5E3PA

Crystal strcuture of dapd from corynebacterium glutamicum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
284
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 92
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3pA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3pA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3pA01
3BSYA 4N6AA 3MQGA 1HV9A 2VD4A 4MFGA 1KQAA 3VBMA 2QIVX 5E3QA 1MRLA 3KWCA 1KRVA 2JF2A 1FWYA 2WLFA 3VNPA 1Z90A 3FS8A 2IC7A 3GVDA 3R5CA 3TK8A 3T57A 4E79A 1G97A 4M9CA 1XHDA 4EAAA 4KQLA 3R3RA 4HURA 3R0SA 4N69A 3R2WA 2QIAA 3Q1XA 3R1WA 4E6UA 2GGQA 5DG3A 2WLEA 5ADXU 3HSQA 4G3QA 3P1BA 2ICXA 3OU9A 4KPZA 3P47A 2IU8A 5AFUV 3KWEA 2RIJA 3D8VA 3OTZA 4AC3A 4G87A 3OTMA 4EGGA 4EA8A 1KGQA 2V0LA 2WLGA 1V67A 3EG4A 5F42A 4R36A 3VBLA 2VHEA 1QRMA 4DCLA 3TDTA 4ISXA 1TDTA 4AAWA 4E6TA 3KWDA 4IHFA 4R7PA 5E3PA 4H7OA 3FTTA 4E75A 2AQ9A 3VBIA 1KRRA 3FSYA 2XATA 4M2BA 3BRKX 1HM9A 1XATA 2TDTA 3GOSA 5DEPA 1QRLA 3BSWA 4R37A 4N27A 3TISA 3TIOA 5L6VA 4M98A 1QRFA 3FOQA 3F1XA 3BFPA 3EEVA 4HUSA 4HZCA 5U2KA 3IXCA 4N6BA 3BSSA 3V4EA 4AA7A 1KHRA 3OW5A 4EA9A 5DEMA 1SSMA 2V0JA 3EH0A 4EABA 5AFUU 3R5BA 1YP3A 4MYOA 1QREA 1J2ZA 3OUPA 1QRGA 4IHGA 2ICYA 4MZUA 4M28A 3VBKA 2OI7A 1G95A 3FSBA 2WLDA 3PMOA 1FXJA 3FWWA 4J09A 2V0HA 4G3PA 1KGTA 3R5AA 3ST8A 1KRUA 1HM0A 2JF3A 2W0VA 3CJ8A 3MC4A 3DHOA 2IUAA 3NZ2A 3D98A 4M2AA 3TV0A 3I3AA 2GGOA 2NPOA 4EQYA 4E1KA 3FSXA 3FSCA 3JQYA 4HCQA 4IHHA 1OCXA 2P2OA 2FKOA 1MR9A 4J18A 2I5KA 4KPXA 2IU9A 3TWDA 3R8YA 1KK6A 3HJJA 3ECTA 1HM8A 1QQ0A 3R5DA 3MQHA 5ADXV 1THJA 1V3WA 1YP2A 3DK5A 4HZDA 3VBPA 3DJ4A 4KNXA 5E3RA 3VBNA 1T3DA 2OI5A 2OEGA 4KNRA 3IGJA 4K6RA 3R3IA 2WLCA 2V0KA 3I3XA 5L6SA 2V0IA 3SRTA 4EA7A 4FCEA 3GUEA 3BXYA 4G3SA 1KK4A 1SSQA 1SSTA 1YP4A 1KK5A 2Q4JA 2OEFA 3C8VA 1LXAA 1S80A 2OI6A 2W0WA 2QKXA 1MR7A 3VBJA 4M99A 3SPTA
chains in the Genus database with same CATH superfamily
1IR2A 3WZ0A 3LP1A 1JLAA 3VBMA 2RF2B 3KG0A 3D4JA 1XR5A 1NKCA 4FPIA 1U6FA 3UD3P 5F8MA 1FX4A 5GVQA 3R1WA 3HFZB 3H59A 2OD6A 2W4CA 1RKJA 1F5AA 3OL9A 3KWEA 1XMOJ 1WC0A 3HHDA 1R0CB 2XZWA 2DHSA 1H0HB 3TRGA 5F42A 3QPIA 1RT3A 3GIJA 3Q8SB 2J6UA 2OGUA 3AXMA 2DTJA 3SXLA 4HH1A 3QGPA 2ZH9A 1VBYA 1QY7A 4C0HA 2CQDA 5C24A 1KWMA 1TK5A 2RSQA 1S9EB 2RILA 3NNAA 1K47A 3KK1B 3H7HB 1Q1KA 2XTJP 4EO6A 2V0HA 4CO1A 2PA3A 2CJBA 1YU6C 2CFXA 1ZS6A 5JMNA 3U1LA 1TMJA 4Q0BB 5BXIA 3RGIA 3KK3B 3D9BA 1BQMB 1RLCL 2ZC3A 4X84A 1JLFA 2PO4A 3M8PA 3KLIB 1X4EA 3MR7A 2G1DA 1FFWB 3C6TB 2NPIA 3DRPA 4XAKA 3RW6A 2ZD1A 5DS7A 1YSJA 5FD1A 1N5TA 2YKQA 2MSSA 2MQQA 2IDEA 3L4BC 1YX2A 2PMHA 3R2WA 2QG9B 4LBPA 4PPDA 2AHOB 2V2VA 1I94F 2XHWA 3DYAA 2YNGB 2JZMA 5F9NA 4XK8C 4X4SA 1TZ0A 4NI2A 3WBZA 4HR2A 2XYHB 2RQKA 1RTDA 2FQQB 3T9ZA 1TV6A 2MLYA 4USMA 2XATA 1TKXA 2DEIA 2DPIA 2ZE2A 2R7VA 2HNZA 5U2KA 3DOKB 3EUNA 2WVCA 3EGZA 1OPIA 3CCRS 4DG1B 1URNA 1X4CA 3VALA 3MAAA 2MZQA 3CJKB 3CJ8A 1YI2S 3IP0A 2B9XA 3Q22A 1HM8A 3BQ2A 3HLUA 2BACA 3GZ7A 2YWEA 1BUSA 1FKPA 3U1NA 3E59A 3DU5A 2PI4A 3CB4A 4ECUA 1V1HA 2FLPA 1FXDA 2J9RA 4QIGA 4LJMA 3M6VA 3JTNA 3C16A 3TX0A 2VA2A 3PX6A 4ZVTB 1DTTB 1S6UA 2K8GA 2YNIA 2XB2D 3TVZA 1RT4A 1UCNA 3RUBL 4Q7AA 4CP5A 3H20A 3QZ8A 4WPAA 3PYGA 1RT5A 2OPRA 4ZPVR 3K57A 4BC9A 3SQOP 1LK5A 4O44A 3P6YC 3KLHA 5C2GA 2UUAJ 4M28A 2PA8D 3QZ7A 3WIUA 4I4BA 4WF9Q 1KGTA 4LBIA 4YB6A 4HT7A 4GKKF 1OIAA 4LFBJ 2A2CA 5CYMB 2ZUAA 4DV3F 1WUUA 1YRXA 3LTOA 1AFIA 4NWBA 4CO5A 4G65A 2YVSA 4DQIA 4OV1A 1VISA 4YS2A 2FHOB 3LGMA 3IG1B 3BH6B 1HBNB 4FYWB 1GMUA 4UT4A 4V19J 3PRVA 1HBMB 1ZOTA 1I5OB 1FKOB 4V19X 4Y2MA 3ZFVA 4OHWA 4CM0A 1UVNA 4LVNP 2SGFI 2CWHA 3CCSS 2K1RA 5THWA 3HHLB 1UA0A 1Y3KA 2A0FB 4WU3A 3I32A 1MWYA 2GW8A 2J0SD 1S1UB 1A9NB 1NK0A 2F65A 4PXDA 5D0GA 2F4VF 3GWCA 1HNXJ 3GJQB 1QLNA 3KLGB 2GO8A 1AZSB 2DHXA 2HWHA 1LFPA 3UCZP 3C6UA 4ELUA 3PEHA 4NCGB 3G86A 3V6DB 5IT0A 2NPOA 5KAKA 2KU7A 3TQEA 3QATA 4ECTA 4F3QA 5HP1A 3T1HF 3HHKA 5KOXA 4DL3A 1X4HA 2E7WA 2WVEA 3GJSB 2R8IA 4X62F 2JW6A 2JFKA 1OYEA 2HFZA 4G3SA 2IIHA 2PDAA 2ZBQA 5EDWA 3OV7A 2W01A 3DLKB 1SXLA 