FYDA 3D66A 3HSDA 2FVCA 4FKYA 3VBMA 1N0VC 1C1CB 1S80A 4A8YA 5KFJA 1WI8A 2RQCA 3M2UA 4MIBA 1RU2A 4GKKJ 3OT9A 1SJ4P 1FD8A 3W5YA 2C3YA 2MKKA 2CAJA 4K8RA 1HL6A 2LA6A 2C2EA 2L9DA 4R8UB 3A8KA 4CLSA 2EK1A 3WX8A 5DG8A 4C3KA 1KGTA 2V8HA 4LUBA 2LEAA 1OMSA 3SUCA 1IKXB 2I38A 1K73T 1IXKA 1IY6A 5DZ6A 4KGXB 3FSXA 1MN9A 2W1BA 1YSJA 1TKZA 1YP2A 3D1HA 4WFAQ 4LF7J 1VRQC 1N34F 4P9SA 3M1VB 2VKRA 2R8KA 4F02A 1B7YB 4MAKA 3ICLA 1NBEB 4QR0A 2DR9A 2G0JA 1SC4B 5DETA 2HK3A 1XBTA 2VD4A 1RT3B 4DQRA 2C1EB 2JYYA 3OH2A 3K5OA 3TUJC 3T3FA 4H4KA 1TMJA 3TX8A 5AFUV 1HARA 3UD3P 1M1GA 5EWEA 2I5JA 4JI2F 3BBCA 3DJ4A 2ASYA 2C2RA 5JUMA 4KAIA 2RU3A 4JI7F 4Y2KA 1QAJA 3OTCA 2NREA 1SCJB 2YKMB 1U6ZA 2AYGA 4Q45A 2W9CB 2VFVA 1FEHA 3PFEA 3EICA 4OHVA 2BVZA 2OEJA 4CZCA 4OI3A 2I5KA 3UNYA 2X7IA 2QLJB 2CQ1A 3GZ7A 4QOTA 2CQCA 5RUBA 1N5SA 6FDRA 2M5XA 1Q8KA 1FERA 1S9GA 3DOMA 3BPDA 3TVKA 1RWNB 4DX7A 1I3OB 1NKEA 3PW7A 3UN5A 1NPPA 2BM1A 1RTJA 2LQ5A 3V81B 2H54B 3UD4P 3ZZRA 5KFZA 5K8MA 4IOAQ 1OMUA 4DU7A 3I3AA 2BJ8A 3M6XA 1SC3B 1MMNA 3ITHB 4FDFA 5LJ3Y 3EGVA 3IM8A 1AFJA 5KFLA 4DV1F 2HGLA 1EARA 3ENAA 5AXKA 2YUUA 3IWNC 3NCRA 1VQ5S 1M8CA 4UW2A 2FVQA 1JLAB 3U1NA 2IFXA 5KFEA 5HN0A 3RG6A 4WXWA 1ELOA 3CSKA 1Y5LB 1D9AA 1VRTA 1H72C 4JI1J 2DGXA 1WEXA 4OI2A 3NKYA 2DHGA 2HPUA 3A4TA 4OHZA 1K7TA 3KLIA 2QZ8A 4LFBJ 4KGZB 2XHWA 5J1PA 4X4NA 2XMJA 1VBYA 2UP1A 1Q95G 4NXMJ 4BBYA 4WZQA 4X65F 3T1YF 3RW6A 2HK2A 2W0TA 1KONA 4D3GA 2BQRA 2AMCB 3MFHA 2OJ3A 2AGOA 1JLEA 4USWA 5HQMA 5HLFA 2QX0A 2ILZA 4WP8A 3ISNC 4B3RF 3M7VA 2NU3I 3M9OB 4J18A 3M8WA 3CPWR 1H74A 4JB8B 5U47A 4HACA 3GQCA 1FDDA 5KT3A 5MLCV 2OU2A 4RW7B 1FAQA 2E44A 4BC9A 4DL3A 3GIMA 1JXLA 3TX0A 2H4YB 3I0SB 4KE5A 4HDGA 4IDKA 2J9DA 1IR0A 2CWHA 2P9GA 1QJHA 4TU8A 2X52A 3CJ8A 2M8DB 2BRKA 3HD1A 4QW9A 4NL5A 1U02A 2BQ3A 3ZZOA 3NGUA 2AJFE 3MEKA 5K14A 4GMKA 3SPTA 2FC8A 1A7GE 4HHJA 3P6YC 3H98A 1Q8LA 1S4FA 4Z37A 4LSLA 3FCHA 3KLEA 1E6VA 1X5PA 3SCLE 3CC2S 3EYZA 2GIVA 4DPOA 2CQBA 1VJWA 2W4CA 2RHQB 3SDEB 3KJVA 3LGHA 4WP4A 3G8QA 1WI6A 5HVFA 3DKDA 1VHFA 5J2QA 4I56A 2V94A 2F3JA 3KK3A 2QFIA 4DR1J 4MK7A 3PO5A 1ULMA 3C14A 3FCWA 1NK5A 1KEKA 1SL0A 2XRCA 2BANB 1NDKA 1PBAA 2WB1D 1AB8A 2NXJA 2L8EA 5DRKA 4SGBI 4F4YA 4PZVA 4I2QB 1TL7A 3C6TA 4FF1A 4IRCA 2EK6A 2QIFA 3NBPA 3Q8UA 2Z0GA 1DHMA 2Z2MA 3ZFVA 4URQU 4DPYA 4JI0J 2VJVA 3DLHA 4CNZA 3CEDA 3S8SA 1S1UA 2X1BA 1F5CA 5A2QY 2YXLA 3CDEA 1PJUA 3DRSB 4IHHA 4X62J 3I5CA 1U6FA 4HYKA 4OYOA 4DFKA 2R8HA 3BBBA 5AE2A 2VPYB 4K7QA 3VZIA 1SQFA 3R3RA 3ELHA 3HHDA 1UL3A 2FJVA 3ET6B 3MMJA 2GJIA 1SGRI 3SIPB 2P9CA 3CE8A 2MHNA 5G4DA 4OYXA 1VFJA 3NGKA 4DZ6A 2X1AA 1MRLA 2LDYA 5KFDA 4BWJA 2DH8A 4JV0A 3FSCA 1U48A 3B4DA 3D2WA 5IC4B 1PJ5A 3Q8YA 1KVJA 2Y0BB 2DPJA 4X2BA 4IFYB 4ZPBA 4U7UK 3D1OA 4I67A 3TZWA 1HNWJ 3RGIA 1SKSA 2JA1A 3Q23A 1GQEA 2YNGB 5KG5A 2V53A 2V4JA 3GQ7A 3TA1A 1WC0A 2UUWA 2L9NA 4DV0J 1YBUA 4N8NA 4ZVOB 2CPZA 2V8DA 4CLFA 4C97A 4M5KA 5EHHA 4ZN3A 1P9GA 3MMCB 2YX4A 4NA1A 3AH6A 3VGUA 2FY1A 5SUHA 3BEGB 4P2MA 1R8BA 1VIXA 4M2AA 1HPZB 1VQ6S 1ULKA 4USJC 3CCUS 1I5OB 4ETZA 1GMWD 2GNKA 3A8EA 3OUPA 4TQRA 3SQGB 2HW3A 3Q83A 3TJ8A 2IMWP 3KOAA 4G3PA 1MROA 2KN4A 3D67A 2L08A 3HKZD 2B8PA 3HFZB 4WPAA 4KKOB 5DDRC 2ADBA 2N3OA 4QR2A 1URRA 2PEHA 1CSJA 2D74B 2WHOA 3JYTA 3KWMA 1C1BA 3OFGA 4M8LA 2EPIA 1T9WA 5MAOA 4LF9F 4MYUA 5ETOA 1QAXA 1XMQF 3GSDA 3MTJA 