3BQ0A 3DLEA 5BYRA 1RT2B 1XNRF 3P4UB 3MUVP 2XYPB 3A1YG 3DLHA 2X1BA 3B82A 3Q0AA 3F73A 4TU7A 5SZTA 3MEGA 2DXFA 1HKAA 3GCWP 2QV6A 5HI7A 1KGQA 4NXNF 2DH8A 3FMBA 1TDTA 4CT8A 4TXSA 3PJXA 3ZTPA 4K4WA 2E1PA 2AIRB 3BSCA 4OYXA 3FSYA 1HQEA 1B70B 1XC9A 3TOBA 2AMCB 3NL0A 3BQ1A 2UUCJ 5IT4A 4FVMA 2DB1A 3MD1A 2VU5A 1IKWA 2RC4A 1A7GE 5L9NA 5DLGA 3PYFA 2LMIA 5KFNA 1SUQA 1D9AA 2MXYA 2IRXA 4Y2CA 3BSAA 1YBAA 3PW0A 4FKYA 4MFBA 4F4KA 3D6FB 4M5GA 1VRUB 3GG0A 2GGPA 3TQ1A 2B3TB 3GQ8A 2CWXA 2E66A 1PSDA 5DGBA 1M5HA 2N3OA 3CD7A 2DIVA 3I0RB 5FUXA 1V6HA 3BSYA 4PG6A 4WKRA 3QIPB 1S12A 3SMZA 1I51B 2JF2A 2P9EA 2L48A 3NGDA 4CNYA 2P8IA 3UFFA 3ENVA 4RW4A 3ILOA 5CZXA 2YWKA 1CJTB 2OPQB 3SCLE 4LR8A 4IO9Q 2DY9A 4M8LA 3EDRB 4L73A 4N47A 1BC6A 4NLPA 2IM3A 2LVWA 1PIEA 4TU8A 4DV0J 1KQFB 4DUZJ 4NLUA 2GMLA 3MMCB 4A8YA 1SL1A 2LUYA 1ITPA 2PEHA 3BPSP 3LP2A 3P45B 4JV0A 5IZHA 5T41A 5GAEU 2QGFB 4NLDA 1E6VB 1RBLA 3W2VA 3L95X 3R5GA 2BJ7A 3HFKA 1WTFA 2HSEB 4ILLA 4TY9A 2COLA 3V6JA 4QIEA 2LXFA 2Z30B 3NAHA 3Q2TC 5K14A 1XNQF 1PO6A 4ED3A 3EDQB 1U26A 3LO3A 1UVMA 2QRRA 2W2NP 3SDEA 1RT6B 3A12A 3AQPA 2VC1A 4ZPBA 3G82B 2LQJA 2B8TA 2IC7A 2OPPA 3OH1A 2HKEA 2GFFA 1Q78A 1UWBA 2LEOA 4U95A 1C1CB 3W1YC 2EFGA 2W4PA 4YDDB 5LMNF 2AJ2A 4RW9A 1L3UA 2RD5C 2HVZA 1K7TA 3VAMA 1HWUA 1RK8A 3TAMB 3W2WA 2MQPA 5BYSA 3PZPA 2Q79A 3CXCR 2G0JA 4C8ZA 2XGPA 1VYAA 3ETOA 4HVZA 1SV5B 5KT6A 3DRSA 1Q7YT 1TBRR 2DO0A 3GFZA 2LEBA 2ZZNA 4KC5A 4R5PA 4PG8A 4DSLA 4OI0A 2OSRA 2XNRA 1RYSA 1RAHB 1MROA 5CHCB 5F8IA 2HQGA 1V5VA 4FXDA 4G6VB 4EBEA 2ZH3A 3MM9B 2CQHA 3I0SB 2R7RA 3QO9A 3L7PA 4ZLNA 4X2BA 3W9JA 1HMVB 3GONA 2MMYA 5F8NA 3TOAA 3JSBA 1X9SA 5LSLA 5KG7A 2DR7A 3R9LA 3UN5A 3FTTA 1SGDI 1SGEI 1FNXH 2F63A 3PW4A 1B99A 3LWLA 4DWIA 1UEKA 4CLSA 4KE5A 1UPPA 1PJ7A 1TAQA 4LRDA 2DGQA 1SC1B 3MTKA 1ZZFA 2OH2A 2BA9A 2GVDB 2G13A 4MZUA 2V8VA 1S1TB 2MJUA 4P7TA 2XI2A 1KONA 2MKJA 2HS4A 1RWVB 1U1RA 2ZOFA 4OJHA 4J9QA 1EKRA 3M8QB 3PJ9A 2V94A 2UXBF 3Q8QB 1N5VA 1TUSA 4XDCA 3SRTA 2WONB 3FK4A 1JXLA 3CJ3A 4JI8F 5D0RA 3M2RB 2CDQA 1SH0A 2VFUA 1BWVA 2B0UC 4MT1A 3ZO7A 1NAQA 3NBPA 1HA1A 3FSIA 2ZDOA 3BR9A 5HROA 1R31A 5AE1A 5LSOA 2RS8A 1VDDA 3BKTA 1PGZA 4JI4F 3BSOA 2C3YA 1IWAA 3I96A 3IRXB 1H6KX 4YEAA 2KO1A 4KSEB 3TWZA 1YZ7A 3VGTA 4NPOA 3ZZOA 2I5JA 3BREA 4B3TJ 4HACB 1NPKA 1YZ6A 4KH1B 3AY0A 2W9CA 1XTZA 3AH6A 4IO1A 5KG5A 3HSGA 2V68A 4EMDA 2CQPA 2JLGA 3W5YA 1KTQA 4UQTA 2CQ2A 4EZ9A 2ZDPA 2OLWA 4B3MF 5F8LA 4DNCA 1BQXA 4F2SA 3DN9A 2J76E 2BOPA 1OSCA 2LXIA 2P6TA 3OSPA 3GQ9A 5I3UA 4LF4J 4SGBI 4LRBA 4F0MA 5EWFA 3F44A 1RWPB 2OZUA 2ATLA 2R7XA 2WVJA 1UVLA 4JI3J 3E3XA 4ALZA 5CYJA 2BJ1A 4BBYA 3CJRA 1FTCA 1NSPA 2QE5A 4WFZA 5CYQA 2R7SA 3I31A 4TYAA 4FF4A 2L3MA 3LF0A 6FD1A 1HPZA 1WGCA 9RUBA 4CLYA 1QVGR 1RE1B 3P5TL 1JLCA 4NLWA 2YPZA 4AQYJ 3FRYA 4B9SA 3NKYA 1PC4A 1KLNA 4X4QA 5DZ6A 5I3PA 1WC5A 2VG7A 2GIQA 4QOTA 4AFFA 4G1PA 1S1WA 4RNNA 5B0FA 2F1FA 3DLGA 3FKBA 4QIFA 1WKXA 3T5HA 3Q23A 2VOOA 2MZTA 5J1EB 3PRBA 3S1TA 2ZH5A 2HMIB 3M2VA 1J2ZA 3PNIA 1C0UA 3VR1A 2H9ZA 2NCKL 2YUUA 2FY1A 3BDEA 1VI7A 3TUJC 2P2OA 3TARA 2MHNA 5A8RA 5IFMA 4TN2A 3VAGA 3E51A 4H54A 1N33J 3Q8PB 2VODA 1S4FA 4PCQA 1T94A 2R7QA 4ZPTR 4BCAA 1T7PA 2HG4A 3US5A 2OHDA 3BYPA 3IM9A 1WF2A 2W1BA 2B0GA 3TUZC 5HMYA 4KGVB 5E3QA 2AWZA 4DFJA 3D54A 1S9EA 4N8OA 1R3NA 2WVFA 1RSCA 4DSEA 3I56S 3RBDA 2LEPA 1S76D 1NLKL 1IQZA 3NGKA 2K9HA 1M5OC 3EYZA 3FVYA 4Q0BA 1BQMA 1TFWA 1VQ8S 1I94J 3EGNA 3OL0A 1Q82T 3M8SA 1SGPI 3ADAC 1FVSA 4DPOA 4F4ZA 2WOMB 2JOQA 4IRDA 1RTZA 2VH7A 3M9OB 2XHCA 2Y0MA 2KFYA 1N48A 1J5EF 1QAXA 3HM9A 1N36F 1SIZA 1EQ0A 3R5DA 3ISZA 2DNYA 1T9UA 4K6RA 2V2QA 3M1VB 4UXHA 4K8RA 2VQFF 4ED6A 4MAKA 4YB7A 1Q5VA 4OYBA 1JLGA 1VDHA 1CULB 1AYEA 4ED7A 3DOKA 1FDAA 2FHJD 1RAJA 4DG1A 2Y1RI 3O2IA 2E5GA 4DUYJ 2SGPI 2WVBA 2KFZA 4A8KA 1UFWA 2J87A 3IXQA 5KG2A 4H7OA 2D69A 1PYOB 1WDDA 1T03B 5FDLB 3BFPA 3I87A 1GFWB 2G0CA 3SQGB 1WHVA 2HGNA 3V2UC 3EH0A 1S49A 3R5BA 2P6SA 3I5AA 1U5KA 1HBOA 3FUYA 3PVXA 2L08A 3GLJA 2JF3A 3HZEA 1P9ZA 3S6EA 1P27B 4QR0A 1Q16B 2GAHC 2I38A 3DM2A 5MAOA 3MPUB 1QQ0A 2AJ0A 1HWJA 1DTTA 2J6SA 2R2UA 5ETVA 1HWKA 4ILRA 1RDRA 4GKKJ 4X4RA 1I3OB 5B0CA 1HHQA 5C25A 4DFPA 1ULKA 1XMQF 3HJVA 2ERWA 2J8AA 4F3MA 1HWIA 3A8EA 4QYZK 2UUWA 2CPJA 4I67A 4UXIA 2D41A 1EJ7L 2GMJA 3HJFA 4IKAA 1TTHB 3DHXA 2EC2A 2VFTA 2XCPA 1VRTB 3EWGA 2QFJA 3B4VC 4FPRA 4KKOA 4ZLPA 3IM8A 2OTJS 1Q79A 1IXKA 4DV2J 2AYBA 4P72A 2J6TA 1FXLA 1QRGA 1TQLA 2V6AA 1Y00A 3TVKA 3IG1A 1CJKA 4DR1F 3PKYA 5GAEI 2F4VJ 3M6UA 1HBMA 3G71S 3J7ZT 1PBUA 3GV5B 4CLUA 1O6XA 4NA2A 3QJLA 3CW2C 3CDWA 1AT1B 4KNXA 3VBNA 3QWPA 2NUUG 2XMUA 3HHLA 2ZJQQ 4RNMA 2M5XA 5A8WA 1MU2A 1NK9A 1LWXA 2RUGA 4JYAF 4ZP6A 1IJFB 4X4OA 3T1YF 3RZAA 3W66A 2B5JB 3LW5C 4RBVA 1Q8KA 5AT1B 1TK8A 1TKZB 2FNFX 1GX6A 1QJHA 1OO0B 4X62J 2C28A 3UQSA 4M5DB 3UO0A 4XTTA 5HQLA 3EMTA 1UJ4A 4IFYA 1G6BA 4JI7F 5ETMA 1PCEA 4NCGA 1GXTA 2OPSA 1GH8A 1P1TA 2AEJA 4ZMMA 4OHYA 3M8RA 1XNRJ 2OMLA 3ULHA 2ZKTA 2DNKA 3GP9A 5J2MA 3QAUA 1B0PA 7FD1A 2PFDA 2OKQA 4AXJA 3GJTB 4UOFA 1HD0A 2W7PA 4U7UD 1FXRA 3QWUA 1VQMS 1XIQA 1S4EA 2JDJA 5IV3A 4XIUA 1RT2A 3H5SA 3HVAA 5L46A 2NXEA 2AYEA 4J9LA 5E41A 2OU2A 4C0OC 1YJNS 4CTAB 1S77D 1OQ6A 3L3CA 3TJ8A 1Y10A 1IKYA 2HRYA 1Z2FA 3OLBA 3PG9A 4U96A 1HV9A 2QA1A 5HLFA 4C9DA 1HJAI 1FI4A 1T9YA 3BH7B 1XHDA 4UY8T 1TL7B 3PCOB 4DL4A 3LP0A 3THTA 2VKRA 3D8VA 3FFIA 4M5JA 3W9HA 4DQQA 1VQLS 4F0KA 4WXOA 3NCQA 4Q2LA 1UFLA 1LXNA 5F3ZA 4JI2J 3IAS9 3GYGA 4FBUA 2F8MA 2XZTB 2XMMA 1JNZB 1S10A 4DR3F 2RVJA 4F3OA 3UNYA 4USUA 4K50A 3EEVA 1YLXA 1RHKB 1U4BA 4B9NA 4FKDA 1PCAA 4IHGA 3OUPA 2UUBF 4MIBA 4F4AA 3TO8A 3POTB 1NB7A 2Y8YA 4DBQA 3QIPA 4XO0A 3NZ2A 1DARA 1FEEA 1NXUA 1VQSA 4RU9A 4Q5VA 1HBUA 3RR8A 2PEBA 4ZCKA 3PO4A 2N71A 4RW7A 5M2PA 1CJTA 2OPQA 4Y34A 2MGZA 4OLPA 5F0WA 1UZHA 3MMAB 4WK1A 4EA7A 2HHHJ 3I4HX 4WTOB 3H5UA 3BN7A 4IDKB 3T1AA 4K0KJ 1Q4RA 1KRVA 2FHKA 2YXLA 4ZVFA 3TUIC 1FFSB 2OO4A 3MMCA 1XNQJ 3GYXB 1LQ9A 2DRDA 3P47A 5HAOA 2W8LA 4PXCA 5LL6d 2ZHOA 4UUWA 3B54A 3FEYB 4GVBA 4O0NA 4CDIA 1X0FA 3OH3A 1KVKA 3OW2R 1LEOA 2AQ9A 1R0AA 1F60B 2I6WA 1TKTB 4USTA 4GKJJ 5G0RB 1T95A 5LMNJ 1NPRA 3OH4A 1FJEB 4YDXA 2CJSC 2HAIA 4LSLB 1S6QA 1RU2A 2BABA 5LT5A 1EP4B 2J9DE 1ZBTA 3MXHP 2DRBA 3TJQA 5FIIA 4B9VA 3Q8UA 4C48A 2YKAA 3UD5A 5F0UA 2BBEA 4DV1F 5D3GB 4N76A 1JWWA 4ZVRB 3GUEA 4M5IA 1FCAA 3PACA 4QBUA 4G3IA 4DZ6A 2QKXA 4WFYA 2HZCA 4FKXA 1RA6A 2YQPA 1B0TA 1WJ9A 4AL6A 1RI7A 4MIAA 1R8HA 3QGGA 4QU7A 2MDAA 4LMZA 4B02A 4Y00A 5A6WA 4DS4A 2HFVA 2BJ9A 1NCLA 1QRMA 4K2JA 4F7VA 4QW8A 1VC0A 1RCXB 3MOZA 4DR2F 3UDEA 2KCXA 2AZ1A 5J2PA 3GIRA 1DQ9A 2ASDA 2AQ4A 1YJWS 2CZ4A 2JL9A 1WHWA 2EG2A 1RLDA 1SQFA 3VBKA 3K59A 5D6GA 1KLMA 2QA2A 3DHWC 1G2EA 1RHRB 2A1BA 2BUNA 1FFGB 3QJJA 3MM9A 2IUAA 3MCMA 4CO0A 2FZGB 4WP4A 1CS4A 2VFVA 1ZTTA 2VDHA 4EYHB 2JEIA 1DY3A 1H2UX 1HMVA 3MQHA 3TANA 4HZDA 2CWFA 1O8BA 3DJ4A 2CA9A 4B6DA 2KRBA 5BJRA 4EWTA 4DL0C 3KLEB 4LVOP 3VZHA 2YNFA 1T05B 3LANA 4I2QB 2AYGA 2OMOA 3GQCA 1Y1BA 2OD4A 4HEA9 3BR8A 4CO3A 4TVAB 1F5CA 2JEJA 2ZM6J 2CJ9A 3FMWA 3T9NA 1JLAB 1TAUA 2GVDA 4OI6A 1NXIA 3VGSA 5FLXY 1WTBA 1X0PA 2B56A 3EVOA 2R7WA 4ISXA 2PQ8A 2BRLA 1T3NA 3M8QA 3L7UA 1VC6A 2BANA 4JI4J 4AL5A 3HVWA 4OZ2A 4DX7A 2WONA 3JQKA 4KHMA 2ICYA 1RYRA 4CLWA 1T9VA 3ELHA 1RHJB 4MH8A 5C24B 3F41A 5FUWA 4J9PA 2GGOA 1WSRA 2EC0A 3FSXA 3CXLA 2AX0A 1RA7A 1YJTA 2JHEA 3MDFA 1U1OA 4O4GB 2BW2A 1NK6A 2YWWA 2RDJA 3HP6A 3KMSA 3R7NB 3S01A 1TUVA 3NGTA 1UHAA 3H4DA 1U1LA 1R8CA 3N9UC 2DGXA 2HS0A 2AF6A 4NLGA 2IM1A 2A20A 4J9OA 4HACA 2RU9A 1KFSA 3BS9A 1KR4A 4YUDA 3C66A 4OX9F 4KBIA 2E5HA 4QU6A 3UGDA 3DRPB 1V5IB 1JXVA 2KT2A 5H1SV 3EZ5A 4DXLA 3KUEA 2RIJA 3BF4A 2P9CA 3QRQA 4Y6IA 3M30B 2ELIA 3IR6B 1IVZA 2XS2A 5ITHA 2FY8A 4DS5A 3BKUA 4NI2B 4TYBA 4F4XA 4WZMA 1GMWA 2LDIA 3SYZA 1RTDB 3H40A 3P96A 2M8HA 4UZBA 4W98A 2V0JA 3I9V9 5DG9A 2ZE2B 4DL5A 4ELTA 2HNZB 4L75A 1FRXA 4USJC 2R7UA 1X60A 1SI9A 3EE3A 1EZZB 3O44A 3AJDA 3QAEA 2O66A 3QLHA 4RKUC 2E9TA 1FRKA 2E44A 3MAAB 2QLWA 4OI2A 1BQNA 3DDKA 4BLGA 3NMAA 2K3KA 3RBEA 1EAYC 2AP6A 4L6V3 4FF2A 4BWJA 1N6QB 3DLBA 1BD6A 1SKRA 1FNMA 3HKWA 3OR1A 1W26A 2OEKA 4GO5X 1FKPB 2FLOA 1HI0P 2EBEA 1X9WA 1FJGJ 1YK9A 