2J76E 2OPPA 1FNMA 3BREA 4JI3F 4CI0B 2A2CA 3MEEB 4GC6A 3I4PA 1PIEA 1N36F 1TGSI 3BSAA 2FJBB 4DL0C 2PI5A 1RI7A 3MPVA 4DF4A 2HNYB 3LAKA 1NNDA 1RAJA 1SIWB 3QFHA 3UDLA 3FJ2A 4HGUA 1U1MA 3M2RB 1NEEA 4C9DA 1FF2A 4QYRA 4ZVPB 1OCXA 4N47A 4DUZJ 2DB1A 5A2QU 2F8MA 4J09A 4M63A 3EE3A 2IBOA 3R6LB 4HT5A 4PXCA 4CLUA 4NI2A 3PEHA 1WEYA 2PFDA 2KHCA 2UUCJ 4IR1A 4DV2J 1SH0A 4Q7AA 1Z2LA 1LK5A 3NGDA 2ERWA 2GAGC 3HJVA 4EA7A 1IKYB 1FKOA 5BYSA 4ID8A 1NPRA 3OW2R 1NKCA 3BQ1A 5LSRA 2Q3PA 2MQNA 4QIWD 1HHQA 1XC9A 2MQ8A 4KGVB 3WX4A 1FI4A 2LXIA 4B6DA 4PYAA 2F3CI 1NB2A 1EETB 1G3OA 4IH6A 5FDLA 1WJ9A 3BO3A 1RZMA 1GK8A 5HP1B 1ZZNA 3DNCA 3ENQA 4EBEA 3MURP 3KY9A 1Q0NA 4RBTA 2R9LA 4OYPA 1KDNA 2W7OA 2XMTA 3SFUA 2ASDA 4BLGA 1KQFB 3HJJA 7FDRA 2AQ9A 3JS9A 4ED1A 3ETMA 4DMZA 5FIIA 4NLOA 3P47A 2IUAA 5KOWA 1J27A 1UTAA 3AY0A 5ADXU 1IBKJ 2A1BA 4GKJF 1WHVA 2KDOA 4RUHA 3TEHB 1LWFA 3R1LA 3HVRA 4OYMA 1UKUA 5HMWA 2COLA 3N6NA 4UUXA 1RWPB 3CNQP 1XATA 3PJXA 1GT8A 1RYRA 3CIZA 4B3SJ 2KVIA 3Q8RB 2WBMA 5C2GA 1TFWA 2V0KA 2DKVA 4P7TA 4IG3A 2QTWA 3OVBA 4A46A 2NPFA 2YNFA 3BS9A 1SUQA 4DCLA 1FKPB 4K2JA 3LANA 2AQ4A 2XZTB 3JTNA 4LRBA 4I2PB 4WFYA 2QLXA 5KG7A 6AT1B 3UVJB 1ZA2B 2RC4A 2HNZB 2R7RA 1KRPA 1Y4ZB 2YNIA 1REVB 4ECWA 5EWFA 1CS4B 1WC1A 1ZH5A 2ZDOA 2A6OA 3KK2B 3CC7S 1CHOI 1S6PA 3MM9A 2VG7B 2CWGA 3DOKA 1FXDA 3RZAA 1UEUA 4DX6A 2UUBJ 1TUVA 4TU7A 5A8KB 3UDVA 2DXFA 1SC1B 3MR3A 2LP4A 5CYMB 3IAM9 3THVA 2CPFA 1P9YA 2DH9A 1YBTA 3SEOA 1FTCA 5D3GB 1NM2A 3OD2A 4GKKF 3QZ7A 1N5YA 2BOPA 1WACA 2E7WA 1S0MA 3MAAA 2J0QD 1Q8IA 4W90B 1NSAA 1S1VA 2ATLA 2NU1I 3NWRA 3BGOP 2Y1RI 2BR0A 5J2PA 1X5OA 1K8AT 2XC9A 2FLPA 1VQYA 1L3TA 3Q8QB 2ZBPA 4ZVRB 3JTPA 2BUSA 2ROWA 4K6RA 4LRCA 1D3WA 1TTHB 1RLDA 3H2LA 2DNZA 1DQ9A 1TVRA 3CVKA 3PX6A 3OUYA 4USTA 4QWAA 1P8GA 1NJZA 1RUSA 4UT4A 4CH1A 1LXAA 2EFVA 5A6WA 3AJDA 5C42B 1WTBA 1VC5A 3VF0B 3TQEA 4MKYA 2DKOB 4O4GB 5IM0A 4AUKA 3AHPA 3CXCR 1VRUA 3W2WA 4A8XA 4XDDA 1O5JA 3R9LA 1YRUA 4IO1A 1O51A 4QIVA 4EZ9A 2E1CA 2DIVA 5CCLA 1N4IA 4ZHRB 2XEXA 4I1TA 1V3RA 3BO4A 4C8NA 2KL8A 5F0WA 1TK0A 5ADZA 3CMAS 4Y34A 5A76A 4PG6A 4ERDA 2XCPA 4O0IA 2O67A 3BSCA 2WW4A 2N3LA 2FLLA 4RU9A 2X1GA 3D6TB 5ETSA 1AXQA 1RT7A 4JI5J 2KCXA 1ZM4A 1D8YA 2E9TA 1JLFA 1E6YB 2XB2D 1RWWB 1IWAA 1AROP 5IT9U 4E1PA 1WWHA 3HKWA 3X1LB 3RW7A 4OL8A 1UVFA 1ZA1B 2HFOA 1LWEB 1XR6A 1C1CA 3BYPA 5BR8J 1M5SA 3DLEB 3GPAA 4GC7A 4UOCA 4DUYJ 2HBYB 3IR7B 4IRDA 1TL5A 2GZOA 3HF5A 2X3DA 3W66A 1NZAA 4DEZA 1YP4A 4F36A 4MTPA 1AT1B 3VHQA 4LF4J 4L73A 4D3HA 2GKRI 1IKXA 3MR5A 3LPYA 1FVQA 2ROPA 2IHR1 2V67A 5K8PA 3VR1A 4JI1F 4ZOSA 3QMQA 4XDCA 1XMOJ 3BZQA 3I55S 2C22A 3AB2B 1UPMB 3GJRB 1KQSR 3JSYA 5DQIA 4UOHA 1HBNA 3MM5B 1U7LA 3VVTA 2Z4PA 3IWXA 3EUNA 1X4BA 2G4BA 3OSPA 2KO1A 2H65B 3VQTA 4ILLA 3CCJS 1RT3A 2XGQA 4X4PA 3D6HB 4HCQA 1FJGJ 2GIRA 3B4MA 3W61A 2ZHOA 1T02A 2UXCJ 1HPTA 3TUPA 4DSIA 4C8OA 3G6XA 4OV6A 4C8MA 5ITHA 4UZBA 2UV8G 2WB4A 1T03B 2W2MP 2C2ZB 1KQGB 3QGPA 5HMYA 4DG1B 4EABA 4ZVGA 2QA4G 3DRRB 2J0WA 1ZPWX 3AODA 2GCFA 3KDOA 4IFVB 1LKZA 3N5BA 3OL0A 2Z2ZA 4OZ2A 2YWEA 4KH1B 3PHTA 2P9EA 2J7KA 1F0XA 1N88A 2W9CA 2B7CB 2GKVA 3R97A 1BHNA 2BJDA 2WLDA 3FSYA 1I1GA 2ZBQA 3PZPA 4ES2A 3Q2TC 1FJCA 4LREA 2GAHC 2HS4A 4ZIVA 2DH7A 1BQMB 1KLMB 1VLYA 5CYQB 3TV0A 4S0MA 1SJQA 2VPZB 1TR0A 2IU8A 2CQDA 4O44B 3POTB 3H4DA 3IGNA 2MY8A 3FGVA 3FQKA 3UNGC 