2HMIA 3CIZA 3KMQA 1S0OA 4DPTA 3P1BA 2HRUA 4LF9F 3K8WA 3C16B 5A8KB 3D2WA 2BJEA 4EZ6A 1SJRA 2M70A 2M52A 1IBLF 1P9GA 2YNIB 4S0MA 2RRNA 4FBTA 3JTPA 1NDPA 1V3ZA 2HBQB 2D1CA 3J81j 1FAQA 1VJQA 2N3LA 1PAUB 2OPRB 4JI1J 2V4JA 4Z37A 2CQ1A 4KAIA 4O3OA 1KRUA 2M5YA 2XWXA 3BN4A 4V1Ak 4O44B 5AE2A 1CSJA 1S79A 3KLHB 1SC4B 2WHOA 1RBAA 1OCXA 2I5KA 2HGMA 1Q5YA 1AXQA 2QYGA 5KFSA 1S7IA 4JB8B 3OUYB 4RJVA 1RWUA 4A47A 4LFCJ 3RRHA 3TO9A 1HNZF 2FVPA 4HI2A 4DSFA 4NLRA 3TA0A 3V5RA 3PX4A 3DOLB 2GCFA 5F8HA 1J5EJ 3R7SB 3RAQA 5I4MA 1UETA 1IJEB 5E7OB 1VLYA 3H90A 4K5SA 4DEZA 2HFUA 2HBZB 3TO7A 1U2RA 3O6QA 1O51A 4LFBF 1FYBA 4M63A 1SQGA 2VQFJ 1S20A 2YKNB 2JRSA 2KFNA 4DN0A 2K1RB 3GR1A 2IBKA 2IVYA 1S6PA 3JSMA 3GOSA 2IBOA 4ECSA 4R37A 2IM0A 4WIQA 2X51A 1HNVA 1UL3A 1WGTA 3FEZA 4I1TA 5C7PA 5IV4A 4FVCA 3HT3A 2ROPA 2HW3A 2G4BA 2G2OA 1YP3A 2EFVA 3MZIA 4J09A 2ZBCA 4CLLA 2W7OA 3WQPA 3A3PB 5JUMA 2ZZMA 2NXNA 1DQAA 3KDNA 1RHMB 4CLZA 3TI0A 1ROFA 2QQDA 4WE1B 4IRKA 4DFKA 1RT7A 4YP3A 1Q0NA 2WVDA 4OHZA 1TL3A 4JI5F 3BO4A 2OEGA 2DNQA 4OV6A 5HP1B 5SUHA 1TR0A 2CAJA 1HNXF 4QWCA 2APOA 1GXUA 5EWEA 2BYCA 1WORA 2NS1B 2W2OP 3OVSA 1PILA 3SQGA 1VIXA 2BXJA 1KC8T 1H0ZA 3AB4B 4RNHA 1WEZA 3DNCA 1Q53A 3MF5A 2CQGA 3DLEB 1RKIA 5CD4H 2JVOA 4DR5F 3SEKC 3VBLA 3Q24A 1N4LA 2JVRA 1KBFA 2VRWB 1XMQJ 3MEGB 2KMQA 3BBFA 4DI6A 1XR7A 2Y1JA 1JB0C 3K5NA 4EO8A 3TIOA 1QUPA 2DR8A 1BGXT 1M0SA 4IG0A 1HQEB 3DOMA 2BVZA 3KUGA 4NX9A 5KG6A 3UEYA 3FSBA 1QAIA 2HHXA 1IKWB 1TBQR 5KT4A 2FLLA 2RQMA 5KFFA 2VQEJ 2I2YA 4E1KA 3KK2B 1OJ4A 4OFZA 4B3SJ 2FJDB 4OZ1A 1SUQB 2VF3A 4HYKA 2L7XA 3F0NA 2IVFB 1U0SA 2HVEA 4P2MA 2VG5B 2V0IA 1DS3I 1K0TA 2PT0A 1LW2A 2OP5A 2CUYA 4MFBB 1S0MA 4DR1J 2VC0A 3CJ2A 2GGPB 3C8YA 2VD4A 3T5LA 4LQ9A 3TO6A 4O3QA 5K5MA 2SGDI 2DGWA 3CC2S 4YY3F 4RUBA 2L8EA 3T1YJ 1IKXB 2UVOA 4U9RA 4NASA 2CRLA 1S7HA 3H5XA 4LF8J 2D7SA 2RKIB 4DR4J 1Y5LB 4AD6A 2ZJPQ 1V9OA 4OIXA 3SFGA 3OVBA 3Q8RB 3BO3A 5L1IA 5B0BA 4WP8A 2WCXA 3M7VA 1NUEA 2IDLA 4ANEA 2PE8A 1WI8A 2ZH1A 1OQ3A 3QIDA 2R8JA 4NE9C 2QEXS 3LP2B 1FTRA 4J18A 1Q8BA 2GVIA 1QVFR 2MKIA 2KMPA 2DITA 3RU0A 1S99A 3VGUA 1F6TA 1BMOA 1DTQB 5ETSA 2KTQA 3ZXWA 2JWNA 4DV0F 4DUZF 2NSBA 1CGJI 3W64A 4ID5B 4NXMF 4O3SA 2AJ1A 2E1RA 3DDIA 2GV1A 3J81Y 3SDEB 4WTYA 4ANCA 1MJAA 2Y1LB 5DDPC 4M5MA 1K7UA 5ADXU 3MEEA 4MKYA 2QJ3A 1VQYA 1IW4A 2DD8S 2P2CB 3T5KA 2NLWA 1UWBB 4C8KA 3KTQA 3RRGA 3K2YA 3WHIA 2XO7A 5D0EA 2CNNB 1VHFA 3J81U 3OSNA 1NHKL 2QMXA 2E73A 1JXEA 1ZAWA 2H1YA 5L6VA 1M1KT 1IWGA 1WC4A 1DURA 3I5CA 5D4LA 1C1BB 3W2WB 4ECRA 1MWZA 2WZ1A 3FCWA 3LALA 3GILA 5K8OA 1OS5A 4TY8B 2DEJA 3OFEA 2XNQA 1TUWA 3SCJE 3MM5A 2W24A 1OMTA 4DR3J 1NZAA 2YKOA 2IU9A 1VQPS 3NNHA 3FC9A 4NA3A 4E2FB 3P3DA 3OTCA 4R5PB 9WGAA 2UUBJ 3I9ZA 2AGQA 4GVLA 3OL7A 1HFEL 2GZOA 1RTJB 3R27A 3Q83A 2ABYA 1MROB 3D0GE 3FBEA 4B9MA 3DKDA 2IJNA 1NJWA 5AE3A 3TJ9A 4JI6F 2X1AA 1FX2A 4FS2A 4A46A 4G1IA 1Q7LB 1OPZA 3T57A 4LUBA 3LUYA 2B4OA 2HS3A 2I9SA 1G1XA 1NK7A 1FARA 3POTA 2WLGA 2VHEA 4P10A 2BV3A 4PRFA 2J7WA 3K5LA 2G2YA 2B51A 2QMWA 4ITSA 4YFUA 1EKSA 4RW6A 3MMAA 4MPIA 3HHLD 3MUTP 3KG1A 2MEWA 3GPAA 1GMVA 2FC9A 4G3PA 1M90T 4P73A 4M2AA 1Y11A 3CSKA 4R25A 1GTEA 2MQ8A 2LP4A 1RWKB 4IHHA 2KHDA 9ATCB 4DF8A 4ZK7M 1A0OB 1F9EB 4ED0A 2DR6A 2NXUA 3R6GB 3CCQS 4OYZA 4ETXA 4XPEA 1HHTP 3UNGC 1QSSA 1KQGB 1U7LA 2ASJA 3KUHA 1PTQA 1YG0A 2A6OA 5E3CA 2VASA 4WU2A 4EBDA 5C5JA 3CJQA 1K44A 1HDLA 5G0RA 3SGQI 2RHQB 1L3TA 4Q8EA 1HHSA 1KNZA 3VDUA 3RRKA 2L9NA 1FERA 3NBPB 3LPYA 3IAM9 1DBDA 1EP4A 3G9CA 4R36A 5HROB 5L1JA 4C8OA 5EHHA 2D74B 2WBMA 2UV8A 4ED4A 2MB0B 2GIRA 2HYIB 2RDIA 4M5KA 1ZETA 3TYTA 2I5JB 5F41A 2KT5A 2W9CB 3TUPA 4ED8A 2V4QA 2BQRA 2HVIA 2LFVA 3B8HA 4PQUA 5LSRA 2AGPA 3R5AA 1RABB 2V1CA 2RE1A 4DR2J 2YX7A 3R1LA 1EHWA 2XQCA 3PJWA 3NOGA 2VPXB 4WK3A 4QIWD 1VQOS 2VIHA 2WW4A 3DLJA 1UZDA 1Y5IB 5I3UB 4B3TF 3CF5Q 2PI5A 1S1VB 4D3GA 3CD0A 3R97A 4WIIA 3MM6A 5GMDA 2DNNA 4RPFA 2N82B 2AW0A 1FEHA 5FUVA 5KFCA 3WC0A 4X4VA 4LF5F 1HPZB 4ZP7A 1UVGA 1JLCB 4ECWA 4DHVA 3FC3A 1HLWA 1V1IA 3QFWA 4R8UA 3UEJA 3QSIA 3SCKE 4LQ3A 3ZZRA 1Y7PA 2BR0A 3HSJA 1K73T 2HFOA 2VG7B 1MMDA 4I68A 3VDPA 5GAHI 2XG8A 3HH2C 5L1LA 1S1WB 3DLLQ 4LF7F 3DLGB 2AYMA 2KDOA 3H8YA 1Y4ZB 2WLDA 4U8YA 4I2QA 1UVIA 3K5PA 2WTFA 1R79A 3NG8A 2CYYA 1C0UB 8AT1B 2R42A 1KK6A 4TQRA 2C3OA 4LF2A 3C2PA 2DNOA 2AJFE 1XK8A 1RACB 5A8RB 5IQQA 4YR0A 2GNKA 1SSQA 3QFHA 4ZLLA 4ZVHA 4ETZA 3N6MA 3E2IA 3VBJA 4UW2A 1JIHA 4IYQA 4NZ0A 1H2TZ 1EX8A 3HPOA 4X4TA 1VQ7S 3O5TB 2DNHA 1FWYA 3MMBB 1NSQA 1VLOA 3KKFA 3OTZA 4CLPA 2GHPA 1CJVB 1IY6A 2M0GB 2DGTA 4RX6A 1N33F 4OX9J 1YGYA 3LOUA 2C3UA 2JFDA 1VS3A 4O4GA 5D0HA 1RU1A 3TX8A 3KWMA 4Y2KA 2VBXA 4OMFG 4N6BA 4CO2A 2HHTA 4EA9A 5IM0B 2V5HG 3CDEA 1F2GA 1SSMA 1XR6A 1YQHA 2I8EA 4D3HA 4Q2MA 3GU0A 2CG8A 4DCJB 5L38A 3ST8A 2W0TA 2JLEA 2V50A 3BGLA 5DJBA 2MZRA 2E9ZA 3GG1A 4P71A 1U1NA 1VOMA 3TWDA 2D3UA 3UW1A 3JYTA 4BS2A 2XULA 1NHVA 4CNZA 2J5AA 2DCLA 3N5FA 5DG7A 1U6BA 1DS2I 2MQNA 2E7VA 3MCSA 1AUSL 3PM9A 3GR0A 3GFYA 3M30A 1FD8A 3PR5B 2L9WA 4OYOA 4DPYA 2QIVX 1UEUA 2YPYA 3JQJA 3N6LA 2VBYA 4RNFA 3QBCA 2DY1A 3QRPA 1WD6A 1JLGB 5D4NA 1RUSA 1RWNB 4O0IA 4KT0C 3SBMA 5DDOC 1X8DA 1YBTA 3H2UB 2V0LA 2PIIA 5BR8F 3OPKA 1ZZNA 2K7KA 2V4RA 3IN5A 4R7PA 3PEJA 1PBAA 1CVJA 4C3MA 2J7KA 1FRIA 2KYZA 2WB1D 4LF9J 4PYDA 3H25A 1O5JA 1RHQB 1U47A 3EGVA 1TUGB 1N6QA 1QTMA 3MR3A 1IBLJ 3AOCA 4PWUA 1VCTA 1VRQC 1TMMA 4DUYF 4DL6A 3JQYA 1HBOB 2NZCA 3KOAA 3QNWB 1KVJA 4MJKA 1YWXA 4P52A 3QT5A 2F3JA 3DM2B 3CCES 5A8KA 3NWRA 2CJYB 3UCGA 1BWEA 2MQLA 1M1GA 2HHPA 2EFOA 3BBBA 2GKTI 3OTDA 3GQAA 1SJ1A 5ETLA 4Q8FA 4DQRA 1VMBA 1HNZJ 1PYTA 5C25B 2YQ3A 4E6UA 2R3VA 2BM1A 4OVOA 1SH3A 2O67A 3MGJA 4J7CA 5KFUA 2CQBA 1IKVB 4EGGA 5I42A 1ZM4A 1WKJA 1QAJA 2HQ3A 3P8BB 1X4GA 5DZ7A 4LIWA 1L3KA 3EPIA 2GQQA 1S48A 1X4DA 3OUYA 3JB9k 4ILMA 2MKHA 5DQIA 1FDDA 1FWLA 3DOLA 1QREA 4KKOB 4QR2A 3PMOA 3FWWA 3Q8VA 5KFLA 4K4YA 2CJAA 4W90B 5J2NA 3X3UA 3M32A 1CJKB 3VBPA 1R89A 5BYQA 2BRKA 1XQIA 2YKNA 2OELA 1NO8A 4OI4A 3NGSA 2ILYA 4HI1A 3C46A 2UP1A 4DV2F 5KG3A 5A8WB 1MU2B 4CLTA 2QQ0A 4JI5J 1FWKA 1ULMA 2XI3A 1GMWD 2G0IA 2W2PP 5M2RA 3IFEA 2X1GA 3ZNJ1 4NLYA 4WZQA 5JVGQ 1NJIT 2B7CB 5B0AA 2QA4G 4IHFA 2Y0BB 2BE2A 4WE1A 4P7VA 3HD1A 4IFYB 3BGRA 5K20B 1QRLA 3A8JA 3PKMA 2OPSB 3RJMB 1AA1B 4DR5J 3WC2A 2IAJB 5J2MB 4J9KA 2IPOB 5AFUU 2J0XA 4TLQA 2SGQI 2C2RA 2H65B 4HH0A 1FXJA 5I3QA 2C2NA 3DMJB 1SGNI 1LNQA 2ZH2A 1J5OA 1FESA 2HAFA 3EXYA 2DCUB 4RNOA 4KB7A 4KFBA 1VR6A 3EVMA 4OX8A 3CMAS 3IGVA 4H4MA 4A8OA 3VWSA 2YX4A 1LW0A 2Z2MA 1VBXA 3FQKA 3FCHA 1FK9A 5IC6B 2KZZA 3SI8A 4IQXA 1UAWA 2E1CA 1CSOI 3UDLA 1IKYB 3OVOA 1AB8A 2HBYB 4KV8B 1F3VA 1VQ4S 1NZ8A 3NGRA 5IC4B 5HLFB 4KPZA 2AD9A 2IU8A 3QT6A 4DQSA 3WIVA 2FIUA 4EU0A 3W65A 4DPWA 4KRWA 4DLGA 3LP0B 5T14A 2YY3A 3RTVA 3FFIB 3KK2A 4E1RA 3HXMA 3QT7A 2Q66A 3RBZA 4Y0FA 5AJ3F 1RTIA 2BQ3A 4ECYA 1U48A 2VG5A 1MN7A 4YY3J 5EX0A 4M94A 2DGVA 1VQ9S 3NGUA 2HPUA 3D6TB 3IR5B 2NXCA 3K5OA 2XMJA 2V9WA 2FTRA 1N5YA 3CD6S 2HNYB 2V69A 2GC8A 4I56A 2PMWA 5HSPA 2OIHA 3CC4S 4JI2F 5AXLA 2Z0GA 2ROWA 3T6BA 4OI3A 1IKXA 1HBUB 1R8AA 3M8YA 2N1AB 2ZKUA 5K8MA 1RTHA 4I6AA 4B9UA 1MNEA 4RW7B 2L9DA 2RKIA 2MGZB 1CGII 2B9YA 2B4PA 1GQEA 2BM0A 2DKVA 4A24A 4F2RA 4WFAQ 5KFVA 1MMLA 4NXMJ 2OAUA 3CDUA 3M6WA 3M9NB 2CJXB 1JJCB 1D9DA 2C2ZB 2HHHF 2SGEI 1QE1B 4GVBB 3AODA 3NS5A 4GC6A 2LQBA 2NYIA 2ZEJA 1KTVA 3V4EA 2ROGA 1R0AB 4K0KF 1DTQA 4U67Q 2N7CA 2R7OA 4FDFA 4ERDA 2M8DB 3DXBA 4ID5A 3KJVB 2E29A 3I82A 1O0PA 2A18A 2HHSA 2W0VA 5DETA 2VA3A 3ET6A 5E33A 1S6QB 1UW4A 2KZMA 2HVDA 3VVUA 2YQ0A 4KHPF 1Q8IA 1VGYA 3FEXB 5HJYA 3PFEA 3OQ2A 1W7WA 4KO0B 1MJ9A 4GKJF 2E5RA 3VVTA 1FE0A 2N4DA 3LAKA 1MR7A 1YBUA 1XBTA 1E6YA 1VQNS 2B8QA 2DHAA 1KQSR 1C1BA 4OJ1A 4ZLJA 3HT0A 4CT9A 1GTHA 1ICEB 2PC6A 4CQ1A 2R2RA 1B7YB 1S72S 1L3SA 4TY8A 2JSXA 2F3CI 5HO4A 3PFOA 4NA1A 2VG6A 1U09A 4L76A 2E5LF 4JI6J 2AEFA 4OZLA 4LRCA 2IC3A 4OJGA 2GQ2A 2M9KA 4CH0S 1U1MA 4EFAC 3HZGA 4HTIA 1LXJA 3J7YI 3AT1B 2UZAA 1RTJA 3BYRA 2XYGB 1GXLA 5J2PB 2IMWP 1SJQA 4HL9A 1JLBA 3VZIA 1HM0A 5M2UA 1KLMB 4NLXA 4K4XA 1WC6A 4B3RF 3CJTA 1JQGA 3HCXA 2E1AA 1CS4B 2JZ5A 2W2QP 2OUGA 4KY3A 2CJQA 2W7AA 4P9SA 2G1HA 1NNDA 