4DFPA 1FE4A 3EXCX 1PYSB 2VBZA 2IY5B 3K8WA 3QYYA 1KRVA 1GXLA 4DNCA 2CPDA 3MHYA 3V81A 2YPYA 1VC6A 4MIWA 3N01A 2EG2A 2JNJA 3J81Y 3ITHA 2LXUA 2CJQA 1R89A 2E5JA 3PYDA 2UUAJ 1QRMA 2N82B 4ZCKA 4J7CA 5IT0A 2CNLB 1CT2I 4RW9A 2FVRA 2D69A 2LQBA 4ATNA 3ZNJ1 1JLAA 4C11A 2GHWA 3JSRA 2LKZA 1BE4A 1C0UB 3H8YA 1UA1A 1MN7A 3H2UB 4HL9A 1H2VZ 4RW4B 3BSOA 1B99A 2SGFI 3FSBA 1RA7A 3QIPA 1UPPA 2QSFA 2ZFHA 1FK9A 2AJ1A 4U7CA 4DV3J 4QYZK 4FYXB 3BGRA 1DZ5A 2UXBJ 3T5HA 2NS1B 4X62F 2AT1B 3SMZA 4HZDA 5KOXA 3C15B 3AAWB 1H38A 5KFYA 4F3MA 1KQAA 1GXUA 3RJMB 3NOGA 3K5PA 2GVIA 3MAQA 1FA0A 5I3QA 2HGNA 4USMA 4GO5X 4K4YA 1NLKL 4OHXA 1G1XA 4B3TJ 3I82A 2HHPA 4RW7A 7WGAA 3BGLA 2V0JA 4Z7YA 1DFDA 5LXRA 3I0SA 2VFTA 5DAEA 4IHFA 4MPIA 4LBIA 2SGDI 2HQCA 4LR8A 4C98A 1CQNA 4NLQA 4CP5A 4FYVB 3V5RA 2DGVA 1F9HA 2VFRA 4LFCJ 4DV0F 4RL1A 1QUVA 3UDCA 2QL9B 1X4EA 3PIOQ 1NSQA 1I6JA 2MGZA 4F50A 3P5TL 2RDDA 5KFGA 2B43A 1B4SA 1P6TA 4NZ0A 4RW6B 1KVKA 2DHXA 3QGIA 1TUSA 2KYXA 2M4MA 3VAFA 4M95A 2PT0A 1KTQA 4FBUA 1T7PA 3NAHA 1HBMA 1OO0B 5ETLA 4JBCA 1RU1A 2APOA 2J9EA 5JXSA 1EKRA 2MLZA 3ZZ0A 4WIQA 2ZOGA 2ZNZA 3BFPA 1XX6A 1SKRA 1UUCA 4PUOB 1WGTA 1Y11A 4I2QA 2K1RB 1KRUA 4O0NA 1UVNA 3MOJB 4WIIA 3NGSA 3MC4A 2PSZA 2WLEA 5LMNJ 3CJRA 4M5NA 1KMAA 5KG6A 2E7XA 5L1KA 3O6QA 5K8NA 3DRSA 1IKWB 3ZNUA 1RAAB 4X4QA 5IXUA 2M5YA 1UVJA 5JHWC 1TKXB 2HVDA 3J81U 2F4VJ 3BRKX 2GO9A 2MEWA 2LDIA 2AYBA 2WSFC 3ET6A 2CKWA 4LF5J 1KKHA 5HVGA 2ZZNA 2ZNYA 2M70A 5KFPA 2JH3A 3D1QA 3NL0A 5H9EK 3OTZA 5F3TA 3ISND 4DR6J 1SJRA 3QAEA 3UR0A 1G4CA 4CLYA 2G1HA 3A3PB 3U27A 4Q43A 2BBEA 2CIMA 1MWYA 1N5QA 5F8HA 1GX5A 4IFYA 1QM9A 5ADXV 1FFWB 3PIPQ 2K7JA 3DLGB 4DSJA 4DUZF 3QT8A 2PI4A 2CPEA 1X9MA 1WEZA 4F26A 4F04B 2HVHA 3VAKA 4LBHA 1H0HB 2YNGA 4DS5A 1K1QA 4M1KA 4C3LA 3H90A 2ZEJA 1EP4B 3KK1B 3QIDA 2CRLA 2UUCF 2EEYA 2IC7A 3I56S 2WLCA 4R5PB 1YZ6A 2V0NA 3GIIA 2AGPA 1N0UA 2OMOA 3AFGA 1PJ7A 1DY3A 4EO8A 1WKXA 1DAXA 3GJTB 4CYUB 2J8SA 1QRLA 2MB0B 4TY8B 4RUBA 2ZKUA 5IWAJ 3F0NA 2UVRA 4ECZA 2B9EA 3ZZUA 4MIAA 2RUGA 4LBPA 3ZTPA 5CXTA 4N69A 4LVOP 3PV8A 4LF2A 4CQ1A 2GHVC 3DGPB 4U9RA 4RNNA 4BS2A 5KFBA 4DPXA 3CCZA 2DJWA 4QW8A 4B17A 4KKOA 3EVOA 3ZXWA 1S1XB 2W4PA 4A24A 2ADCA 3O3LA 1HBOB 1CC8A 4I6YA 4BCAA 1Y3KA 3V4EA 2QE5A 1CT4I 4R0JA 3ZTOA 2BJ7A 4J9QA 1UWAA 3N5FA 4P2SA 2DEIA 2XM3A 2HAFA 4HEA9 2UVVA 4DL7A 3MEEA 3NP5A 3GV7B 1Q5YA 5B0DA 1ULNA 2KJWA 2YNHB 2B9XA 4B08A 2KB2A 1T3OA 4USHA 1YJRA 4M9CA 2Z56B 3H5SA 3FBEA 2HNYA 4Y2IA 4IQMA 1JLGB 2BA9A 2JFDA 3GR1A 2NSBA 4TQSA 4WU3A 1MJ9A 3VQSA 4CLKA 2ZBCA 3VBKA 3VNPA 3QGHA 1FT8A 4K4SA 3ZC4A 1G2EA 3D7SB 3UEYA 3M2RA 2AEMA 1KBRA 2ZH7A 5CH7B 3IBCB 1TOTA 1F2HA 1ITPA 1TIHA 2LU1A 4KIAA 1RT2B 2ICXA 4KT0C 2XYGB 3D00A 4WE1B 4YHHF 2MKCA 4KPYA 4DPTA 2H48B 3IFEA 3FOQA 4B9UA 2R7WA 3RAQA 1KS2A 4GVLA 2I2YA 4ZPAA 5IC6B 1JXEA 5F42A 4XO0A 2HIYA 2IRUA 2UUBF 2EKNA 1HHTP 5KFOA 1T11A 4QZVB 3AB4B 2ZM6F 1X74A 1SVDA 2HRTA 2B0UC 5LT5A 1EETA 2BE2A 1Y8FA 1H2UX 1M5VC 3MR7A 1FDBA 3P3DA 4WK1A 2JZ5A 3H20A 1DQAA 4OYZA 4UZCA 3I4HX 3MCSA 3HT0A 3VZHA 2D3OR 4O3NA 3V6HA 5LMUJ 2FHKA 1DQ8A 1Q16B 2I1RA 2IDLA 2YWKA 2JOQA 4HUSA 2UVOA 1RBOB 2F65A 1RKIA 5KFWA 1QE1A 3KDNA 4MK8A 4EBDA 4OZJA 4I64A 2LU2A 3CCRS 1R8CA 1RHRB 4HTJA 1S9GB 4OJ1A 2IPOB 1OYVI 4JYAJ 4B9MA 4R25A 1I94J 1FJ7A 3LP0A 1N32J 1U5KA 4CTAB 3GQAA 2XCAA 5KTQA 2MZSA 2FQQB 5IQQA 