1EIYB 1X4AA 3TP2A 4DSIA 2LU1A 2UU9J 1ZH5A 1NEEA 4KH0B 4F04B 3BEGB 4P74A 1Z90A 2YNFB 3TK8A 4M9CA 4PQAA 3MUMP 2NU4I 1LWEB 3HSQA 2MLXA 1NK5A 2YKMB 1Q8LA 5B7WA 2QZ8A 2CIMA 1R6YA 4RL1A 5D4PA 1RJJA 5J1NA 4WJBA 4E75A 3G6YA 4M2BA 5DEPA 4N7TA 5DDRC 3JSYA 2KJWA 3DXSX 4WYLA 3ILIA 2BANB 3FZBA 4F0HA 3A8KA 2ZM6F 1RWMB 4LSZB 2EW9A 3B78A 2J7UA 5KFMA 3DHOA 3TV0A 2HFSA 2A6MA 2XC9A 1YIJS 2ZJRQ 3DU6A 2FJEB 3KJNB 2VD3A 2C3MA 2V8HA 4I7FB 1VQKS 2D9PA 2ASLA 3N0VA 3CPWR 3EM1A 2C22A 1PC5A 1WNEA 1NDLA 5CAAA 2DIPA 1K9MT 4BDPA 1KFDA 3C8VA 2OI6A 4M99A 3ENQA 3MTJA 5KFGA 2DH9A 2XZDB 2V63A 4ECVA 5K8PA 1VBKA 4NMLA 4YOEA 4ZDNA 4HKQA 3PHEA 1SB6A 1RT1A 4NLOA 2LCWA 2LA4A 4KGKA 4KGMA 2R8HA 5J2QA 4I64A 2HWTA 2R4FA 1X31C 2DNGA 2HHVA 2JEFA 5KFTA 1MLAA 4LF5J 2H54B 2VHGA 3MCOA 4ER8A 1SJ4P 1S1VA 1WKKA 1TBOA 3QGIA 1HW8A 5CH7B 3WX8A 2ZH6A 1PAEX 4DZDA 3QSYB 4OZJA 1X4FA 1JLQB 2LU2A 3D98A 1VJWA 1UFKA 1HEVA 1SC6A 1YKWA 2QX0A 5HJXA 1T9TA 2CNKB 3VAJA 4LF7J 2VUGA 4C8YA 3QLHB 3OHAA 2ZNYA 5KT5A 5HMZA 1X5SA 5GMKa 2FJWA 3CCZA 1BQNB 4M5NA 3OL6A 3CCLS 2OTLS 4ZJOA 5KG1A 1H72C 2IM2A 1LWFA 4ZPWR 3FS8A 2HK2A 5KG0A 3OR1B 2UVRA 3J7Z5 2OEJA 2VBWA 2M7SA 1HL6A 2W4DA 2JA1A 3FNNA 4X65F 4K4TA 1NK4A 4URGA 3UVJA 5EGYA 2EFPA 1TURA 4JV5J 3PW5A 3U27A 4ANDA 1KOHA 1S9FA 4K4ZA 3OBIA 2RMLA 1IQTA 3GV7B 1LR7A 1N13A 4ZOSA 1ZTWA 1S6OA 4UUXA 2LQ8A 4ZVGA 1ULNA 2ZHBA 2X52A 4ELVA 2B9EA 1FJGF 4B17A 4ES1A 2CZ9A 3Q8YA 6AT1B 1NU4A 1YVFA 2V4JB 2D3O1 3TW0A 3MMBA 4GRSA 1HNIA 1S9GA 2XO6A 3A3OB 4M5HA 3EX7B 1SBRA 4ZVEA 1CJVA 2DGOA 1ZPVA 3BXYA 1I6JA 3E2EA 2MTLA 3R2CJ 5B0EA 2G2ZA 3OVAA 5F3TA 3OFGA 2UXDF 4JI1F 4DLEA 2Y9HA 4KTQA 1QDUB 4IH7A 1S1XB 4IG3A 4MKAA 3FRZA 3ILJA 5IM0A 3MURP 1PYSB 4FF3A 1NK8A 2ZH8A 5AXKA 4QPXA 2YNHB 1ZA2B 1RAGB 3HHNB 4B3OA 1FHTA 2V34A 2CVEA 4LFCF 3UCUP 5AXMA 4FNHA 3UGLA 1MT1A 4N27A 1VBZA 3R1HA 1SKWA 4Y2IA 1S6PB 3BSSA 3JSMB 3FGVA 2MZSA 1FRLA 1WOOA 5LM7E 4DR6J 3OJUA 2JYYA 1P9QC 4CIOA 2EVZA 3UFCX 5BR8J 2DPJA 4UY85 3L9ZA 1HNVB 4NRTA 5KFWA 2EXUA 4USWA 3CNQP 4FXVA 1GT8A 2KRRA 5KG4A 2KMRA 2FUG9 3MR5A 5CZVA 5KFQA 3LGNA 4OYWA 4IUFA 1D1UA 1RWXB 5IXUA 2IFXA 2NR0A 2V0KA 1NH8A 1U24A 1RT7B 2YKPA 1TL3B 2HFNA 7AT1B 2FHMA 4L9MA 2BOAA 3MR6A 1U2FA 3FBFA 2LXUA 3BM7A 3MWBA 1M5PC 3CCJS 4RWXA 5HQ8A 3PX0A 2IRUA 2QL5B 3THPA 1DAXA 3DGPA 4K4SA 2P9GA 4LIRA 2DHGA 2V0NA 3OFHA 2F9DA 4DUTA 3MEDB 1CHOI 4CM2A 2WSEC 3G8QA 2ROEA 4FYDA 3SEOA 1B3TA 2LQ9A 4MTPA 1RISA 3D66A 3NAIA 1KDNA 1ZM3A 5JHWC 3IXCA 4A8WA 2MY8A 1P9YA 1Z4UA 4WP3A 2K2PA 2X3DA 2QLXA 2XMAA 1X5TA 2ILZA 1NPPA 4IG0B 2BDPA 3DOMB 2HZAA 3IS9A 4IR9A 1WTJA 2CDRB 2P6AC 2IMOA 1UKUA 3RB4A 2EPIA 1N8RT 3HVTB 1W4RA 2EKYA 4LSNA 3V4MA 1IKVA 4K2XA 1BY9A 2WLCA 1WC1A 1VC5A 3IC1A 1RBOB 2HBRB 3IA0A 3FJ2A 3VCDA 3PW2A 1T3OA 1PJ5A 1UA1A 3LQVA 1LW2B 4BWMA 4YB1P 4J9MA 4E79A 2VFRA 5HMXA 4ZVOB 3RB3A 2H4WB 2ENNA 2VQEF 3O3LA 3EICA 4PG7A 3HDSA 2KM8C 2GMHA 4B3SF 1FF2A 3TDTA 1S59A 3NEKA 2JLFA 1F5BA 4J9UE 5KT7A 2AEMA 1GEHA 4OYPA 2MKSA 1Z2ZA 3PDNA 4BHQA 4OX7A 5ADZA 2UV8G 3QMQA 1Q81T 3MECB 1IBCB 4TQSA 2ZNZA 3OH0A 2ZBRA 4G1QB 2MKYA 4ZS6A 4CRJA 1WC3A 2DISA 2KVQE 2ZBPA 1BXNA 2Z8QA 3AA9A 2EK1A 2D3OR 2JC1A 2CQ4A 1WF0A 2CPDA 2UUTA 3CC7S 4LF8F 4DR4F 3MM7B 3FCVA 2ACMA 4Q45A 2VV5A 6FDRA 1WI6A 2RNEA 4Y2AA 1UEVA 1XMBA 4ZP9A 3J7A1 3UR3C 3CD5A 1UVJA 2FVSA 3ISNC 2XLKA 2HWIA 3ETMA 1SJ3P 1ZAXA 4C3LA 1QD1A 4XPCA 1REVB 1N4IA 4ZP8A 2IAJA 3VGVA 1P6TA 1GAOA 1HI1A 3GYNA 2JXDA 4H4OB 4PXBA 4RWWA 3DMJA 1M5VC 4PZVA 1R7IA 1TKDA 4I69A 4F36A 1KEKA 4QCLA 3MEEB 1WG1A 5E3PA 4ATNA 4OYMA 3KHRA 2VL1A 2BE7D 3MPVA 2QYCA 4FXWA 3TNVA 4QWAA 2IJRA 2GKRI 1YJVA 5CD4A 1R0BG 4PAAA 2KHCA 3DI6B 3MI7X 4WBFA 1U6ZA 2DT9A 1WG5A 3CCMS 2OSQA 2ZHAA 2AZ3A 2Y0SD 1D9FA 3KYLA 3HMJG 2Q6BA 4O23A 5AJ3J 1FDBA 4OI1A 1UVFA 3GIKA 1UWAA 4KV8A 4ICLB 3LWMA 5DQHA 2R9LA 2ZZTA 3QJPA 3MM5B 1FNOA 3EZOA 1RAIB 2B9WA 3W62A 4KPCA 3ZNUA 4C8NA 1FRJA 1NDKA 3VF0B 1A6LA 4C98A 3R3IA 1F9HA 2VJUA 1MJBA 2CPYA 5A0YB 1KK4A 1HQUB 1Q95G 1NKBA 1N0UA 2YWFA 5GAGI 1YHQS 1NDCA 5D78A 3OTOF 4C4WA 3TOQA 2P5VA 3KWCA 1H3DA 3GVDA 4ZCMA 