2QMWA 1AA1B 2DNRA 3TUZC 1RTJB 3HCXA 1L3UA 1BMOA 4HR2A 2W0WA 1QSSA 2GJ2A 2FB0A 2CDQA 2DGOA 4NLRA 1FKPA 1N4LA 2HIQA 3BJIA 5KFCA 1SBRA 4WWSA 2X1FA 1PC5A 2FTRA 2JW6A 3K5LA 4TLQA 4M98A 3L4BC 1LW0B 1KRRA 1KQKA 1Z2ZA 1IKVB 3L7OA 2EVZA 1REVA 4OQJA 1PTRA 1CS4A 5KFVA 3KK2A 2CDRB 4J9UE 4ANEA 1HI1A 1B0TA 3CDAA 3IBFB 5GMDA 1S59A 1UVMA 2VG7A 4GI3C 2DT9A 4NZ6A 3KLIB 2V8GA 3DDNA 5D6GA 1H7XA 5FLXY 1GMVA 1U45A 5CYMA 1ACMB 5BR8F 3UDEA 2E7VA 3AA9A 2CJYB 2R7VA 1RP5A 4DUYF 1Y00A 2V34A 4LF1A 3BR9A 4U67Q 4KTQA 5CD4H 5HLFB 4WK3A 3TR5A 3DFEA 3TDTA 1B70B 2MQPA 1OYEA 1T94A 4K4VA 1FE0A 4LF4F 3TP2A 2LFVA 2M88A 4G3QA 4NPOA 1OYDA 1YU6C 4I69A 1YBAA 4U6PA 2RT3A 3MPWA 2R7OA 5AJ3J 4PWDA 4URSA 1XMOF 3CMQA 3HHKA 2I9SA 4IDKB 3MMAA 3LP2B 4AXIA 1IQTA 4R0EA 5KT6A 2DNOA 1WKKA 3R5DA 2IVMA 3H42A 2ODDA 3BKTA 2HWTA 3IXCA 2XSFA 3A3NB 4UQGA 3NWGA 1FJGF 4RZRA 3CO9A 1V6HA 4DCJB 5C42A 2UXCF 3CDBA 4LSLB 4YR0A 3HH2C 5D0HA 4EO6A 4WFXA 4FKDA 1Z1ZA 4CLZA 4C8YA 1B64A 4K4UA 1R27B 1HQEA 4PG7A 1YJVA 3I31A 2WTFA 1GXTA 3LPEA 4ZHRA 5A8RB 5GADU 4EYIB 2OAUA 4X4RA 2VZ9A 2OUGA 2HVIA 1JWWA 2J0SD 3F73A 1EKSA 4XK8C 2ZZTA 5F8IA 1U0SA 2EFNA 4F4WA 4XIUA 1DRZA 3O5TB 3DC2A 3C2PA 2AHOB 2ZH5A 4P52A 3DLJA 2RDIA 3QSIA 3W2VB 1YVFA 4DL6A 1O8BA 1XBWA 4ZPDA 3R2WA 1BQXA 4FYWB 2BDPA 1EQ0A 1E6YA 3NBPB 4YMEA 1OY9A 4E98A 1S7HA 1WC5A 1IJFB 4Q2MA 2AJ0A 3QRPA 1S1UB 1RHKB 1LWEA 3OFHA 1HJAI 1NK7A 4OJHA 1ZYQA 2ZH8A 2UUAF 1KLNA 1IR1A 4J9PA 1C0TB 1S97A 2Q1LA 4DJBA 1NKBA 3KLHB 2E29A 3CDUA 3P1BA 5HANA 2CPXA 3S6EA 3RB3A 3DXSX 4QJVA 3GU0A 5KT5A 1JKHA 3JQKA 1HQUA 2ELIA 3OHAA 3W8GA 3QGGA 3VBPA 1U1LA 1PTQA 4Y2MA 3KMSA 4BC7A 1FD2A 3MM5A 5KFSA 3HSGA 2UXBF 2HBZB 5L38A 3DDIA 3RRKA 2EC0A 1RT4B 1YP3A 3M4XA 2QLWA 2CUYA 2Y3YA 2FJDB 3I32A 1VQPS 3DRPA 3H2VE 2NUUG 5L8RC 2KMQA 4DSFA 4P2FA 2VV5A 1FX2A 3MI7X 4PWUA 1T03A 1AFIA 4DG1A 4L75A 4DDFA 4NLSA 1HA1A 3DRRA 3SZ2A 2HRUA 4IFVA 1NDPA 4B3TF 2ARPF 2F8HA 2ROGA 1S20A 3E3XA 1G6BA 2B7BB 2LQ8A 2KKHA 3IR6B 4ZVQB 5KG4A 2ENZA 4ECYA 4B9LA 5B7WA 2D41A 4NCGA 3FMWA 4ZVSB 3R7BB 2WONB 2R2SA 1MROB 4N41A 2MZRA 5D4LA 1BQMA 1KLMA 1RWMB 2GQ2A 1X0FA 2VONA 1SSQA 4O44A 3POTA 1YJ9S 3FFIA 2XGPA 3CD7A 2HLTA 4LFCF 3KHRA 2P2OA 2AD9A 1VQLS 3TO6A 1VQNS 5C24B 2RF2A 4PPZA 1F60B 2H9ZA 1W2IA 4ED8A 3S7RA 5B0GA 1C1BB 4N8OA 4DQSA 3AD7C 1MR9A 3PDNA 1PC4A 2H5JB 1M1KT 4KHPJ 2V9WA 2WLGA 1RB0A 3DLLQ 4H54A 4IG0B 5LM7E 4B9VA 2H4WB 2OPPB 2K06A 2WVBA 1IN0A 3EH0A 1HEVA 5KFNA 1PG5B 2NZCA 3KMQA 3O8WA 1NK9A 2GFFA 4HHHA 3A13A 4YEAA 3VAMA 3GYNA 1UFLA 1NJIT 1YITS 1MJBA 3GCWP 8RUCA 2GMJA 4DXLA 3KYLA 2QO3A 1RWUA 4OJ3A 2IC3B 4RW4A 1IQZA 3AD9C 2KXHA 2ZD1B 2VOPA 2V5HG 2DNQA 4IH5A 4F0KA 4QPTA 2YKQA 5E33A 5LMNF 2R42A 3ZTRA 2RQMA 2I8EA 3KHGA 5L1IA 3Q86A 1SSTA 3OW5A 2HVZA 2RHSB 1V3WA 3TA0A 4N6AA 4NI2B 3HVTA 4FP9A 3C15A 1K1SA 4JV5J 1VCTA 4LF5F 1S1WB 2QRRA 3QSYB 1MW7A 2HS0A 4ES3A 2V0HA 1A0OB 4OZ3A 4A48A 4U95A 4N76A 1DARA 4DR6F 2KYZA 4AQYJ 4DWIA 4M5DB 2F40A 4FXDA 4WP9A 2XLKA 2U2FA 3KWDA 1BUSA 3IN5A 4FCEA 3GWCA 4PKDB 2SGQI 1KP6A 2ACMA 4DPWA 2LYVA 2YKOA 3SSRA 5B08A 1HYSB 2UU9J 1OMTA 5IS2A 2HFNA 1IM4A 2GQCA 3NZ2A 4XTTA 3T1HJ 3PX4A 3JXOA 3IS9B 2C3OA 2KHDA 2AW0A 3CUNA 3TYTA 5GADI 2KTQA 1VR6A 2AU0A 3D4JA 5B0AA 3J80Y 4RW6A 1SPBP 3E8OA 2QEXS 5KG0A 4ZKAA 3OVAA 1M5PC 1LWFB 4EEYA 2B56A 5IWAF 3FC9A 5HQ8A 4OV1A 1HR0F 2JEFA 1EWWA 1RAOA 1VMBA 1IBLJ 4W92B 2DITA 4AC3A 3OH3A 2KVQE 1JK9B 2VODA 2KM8B 1ZZFA 4F8RA 4PUOA 5CCMA 4PRFA 4K4WA 4IG3B 3ZO7A 4KV8A 3T5LA 2CQ4A 3A8IA 3OFEA 1SUQB 1T9YA 2CYYA 3ISZA 1VLOA 4A8SA 2CNOB 4GO7X 2CZVC 2VQEJ 3W5ZA 1IKWA 2CWKA 2YNIB 3Q8PB 3WQPA 1X5TA 1Y1CA 1HHSA 4DZDA 3G2XA 2HQIA 1SQGA 1VQ4S 3EXYA 2FPHX 1O0PA 3U1MA 2PD1A 1SGYI 3G6VA 3HFKA 4MYTA 5E5NA 4YR2A 3US5A 4NEYA 3DOKB 4OIXA 1ZBTA 3G8TA 2KFZA 4FPIA 2BKOA 4KJIA 2MLXA 2CADA 3FQLA 1X4AA 3MUMP 3LP1B 2BKNA 1GMWA 2IRXA 1VQOS 1S1VB 3MPUB 2DXEA 2NXCA 3M8QA 4LF8J 3D3BJ 1HNVA 4FZVA 1JNZB 2A10A 3B8HA 3I5AA 1X0PA 5KFMA 3AD8C 3AJ2A 1CPZA 3TJQA 4NLPA 4ZPVR 3HVWA 4ALZA 4G3SA 1U26A 3VALA 1HV9A 5LSLA 2FJEB 2CFXA 4R5PA 2QFJA 3G96A 1T9VA 5D8HB 2Q6CA 4NE9C 1FARA 5F8GA 1XHDA 4J9LA 4CYUA 1TVRB 3VCDA 3OJSA 2N17A 1VQKS 1U47A 5CQGA 4KPCA 3K57A 2OPRA 3PW0A 3MM7B 1FNOA 3W65A 4LSNB 2SXLA 4HVZA 1YJ7A 3M2VA 2VH7A 4AL7A 2YQ0A 1VRUB 2GA7A 5LOQA 4DFJA 2E1AA 3V6JA 4WCEQ 1CJVB 3DGPA 4OX8A 1HM0A 4RW8A 4PAAA 2CG4A 2OP5A 2BJ1A 4QWEA 5LMUF 2HBRB 2GGPA 1HBOA 4ED4A 2EFPA 3TZZA 3UEJA 4DV5J 2F63A 3LOUA 2YKPA 2XI2A 1RHUB 1RAEB 1KGQA 1RT1B 5DDPC 2KMPA 1TP7A 3LGMA 3V4IB 5IV3A 3OH0A 3CCQS 5L1JA 1A9NB 1FNXH 2OGUA 1S49A 2OFHX 1PKUA 1RJJA 4JYAF 3MEGB 1RT7B 1I94F 2YNHA 1N32F 1JLFB 1P9QC 4X64J 1DURA 5D0GA 4M28A 2VFSA 4FS2A 3QPIA 2P6AC 1QAIA 4WF9Q 4Q8EA 2RD5C 2OHDA 3A8JA 1HBUA 5DG9A 3OH4A 3C6UB 1R0CB 1RT6A 2HQ3A 5HL7Q 4WTOB 2QV6A 1QAYA 4PEOA 5D4OA 4M5MA 1OPIA 1WF2A 2IM3A 4OVOA 1G95A 5BXIA 4B9NA 4KO0A 2ORWA 2FIUA 3BXYA 3CCLS 1RT2A 2ABYA 3RAMA 2XY5A 4YFUA 1R31A 4WE1A 4YY3J 4P2XA 2IJNA 2D9PA 2XI3A 2N4CA 4CLWA 4LRAA 4CM0A 2R4FA 4FKXA 3W9IA 4TYAA 4UUWA 1MWQA 2JLEA 4KRWA 2UVUA 3Q89A 4WYLA 1HBNB 3PRBA 4KBIA 2XWYA 3QLHB 2MY7A 2CQIA 3NGRA 3GILA 5DLFA 1KD1T 5D0RA 2GVDA 1SH3A 3FBFA 3NG8A 2DBBA 2FGCA 1W7WA 3JAMU 3RTVA 4ID5A 4DHVA 1Q5VA 3IG1A 5L46A 1L5UA 5C2CA 1KFSA 1MSWD 3AOBA 4N56A 5CAAA 3TAMB 5AJ3F 1T8EA 2KJVA 3RB0A 4ED6A 3CO0P 3EGNA 1WDTA 3MCNA 4NLXA 3MR6A 4RR5A 1HDLA 2ZVIA 2DGUA 4AE5A 3CTRA 1YX2A 2KRBA 1HI0P 1LW2A 2BZ2A 3SCIE 3OTEA 3JQMA 1ZOTA 4N5SA 1N13A 5BYQA 4IR9A 2UXDJ 1MR7A 4OX7A 2YKNB 2VKZG 2E5RA 4JUZA 2B5JB 3RB6A 4UF4A 3AXKA 5IFMA 4CTAA 4EFAC 2XMKA 3U7JA 3MPDA 4IHGA 3QRQA 4DR7J 1YRTA 1S99A 3EVWA 1VQ9S 1FRXA 2Y8WA 1J2VA 1RK8A 4J90A 3GVDA 3KJNB 2FD2A 4E79A 3T1AA 1QVGR 4YN3B 1VQ8S 3OTOF 3VGTA 4ECSA 1OVOA 3HVAA 4QWDA 3VDPA 1QRFA 1FJEB 4LR7A 3NOCA 4WZMA 4K4XA 1LXJA 4RW9B 2E5LJ 4UOFA 3EPIA 1LW0A 9ATCB 1IKVA 2A3JA 2LEBA 2C2NA 4C11B 4QU7A 2HMIA 1V5IB 2RIJA 2N4DA 4DQQA 3OV7A 2V1CA 2QA1A 4PABA 5E2QA 5ETKA 3QIPB 2AP6A 1FK9B 1RABB 4F4KA 4M5GA 2ZJPQ 3H7HB 2SGPI 1X4DA 3T9ZA 1PGZA 3UQSA 3BGRB 3HHNB 4X4VA 2H5IB 2W01A 2M8HA 3N79A 3C66A 5DDQC 2KM8C 2W9BB 3R6GB 4K2XA 2NYIA 4K59A 4YB5A 4OZLA 4DR5F 3SBMA 4C4WA 4IYQA 1F9EB 2J7WA 3R7NB 2UV8A 1JX4A 1F5BA 1M1HA 2DTJA 2DEJA 1DTTB 4IQXA 3TA2A 2GJFA 2ALZA 2YQ1A 1THJA 3L7PA 2W2QP 4ED3A 2K9HA 3VWSA 4AYBD 2O66A 1RE1B 1VBKA 2CA9A 4JI2J 2KG1A 3LP2A 1SKUB 4MK9A 2AV5A 1AN1I 4ECTA 5CHCB 5HBMA 4QQBA 1JJHA 4M5HA 2FJAB 5D77A 2XZDB 3UFFA 3MECB 4O3SA 2B9YA 5DGBA 2MGZB 3ECTA 2D1CA 3LGNA 4NCBA 3V2UC 1FDAA 1HWIA 2X3GA 4ZMMA 2AX0A 3MM6B 4DV6J 2W4DA 1NMEB 3DM2B 1HMVA 1D8ZA 2ERRA 4P73A 2PMZD 2MKSA 5A8RA 1WOOA 3GFXA 2V8VA 4RNHA 5B0CA 1EHWA 3SSSA 3G8SA 4XPCA 5I3PA 2NU4I 1PBUA 2N71A 1HBMB 2DNKA 