4EAAA 4DF4A 2XY6A 3D5MA 2WK4A 4ZVUB 2N52A 1BLUA 5FJ4A 3NY0A 5GADI 2O5DA 3KHGA 4DSKA 2HNYA 1TU0B 3UWTA 1EETA 2EI5A 2RRAA 2CQ3A 2MZ1A 2QSWA 3HHEA 3RR7A 3SCIE 2C3PA 2MQOA 1M8BA 4JV2A 4DFMA 5F9LA 2ACYA 4HUSA 1FA0A 3OXFA 4A8XA 2DXDA 2XY5A 3AD9C 1U2CA 2QO3A 5T7LB 5DRKA 3CO0P 5KFAA 1G95A 4RW6B 5HK4A 4KYZA 1IUJA 3BJYA 4FS1A 4Q43A 4ZA1A 4EQYA 4Q44A 2XGQA 3MM8B 4LRAA 1S97A 1ZA1B 3NNCA 3ECTA 3QTLD 4OZ5A 1WOSA 3BGFA 3TEGA 3I5BA 2CG4A 1YP2A 3V4IA 4IOAQ 2KYXA 1LWCA 2KG0A 2D9OA 1UJ6A 2GVZA 1RADB 4NLSA 4ID8A 1EARA 1N5QA 1ZAVA 3EJMA 4ZPCA 4LF1A 4UXJA 4OZ3A 1QE1A 1GX5A 2MZJA 3AOBA 4KHPJ 1VK3A 4U7UK 4PYAA 3HX9A 4HURA 5AXNA 2QIFA 4G3QA 2WGCA 1DRZA 4P75A 4AC3A 2QTWA 3KJVA 4EI2A 4KGXB 1MW7A 2KG1A 3MCNA 1IBMF 2KN4A 1R8PA 3JAMY 2KKHA 2QA4S 3UR0A 4DCOB 3LH2S 3RG6A 1WKLA 3NMRA 4F4WA 4J5OA 4PUOB 4DV4J 2BJ3A 4KO0A 1XA6A 3VAIA 2E5LJ 1X74A 3AQOA 3JAMU 1XX6A 4PQUB 2XMTA 2DR5A 1X7VA 4DCPB 1PJ6A 1WSVA 4DJBA 4JP8A 5HVGA 3OLAA 3T3FA 3TJAA 4H4KC 4EGLA 4U6PA 1KK5A 3KFWX 4B3RJ 5A76A 1KQAA 5B0DA 2ZVSA 3MM6B 4ZHRA 1Z2IA 3DRRA 2LYVA 1K7VA 2CPHA 2I0XA 4F8RA 1L3VA 1FDNA 2CJKA 3HI9A 3H5YA 1L5UA 1H98A 3OH2A 3R3TA 2JEGA 4ED1A 1M5KC 4CO4A 4AAWA 5LOQA 5L39A 2R2TA 3L09A 4R8UB 4AMLA 3MPWA 5HVFA 3OJSA 3TISA 4OYAA 2ODDA 1SL0A 4JCVE 3MAQA 2BKOA 1FRHA 3OR2B 5DG8A 3EZUA 2R8GA 4K5RA 3G96A 3CO9A 2YH0A 4DV5F 3HHLC 2NREA 1NSAA 5IT9Y 5DAEA 2PFFB 3MPYA 3NXZA 2Y3YA 1H7XA 3CE8A 2FVQA 4CYUA 5ETOA 2E5JA 2FKOA 1OY8A 1UTAA 1LWEA 5LJ5Y 4USKA 2QMUB 2YKMA 2J9EA 3KNGA 2NUHA 5E3RA 1UVKA 5IWAF 3MAHA 2H5EA 3JQMA 5IT9U 5C42A 1GNKA 4QZVB 5DQGA 4PKDB 1KD1T 2C42A 3K7RA 4URSA 4NCAA 4YN3B 1H7WA 4RW8A 4WYWA 3T6JA 4QR1A 2DGSA 1HPTA 4YQWA 5JJBA 1HR0F 1NUBA 4C7QA 3KLFB 2RHSB 3G6XA 3UGIA 2BKPA 4DX6A 1R6VA 1WHXA 3G4SS 3BSWA 3KG4A 1KQKA 1QTNB 3CT9A 3GB0A 1IBKJ 4I7FA 3ITHA 2F40A 3F1XA 4QQBA 3CULA 3THVA 1BHNA 5F8GA 2OI7A 4AE5A 5CCMA 2Z2LA 5HVHA 5LJ3Y 2DO4A 1LR9A 4WFNQ 2CPZA 3DFEA 5J1PA 3JYTB 4C6AA 3C14B 4USHA 4WKYA 5EWGA 1U02A 2E1MC 5H9FK 1VIOA 2FB0A 2A3JA 3W9IA 4X64F 1VK8A 4I6WA 3R5CA 1FRMA 1W2IA 2WLEA 1CJUB 4G87A 3QT8A 2B6AB 1JX4A 3ONQA 2QLJB 3BJIA 1JLQA 3C3LA 2IA6A 1RGVA 4DN9A 4EK2A 1KRRA 1FO1A 2CZVC 3N6NA 2XMWA 3EPGA 4JBCA 4DR7J 2YX1A 1QRFA 5GMEA 1B64A 3BBCA 1GK8A 1SVDA 2QSFA 3Q2SC 4X65J 5ETRA 4ES3A 3QGHA 2JNJA 1UUCA 1TGSI 3GFXA 1F0XA 4U8VA 1NHUA 4FNIA 3C15A 4ENOA 3NS6A 1R8BA 2V8GA 4UOHA 3DK5A 3DC2A 4ED2A 3IGJA 3EXCX 3P49B 4DSJA 2OVOA 4IFVB 4UQGA 1TL1B 2FZCB 3QYYA 2KXNB 1ELOA 4Z2XA 3VE5A 4O4RA 5GAHU 4N69A 1WDTA 2DNZA 3Q1XA 4NOHA 1W3SA 2VFSA 4FYYB 2W25A 3UPFA 3A8IA 2VPZB 1Y0HA 1K0VA 2UXDJ 1F9FA 1CPZA 4PEOA 1U1KA 1V3RA 3V81A 2J9CA 5I42B 1JLEA 3EGWB 3CIMA 4EYIB 2KB2A 3KLVA 2ZC4A 4NL5A 3DDNA 5DGAA 4X66J 4MIWA 3CMQA 1D8ZA 4OHXA 1Y5NB 4QJVA 4MYOA 3W60A 4NCBA 3L7OA 2RB7A 3HKZD 1R43A 5IQ6A 2NSCA 1IR0A 2QC3A 3OFFA 2FC8A 4PWDB 1PPFI 4ZITA 4I0WA 1S1XA 3AFGA 4HCQA 1MR9A 1FKAF 4AUKA 1JJ4A 1KS2A 2YNHA 4NYPA 1T3DA 5J2NB 4RUCA 5L6SA 3D6MB 3M32B 3U02A 2RF2A 1Z1ZA 3DRYA 1KHVA 1BE4A 4B9TA 2H5JB 5C2CA 1KBEA 3MQGA 1EQMA 2IVMA 1OMSA 3HULA 5CQGA 2N17A 2XSFA 4C8LA 1RAFB 3H4BA 4GO7X 1N56A 1HD1A 1IY5A 1TK0A 4YMEA 2XLJA 1REGX 3NCRA 2IJFA 3R7BB 4MMOA 4JUZA 4OZNA 5KFBA 3AAWB 1IM4A 2NPFA 3IGNA 2IYIA 2CNLB 2XS7A 1D0EA 5KFZA 3KK1A 2RS2A 3GSDA 2FPHX 2BE2B 4Z7CA 2VZ9A 2PD1A 1NM2A 3BGRB 3T5JA 4R0EA 2HNDB 3ICLA 4USVA 3MOJB 1JJ2R 4DV6F 2BUSA 2HEKA 4K4VA 1NB2A 3K17A 3KK3A 4ZKAA 3SZ2A 3KLIA 4C0BA 3CTRA 5ADXV 2UXCF 2MHEA 1J5OB 3C6TA 4F02A 1YRTA 3JXOA 3MEDA 3PR4A 4WFBQ 3CDAA 2VKZG 5KFPA 3D1QA 2MKKA 2ADBA 2FGOA 4KFBB 5JXSA 1WF1A 2NU1I 3I4PA 2GHWA 1BMQB 2HQCA 1TOTA 3SSQA 4H4MB 3D6HB 1LW0B 4A8FA 4NYOA 1Y9OA 4WWSA 4DV7F 1FK9B 2YNGA 4ES2A 3N79A 2ICXA 4HHHA 3RYLA 1U0HB 2DR9A 1EWWA 4LR9A 1N54B 2VDIA 5HMWA 1SIWB 5KFOA 3BGOP 3HVTA 2E5IA 4PG5A 4MYUA 2Z4PA 3GIMA 2WCYA 2AJQA 3BB5A 2ALZA 2POKA 4CH7A 4WP9A 5DEMA 3RBXA 1RTIB 3CJKA 1SGYI 1XJWB 4YR2A 1VQ6S 3HD2A 3B6BA 5J8FA 2ZUGA 4FZVA 3O1LA 3I55S 3DCAA 4J37A 3UN2A 5DM6Q 1B7FA 3U7JA 1DJ0A 2HHUA 1N32F 4OL8A 5H9EK 5E3AA 3SGBI 2UVWA 1N5YB 