3T6JA 3JTOA 4ZCMA 3M8SA 1HNZJ 3P4UB 4RJVA 5T14A 3MTKA 2OD6A 2CZ4A 3OXLA 5CZVA 3W2VA 3PKYA 4UOGA 2W25A 4BWMA 2ZE2B 3FRYA 3TWDA 5J8CA 2LA4A 2HKEA 4RUAA 3GR0A 1TV6B 1Y3JA 3SFGA 4MJKA 3ADAC 3DYAA 1X60A 1MNEA 1VS3A 3DXBA 2EWHA 3IWLA 4NRTA 4JV2A 3HO1A 4KHPF 1K47A 3LF0A 3OTDA 4K4TA 1HNXJ 1U8SA 5HMXA 2EG1A 1N6QB 4OYBA 3OL7A 4JI8J 4ISXA 1T0TV 1X8DA 3UCUP 1V5VA 4OX9J 4Y00A 3GOSA 5CZXA 5ETPA 3WIUA 1C0TA 1VQ7S 2KT2A 2OPQA 4E0DA 1HD0A 3KLHA 3AOCA 3GMGA 2E9RX 1RWKB 3ETOA 1QVFR 3DCAA 1S1TB 1UVKA 3T1YJ 2GX8A 1QQ0A 4TU9A 3BH7B 3D5MA 2DGWA 5KFFA 3W8PA 2DCLA 4A8QA 1YIJS 2JC0A 3C8YA 3QATA 3NNHA 4DUTA 3KG1A 3TANA 1RT4A 2QIAA 3HMJG 5DS7A 1J5EJ 3OTBA 4ZJLA 2ZC4A 1OY6A 4JV5F 2MJUA 1NXUA 1TZ0A 3DK5A 1YKWA 2DGTA 2DNMA 2Z8QA 2Z57B 3C19A 2RKIB 4YDDB 3M32B 3PR5B 2KRRA 1F5AA 3GONA 3CJ4A 1N8RT 5DM7Q 5G0RA 4IKAA 3GJSB 2L41A 1TBOA 3TO7A 3P49B 4USIA 2C2OB 2HQFA 5GMKa 2XO7A 3F1XA 3G87A 2ZH1A 2FHOB 2W9AA 1U4BA 3GFHA 4YOEA 4KHRA 2WONA 3QBCA 5H1SV 4PPDA 1A6LA 1XK8A 3H5YA 2UU9F 1KC8T 5E3CA 3T1HF 4DQIA 5AE3A 1RTDB 5C24A 3THTA 4CO4A 3I3XA 1NAQA 1QRGA 3HSZA 4P75A 4OZ5A 1AW0A 3VAIA 1XN9A 5ETQA 5ETNA 2CZ9A 2GKTI 4DV4F 2AIRB 2R7QA 2HG4A 3CF5Q 4FF3A 3V6DB 4IG0A 5F8NA 4IO9Q 3C46A 3DMJA 3K7RA 3KG0A 1W3SA 2O5DA 1IBLF 1PJ6A 3A12A 1SV5A 2HHSA 1ZS6A 2W2NP 4DSEA 2OI7A 2PC6A 3MUTP 3CCVS 1T05B 3RYLA 1RKJA 3ZTSA 4URGA 3NY0A 2BV3A 3M8RA 5DQHA 2IC3A 2K7KA 1REGX 2ZD1A 3ILIA 5THWA 2VHGA 2V4QA 3IAS9 2E5IA 3P8BB 3IMQJ 3KFWX 1FRKA 1TL1A 2OFGX 2KMRA 2F1FA 3VAHA 4F0MA 3RAXA 2OD4A 4HKQA 5T41A 2VQEF 4RNFA 5D4NA 4TNOA 1SB6A 1UJ4A 5CA5A 1EIYB 5U2KA 2A2DA 4QIGA 3KTQA 2OI5A 1M5HA 2MDAA 2M0GB 4PXEA 5KG1A 2ZH2A 1RBLA 1FESA 1S1WA 2LLZA 4OI1A 3X3UA 2EW9A 2HZAA 1NXIA 1OSDA 2DNPA 5B0EA 2M3DA 4M5DA 4O3PA 4C0OC 3BGUA 1Y1BA 1R6VA 3ILLA 3MQHA 3UI3A 3I9V9 3OSNA 1APSA 3BJYA 4TVAB 3G71S 2DNGA 3SQOP 2V2KA 4I7FA 2XSJB 3QJLA 5C7PA 2BE2B 2F9DA 3OLAA 1URNA 2Y8YA 2YY3A 3WZ0A 3W60A 3CC4S 4LF8F 2P8IA 4ZVUB 4ELUA 1QD1A 1HYSA 2CQ3A 1R8PA 4C0BA 2XHCA 1F3FA 3IS9A 1OQ3A 3R5AA 4AAWA 3SGQI 3UD5A 2N52A 2M52A 5I42B 5T7LA 1RHMB 2OLWA 1QE1B 3G6YA 3TNVA 2KH9A 4WBFA 3R1WA 4J9OA 3D6MB 4ER8A 5ETTA 4ICLB 4HZCA 4TKTA 4OYIA 4YUDA 4K4ZA 2MQOA 3LP0B 4CO2A 3PVXA 2OEGA 5KG3A 2QLBB 5IT9Y 3GIKA 2BX6A 4ZJOA 2E66A 1Y5NB 1S5ZA 4JI3J 1UW9A 4YB6A 3HI9A 1N36J 5GVQA 4USVA 2YWFA 1JJCB 1H6KX 3BGFA 2MLYA 4E1KA 1NK6A 2JZMA 3OVSA 4PG5A 3SCKE 1SL1A 1J2ZA 2YBVA 3RU0A 4DI6A 1H98A 2YKAA 1U1NA 2CJXB 4AL6A 3BKUA 4EWTA 2OTLS 5HK4A 4X64F 2QMXA 2Y1LB 4DL2A 2RH3A 3PX0A 3B6BA 1IR2A 5HSPA 4JOUA 4G87A 3SV3A 3M6UA 2DO0A 2GHPA 4ZJQA 1RWOB 4LT6A 7AT1B 3TAPA 3JSMB 3MZIA 4GVBB 3LWLA 3HLUA 1R8HA 1AYEA 3LP1A 4AD6A 1YLXA 1FXLA 3FBBA 2V2VA 1CJUA 1KOOA 1ZM2A 4YY3F 3OR2A 1TELA 3CULA 1U1KA 1HQ2A 2JX2A 4FXVA 3PG9A 2IJRA 5KFTA 3NXZA 4AMLA 3CD5A 3RR7A 2GIQA 4LF7F 4PWDB 4LQ3A 1N54B 3T9NA 3MEDB 1SXLA 2VU5A 2VASA 1FO1A 2LUYA 2VG6B 3UGIA 3SGBI 1LOUA 2X51A 4QPXA 1WD6A 3MMAB 3R2DJ 1YRXA 2WCYA 4MFBB 4CWBA 4ES1A 3F56A 2MKYA 3K2YA 4WXOA 5FD1A 1HW9A 1R0RI 4BHQA 3DDKA 3Q8SB 3UCZP 3MM7A 1RACB 1BC6A 2NZ4A 1M5OC 3BDPA 4LSNA 1SJFA 1JJ4A 3BSSA 5DJBA 2DRDA 1HQEB 1SGPI 1CJVA 1GEHA 1HWUA 1R0BG 1TL3A 1Q82T 1RBAA 2DY9A 3N6LA 4Q8FA 2HGMA 3KJFB 4FS1A 4ZS6A 5B0FA 4WTYA 3E01A 1PYOB 1ZPVA 4CIOA 2VB6A 3EGZA 3TVYA 2QA4S 1WKLA 1CE3A 3OBIA 1D9FA 4HI2A 3GP9A 2HHQA 2VC0A 2BRLA 1TURA 1RT1A 1YWXA 4HLBA 1WNEA 1JLQA 3EGWB 4B3MJ 3V4IA 2P5VA 2BXJA 2N7CA 2NU2I 4TLRA 3N0VA 4NLWA 4JV1A 4EGLA 5F8MA 2WAQD 3MEGA 4AFFA 3RBXA 2HHVA 3EDRB 1CSOI 4H4MA 2IM0A 1ZM3A 2IIHA 2ILYA 3PYFA 5AXLA 5HMZA 2OI6A 2QQDA 4Q44A 4DR7F 4MZUA 2E1PA 3M8YA 4CT8A 2B6AA 3OU9A 3FWWA 3C6UA 3VBLA 3N6MA 2FHMA 2HHUA 1FEEA 2RJZA 3TWZA 2HHTA 1K0VA 1W26A 2MQLA 4G1QB 3BKFA 4QBUA 4QR1A 5HROB 3J7Z5 2OZUA 3LALA 3VVUA 4NEZA 2VQFJ 2JEGA 1KK4A 2ASLA 3B82A 3U1LA 2FJWA 4Q0BA 2E5LF 4FBTA 4OMFG 2L9WA 1WOSA 1CJTB 2JHEA 3IR5B 3NLCA 5KT4A 2IRYA 3PRDA 2KFNA 1JLCA 2OD1A 4GRSA 3QO9B 5J1EA 1JKHB 5F3ZA 4H7OA 1HQUB 4YQWA 4EI2A 4A4JA 4ZP8A 3CXLA 3BPSP 2LMIA 4FXWA 2JLGA 3I0RA 3QLHA 4LFBF 3TOBA 3RR8A 3GE9A 3R5BA 2VL1A 4RWWA 3NAIA 2Y9HA 2Q6BA 4ZVTB 4NXMF 2XY6A 3DRPB 1SH2A 2B4OA 2R8JA 1S9EA 1NB7A 3M8ZA 2NPOA 4PXBA 3R3IA 1IJEB 3W7BA 4L76A 4G65A 2V0LA 2JDJA 3R7SB 4OX6A 1WG1A 4LFAJ 3TAMA 1B0PA 3IRXB 4EUVA 1L3VA 2KZMA 4NCGB 1DS2I 4I0WA 1FFSB 3F41A 3FFIB 4V19X 4M5LA 2VBWA 2DGQA 2YKNA 2XATA 2B5JA 3OL6A 2J7UA 1HW8A 1OSCA 3CJSA 4CO5A 3PY8A 2RF2B 3MWBA 4KR0B 4LRDA 4DV6F 3OTMA 1FRLA 1XJWB 3HHLC 1F2GA 3DU5A 5LSOA 4RO0A 3IGJA 2QQEA 2DCUB 4Y0FA 2JSXA 2FZCB 1UZHA 3LQVA 1H2TZ 4DR2J 4NMLA 1S57A 1HNZF 1ROFA 2WVFA 4ZCLA 2B3TB 4DR1F 1NU4A 4FYYB 1YJTA 2IVYA 1GAOA 2GQQA 1K9MT 5FUXA 2XYPB 2Z30B 1U24A 1W25A 4ZLLA 5E7OB 1SJ1A 4O3OA 4RU2A 3FEXB 2O3DA 5HJXA 3CCWA 2WW8A 4ECUA 1S12A 4CNYA 4UY85 4I6WA 1QSLA 3M6VA 1NK4A 5I4MA 3VBIA 4JI0F 1NJYA 3PFOA 3SCJE 3QZ8A 1PYTA 3UE2A 1KN6A 1VBXA 1HNXF 3GLJA 5E0OA 4JI8F 4ELVA 4XPEA 2W9BA 1NZ8A 4DOZA 3HVTB 4KQLA 1T95A 4OX9F 4RKUC 2V2ZA 3JSBA 3TARA 1YI2S 4KHMA 3BN7A 1QUPA 2FZKB 5AXMA 2KG0A 2U1AA 5AE1A 1LK7A 4ED5A 4WFBQ 1MLAA 3VDUA 1XA6A 3FNNA 2YQPA 1DTTA 3GV5B 2QN6B 1YQHA 2RDJA 2B51A 3R1HA 1S0OA 1UFWA 3VE5A 2DR8A 3AT1B 3OR1B 2CWFA 1RXOB 1XR5A 1VI7A 2HQGA 4LIRA 2PGCA 4NMXA 1HNWF 4P71A 2DGSA 2R2UA 1C2PA 1WG4A 4NLVA 4CCHA 3EVMA 2FHJD 1J5EF 2A20A 3MECA 4CH0S 5KFIA 2WOMA 1OS5A 2V68A 4OJGA 2VA2A 3FSIA 2RUSA 1CJKB 4L74A 3MM6A 1R43A 3LO3A 4JP8A 3DM2A 1WGCA 3AA8A 1R6YA 1JXVA 4NLTA 4I68A 4A8OA 3UGDA 1Y0HA 1GFWB 4Y3CA 1VYAA 2G0IA 4EA8A 2WK4A 1RTIA 3T6BA 3GTYX 2V69A 1XWLA 2YVSA 3HFVA 2Q79A 5KFKA 3I5BA 4K5SA 3QTLD 1VIOA 4HHUA 1LR7A 3SRTA 3Q24A 1WC6A 4ZPWR 1KHVA 2DR5A 2ZE2A 1X4SA 3HSJA 2Y0SD 1RHJB 3K8VA 1R0AA 4KV8B 2D3O1 1TV6A 4NRUA 4ANCA 3ILJA 2V2QA 3PW2A 4HI1A 3R8YA 4OHYA 1KVIA 3MD1A 3D8VA 2W24A 1RA6A 2RRBA 2AGQA 2KI2A 2F8EX 4UTGA 3FKBA 5C25A 4L3NA 1N6QA 1KK6A 1FKAF 4Y28C 1NHKL 2QKXA 3NMAA 1JQGA 3M9NB 5M2PA 4E6UA 2E73A 5JJBA 3HM9A 1PSDA 5H9FK 4NZ7A 1NSKL
chains in the Genus database with same CATH topology
4R36A 4DN9A 2A10A 2GC8A 2EFVA 5A6WA 3SI8A 3B8HA 3I5AA 5AFUU 5C42B 1WTBA 1X0PA 1VC5A 4IRKA 3LW5C 5KFMA 2M2BA 4G1PA 2E5GA 3AJ2A 4WU2A 4QU6A 3VF0B 1C4CA 3MDFA 1LWCA 5LL6d 4EBCA 4MKYA 4O4GB 1CPZA 2IVFB 5IM0A 4NLPA 1S1TA 4AUKA 3AHPA 4ZPVR 3HVWA 4ALZA 4G3SA 5B09A 3CXCR 2IAJA 1U26A 3VALA 1HV9A 5LSLA 2FJEB 2CFXA 5J2NB 4RNOA 1VRUA 3W2WA 3G6ES 4R5PA 2QFJA 4A8XA 4XDDA 1O5JA 5C25B 3I6PA 3G96A 5D8HB 3C6TB 1YRUA 2NR0A 2Q6CA 4IO1A 4J9MA 1O51A 4QIVA 4EZ9A 1VOMA 5F8GA 2CJ9A 1WF1A 2E1CA 2DIVA 4OZ0A 5CCLA 3DOLA 5DDOC 1XHDA 4ZHRB 4J9LA 2JVRA 2XEXA 4I1TA 1TVRB 3VCDA 2E1MC 4G1IA 3OJSA 5F9NA 1VQKS 2TDTA 4EGGA 1V3RA 3GB0A 1U47A 2G0CA 3BO4A 4TN2A 4C8NA 5CQGA 2FJXA 5DO2A 3K57A 2OPRA 1TDTA 5F0WA 1TK0A 3M8QB 1DTQA 4Q0BB 3PW0A 1HNVB 3MM7B 3FTTA 5ADZA 3CMAS 4FPRA 4Y34A 1FNOA 1VGYA 2NPIA 5KT7A 4LSNB 2SXLA 3DLEA 2J9CA 4PG6A 1LWCB 4H4OA 2ZH6A 4ERDA 4HVZA 2XCPA 1TAUA 4O0IA 2RSQA 1UMJA 2O67A 4DV2F 2O1PA 3M30A 4OLOA 3M2VA 2VH7A 5H9FJ 2R7UA 1FTRA 3BSCA 2ZHAA 4AL7A 1VRUB 2GA7A 2N3LA 2R8GA 4DFJA 4RU9A 2X1GA 2E1AA 2FLLA 4OI0A 3BM7A 1Y7PA 3IO1A 4WCEQ 3V6JA 2RKIA 3DGPA 1XERA 5H9EJ 1AXQA 1HM0A 4OX8A 1RT7A 4RW8A 1ZM4A 2CG4A 2CQ0A 3M32A 2OP5A 1D8YA 1JLFA 2E9TA 1E6YB 4QWEA 1V9OA 2AWZA 5LMUF 2EKYA 2XB2D 3WBZA 1AROP 2GGPA 1HBOA 1L3KA 1JB0C 4LQ9A 2EFPA 1MU2B 4X84A 2XBPA 2DO4A 1WWHA 4DQPA 3HKWA 1M5KC 5L6SA 2VD3A 3X1LB 2OPRB 3LOUA 3RW7A 3N4WA 4P6QA 3M9MB 4OL8A 1Q4RA 2HFOA 5HI7A 4F67A 2YKPA 2XI2A 1LWEB 4K50A 1KSPA 5JVGQ 1KGQA 2O01C 1RT1B 1XR6A 1X4GA 2EFQA 1C1CA 5DDPC 1M5SA 3IXQA 1TP7A 3DLEB 3LGMA 4FVMA 3MUVP 3V4IB 1M90T 5D4PA 1TQLA 4UOCA 3CCQS 5L1JA 4GC7A 1A9NB 3M30B 1FNXH 1X7VA 3M2VB 2XNQA 2CPYA 3TOQA 4C8LA 1Q7LB 1S49A 3IR7B 4IRDA 3K5MA 1TL5A 4ZP7A 2OFHX 3HF5A 4DLEA 2KXNB 2ZH4A 1RJJA 1NZAA 4JYAF 4DN0A 4YB7A 2G9OA 3MEGB 5KFUA 4RW8B 1RT7B 3S1TA 1I94F 2YNHA 4DEZA 1N32F 1GTEA 5D78A 1JLFB 1P9QC 3ONQA 2R2TA 1YP4A 3D28A 4R37A 1U6BA 1DURA 2V4JB 2EFGA 4M28A 4MTPA 3DRXA 3HP6A 2VFSA 2GGPB 2GGQA 1AUDA 2WCXA 1D0EA 1U09A 3QPIA 4FS2A 4B9TA 1RTDA 4LF6F 4D3HA 3KKFA 4AQYF 3KWEA 1B0VA 5AXNA 2OH2A 1QAIA 1IKXA 3MR5A 4WF9Q 1MWZA 4Q8EA 3LPYA 2RD5C 1SL2A 1FVQA 2ROPA 2IHR1 1GTHA 2AF6A 5K8PA 4NLGA 3VR1A 3T5KA 1HBUA 1HWLA 5DG9A 2C3PA 1BY9A 3C6UB 1IBKF 4WKRA 4JI1F 4F4XA 1RT6A 3R5CA 2LVWA 4ZOSA 2HQ3A 1CLFA 3QMQA 2P6SA 4XDCA 4MFGA 5BJRA 5HL7Q 5GAHU 3BZQA 3I55S 2QV6A 2IM1A 2C22A 1QAYA 5D4OA 1OPIA 1WF2A 3AB2B 2XS5A 1KQSR 3JSYA 5DQIA 2IM3A 5EN1A 3BSNA 4ECVA 3L09A 3V6DA 1HBNA 3MM5B 1N5VA 4MKAA 4Y2AA 4NCAA 3CGIA 1G95A 1U7LA 2Z4PA 2XLIA 3IWXA 2IA6A 3D98A 3EUNA 4B9NA 4KO0A 1X4BA 1S6OA 2FIUA 2CQGA 2G4BA 3BXYA 3FVYA 3CCLS 3A1YG 3OSPA 4PQUB 2KO1A 1RT2A 4X4TA 2ABYA 3RAMA 2XY5A 4YFUA 1Z4UA 3L95X 3VQTA 4ILLA 1R31A 4HT7A 3CCJS 1ZETA 4WE1A 1C4AA 1RT3A 4TY9A 2EBGA 2IJNA 1BQNA 4X4PA 2XGQA 4HCQA 3O1LA 2GIRA 1J5OA 1S0VA 3B4MA 2D9PA 4B3SF 2XI3A 3GYXB 5FJ4A 2ZHOA 1T05A 1T02A 3CT9A 2N4CA 4K5RA 2R4FA 4DSIA 4C8OA 1HBUB 3G6XA 2XY7A 5CYQA 4C8MA 4TYAA 2POKA 5ITHA 2UV8G 3N9UC 4ZPCA 1RT6B 1OWXA 2WB4A 4UUWA 1T03B 4Z2XA 3BB5A 2JLEA 2JJ4D 1KQGB 1X9SA 2D7SA 3MM8A 3QGPA 4DG1B 5HMYA 2D9OA 2YWGA 4KRWA 2UVUA 4EABA 4TXSA 4ZVGA 2QA4G 2VOOA 4WYLA 3DRRB 3ZZYA 2J0WA 1ZPWX 1HBNB 2GCFA 3FEYB 1U1RA 3PRBA 4IFVB 5B0BA 1LKZA 4KBIA 1YJNS 3N5BA 3OJUA 2XWYA 4KO0B 3QLHB 2MY7A 3JYTB 2CQIA 4RUCA 3MXHP 2YWEA 2QSWA 2XNRA 3PO4A 2P9EA 1FHTA 2J7KA 4YP3A 1F0XA 1N88A 2W9CA 2IU9A 2B7CB 3RRGA 2AX1A 1HWKA 4H4KC 2BJDA 3LUYA 1OQ6A 5K9FA 3GILA 3IBWA 3TUIC 2E9ZA 2WLDA 5DLFA 2VUGA 1TAQA 2RQ4A 3FSYA 1KD1T 1I1GA 2ZH9A 3PZPA 4ES2A 2KZZA 4B3OA 3Q2TC 2DK2A 1FJCA 1SH3A 1QY7A 2XZWA 3NG8A 2JF3A 2DBBA 1HM8A 2HS4A 2RU9A 2K3KA 2DH7A 2CJAA 1FRJA 1BQMB 1KLMB 2FGCA 1VLYA 5CYQB 3TV0A 2R8IA 4N77A 3WC0A 4FF4A 1SJQA 2VPZB 1TR0A 5EDWA 2IU8A 1LV5A 2CQDA 4O44B 4E6TA 3POTB 4ID5A 3IGNA 3H4DA 3RTVA 4DHVA 1BWEA 2MY8A 4WYWA 3MM8B 3KNGA 1V67A 3FGVA 4ED2A 2VHEA 1FDNA 3IG1A 1L5UA 1KFSA 3FQKA 3UR3C 3UNGC 5C5JA 4N56A 4DFPA 5GAEU 4J9KA 1JJ2R 1WG5A 1MSWD 1FE4A 2JEJA 1Q1KA 3EXCX 3OHBA 3IC1A 3MMBA 3TI0A