4F25A 2WRMA 1M5SA 2U1AA 4P6QA 4UTGA 1N52B 2DXEA 2ZFHA 5KFIA 2RRBA 1LXAA 2W0WA 3BPDA 4RO0A 2VB6A 3ZTRA 2NQPA 3T19A 1RTHB 4N6AA 1XEZA 5J8CA 2HQIA 3MECA 4NLVA 4ECXA 1PTRA 3IBFB 4O3NA 4G1QA 2Q1LA 3D28A 1FJCA 4YR3A 1SKUB 1D8YA 2HURA 3TR5A 4DV3J 4X4PA 3KWDA 4ZPAA 3IO1A 2HIQA 2MPUA 3VBIA 3QAHA 1XATA 3CCTA 2GJ2A 1FVQA 3BV8A 3FOQA 1HARA 4H4KA 1S5ZA 4DX8H 3MM7A 2DVIA 2BEFA 2X1FA 1XWLA 2AJ4A 4RUAA 5HQMA 1H38A 2QN6B 4LT6A 1ZPWX 2NZ4A 1ZM2A 3ZTSA 4ZVQB 1N5SA 5CYMA 4DPXA 1KBRA 2UVVA 3VHQA 4J9NA 1REVA 2NXJA 1C0TB 3TEHB 3VAFA 3ET6B 1KOOA 4H4OA 2VBZA 1W2BR 2W2MP 4ZJQA 5A2QY 3D3CJ 4EEYA 3FQLA 1HBNA 2OI2A 2YBVA 2C2DA 2JH3A 3M9MB 2ZVIA 1J27A 4ED5A 2DNLA 3PY8A 1FKOA 5HBMB 3TZZA 1WELA 4LFAF 2WLFA 2XY7A 7WGAA 3Q89A 3DI6A 3G8SA 2XEXA 4URQU 2EFQA 1E6YB 4CZCA 5A2QU 2XMVA 2CVIA 3OT9A 1S1UA 2RU3A 4MK7A 2WBRA 1CT0I 3EG4A 3UDCA 3OTOJ 1WWHA 4IOCQ 2LQ5A 4RBTA 1U49A 3T1HJ 4W92B 4ICLA 2DKOB 4WFXA 4MKVA 3HFVA 3AD8C 1DLOB 2VG6B 3KLGA 3H42A 1AZSA 2Y1IA 2BKNA 2IC3B 2MQMA 4MKBA 1OY9A 1UW9A 5A0YA 1HQUA 2LKZA 2RJZA 1OSDA 1K1SA 5DLFA 3V6DA 3GJRB 3O8WA 1Z7KB 3E01B 1R27B 3M2UB 4ZCIA 2DNMA 2VPYB 2XSJB 1RXOB 2DBBA 5KFYA 1J2VA 4PG4A 3C19A 2M2BA 1JLBB 1T02A 2FJVA 4NXNJ 4JI0F 5K8NA 2AU0A 4KPYA 3DLKA 1VFJA 4QYRA 3GE9A 4BC7A 1TVRB 2H48B 4C11B 2OEFA 1SQEA 4EUVA 2X3TA 2Y8WA 2DB6A 4A4JA 4NYZA 4IQMA 1G97A 2FJAB 5T7LA 4B9LA 2QT7A 2HLUA 3OU9A 4A8SA 4R0JA 1VHIA 2BQUA 4U7CA 4OYIA 1F1BB 4DL7A 4I2PB 1N34F 2GIVA 1X4BA 3MM8A 2FYXA 1WG4A 3KDOA 3UD4P 2UU9F 4MK9A 3S7RA 4HHUA 3NP5A 4B08A 3OW5A 2GAGC 4DQPA 3OTEA 2YQ1A 1HYSB 1TELA 3QQCD 1IBMJ 2IY5B 1WEYA 2NYHA 3ILLA 3P5BP 1U8WA 1NRKA 1VRUA 2BJ8A 2QQEA 3LPEA 2WW8A 4QWDA 4EBCA 3ZZZA 1OY6A 2YH1A 3I0RA 5LMUF 3MR2A 1HWLA 1U1PA 4DX5A 4N8NA 3GV8B 1Q86T 1MRLA 4HLBA 2E7XA 3GFHA 3RB0A 4CWBA 2KH9A 4PUOA 3BZQA 2GS8A 2LDYA 1QSYA 1RAEB 1RT1B 2N4CA 3NS7B 4ECQA 2C2MB 5J2QB 3SFUA 4FP9A 3MEKA 4HT5A 2TDTA 2W9BB 2EEYA 2F5GA 2WB4A 2M88A 2H51B 3H98A 1LK7A 1QAYA 2ZWPA 3ENWA 3M4XA 4PPZA 1E6VA 3ZZPA 4CCHA 3ENAA 3IRWP 2IYGA 1H2VZ 2ORWA 2IHR1 1YRUA 4N56A 1JKHB 2FZKB 1WHYA 1NBEB 3DRXA 4LF6F 4ZN3A 2RQCA 4MYTA 4QWEA 8RUCA 3KHHA 2VONA 1FY7A 3W5ZA 4L3NA 4DV5J 1LV5A 3W61A 4P2SA 2GHVC 3I3XA 1RT6A 4ZCLA 2FD2A 1JJHA 3G82A 1C2PA 2CWGA 5FUYA 2B4UA 4IR1A 3MFHA 3W8PA 2UZ3A 2LB7A 1C1CA 3TVYA 1L0SA 3OR2A 4KQLA 3IWNC 5IWAJ 3BGUA 1TIHA 5DG3A 2Q3PA 2RT3A 5KT3A 5CXTA 2A2DA 1LWFB 3J7YU 3TAMA 1RB0A 3GCXP 5KTQA 1OVOA 3N5BA 3UDVA 4IH5A 1YTPA 2HRTA 4GMKA 3GQ7A 3TA1A 3A3NB 4J9VA 1RCOB 3UVJB 1SV5A 4CI0B 4C97A 3CCUS 4YB5A 1HR0J 2BW7A 2ZH7A 1FE4A 3K58A 1APSA 3OTBA 2A10A 4EABA 1V3SA 5ETQA 3PYEA 2VICA 2WSFC 1CE3A 1NSKL 3KJFB 2B7BB 4K4UA 5KFDA 2RAQA 2JC0A 3HO1A 3HSZA 2GIFA 4JOUA 4JV5F 1THJA 1B0VA 1T9WA 3VAKA 5IS2A 3KLFA 4QPTA 2I1RA 4DPUA 2Z57B 1HNIB 4L72B 1S9GB 3JTOA 3EVWA 4UZCA 4PR6A 3I0SA 1NJZA 1M8CA 3VV2B 1AN1I 2BMBA 1CC7A 3AOAA 3D1OA 1H73A 4QIVA 2GJIA 3BSNA 5JVHQ 2CPFA 2U2FA 3JSRA 4IG3B 1YJ9S 3ZZYA 4EA8A 1DHMA 1HNWF 4X64J 5DO2A 4KQZA 1KMAA 4DCLA 2NU2I 4UF4A 2DK2A 3R6LB 3BO2A 4ZJLA 1NH7A 4B3OB 2UXBJ 1FJ7A 3FDSA 2DGUA 3UN3A 4X4UA 3CWJA 3LP1B 1MN9A 2LA6A 4CH1A 5ETPA 4RBUA 4M95A 4RZRA 1S1TA 2DH7A 2ARPF 5E5NA 3C14A 3H2VE 5IOLA 3MD3A 1LFWA 4JI8J 3CUNA 4YHHF 3G6VA 1NKEA 4HDHA 1YDLA 2ZOGA 2H4YB 3SSSA 1RT3B 4ZVPB 1CT2I 3OD2A 5CA5A 3A4TA 5D4OA 2FDNA 2YTCA 4NEZA 3OL8A 1CJUA 5FLXU 1RFHA 2B6AA 2HLTA 4L3KA 2OFGX 3M2RA 1X5OA 2H3EB 1XMOF 4RLEA 2BJDA 2MY7A 5HL7Q 1S80A 4DR6F 4MFGA 3G2XA 3TAPA 3ZZTA 1G7CB 4B3MJ 1QM9A 3FBCA 3PIPQ 3IRXA 2Z56B 4OZ0A 1KSPA 2EKNA 1CQNA 3PV8A 3PYDA 5AFUV 3QRRA 1JLFB 4DU8A 2O01C 5LXYA 3M8PB 1WOPA 3DGPB 1RAOA 4GC7A 1RP5A 2ZD1B 4M98A 2ADCA 1UMJA 3B4DA 3M8ZA 1URRA 5A6PA 1B4SA 3KNAA 1T11A 2XCAA 1TBNA 3PXGa 3N01A 3W8GA 4IFVA 2DNPA 4LREA 3DYAB 1TL1A 2HHWA 2W9AA 3W7BA 1M8NA 3GTYX 3HF5A 2FVCA 4P2XA 1OMUA 1TV6B 3K8VA 4NRUA 3IS9B 1TKXB 4FN5A 5ETTA 2Z2YB 2F8EX 5KFJA 4DDFA 5B09A 3KJQB 2QL7B 1RZMA 2FGCA 4LSNB 1T0TV 4OJ3A 2OJ3A 1EB0A 2XMKA 2R2SA 2VPWB 1F3FA 4UOCA 1SH2A 1XBWA 5KOWA 3G8TA 2AT1B 4ZIWA 5CCLA 3D67A 1H74A 4JV1A 1U25A 5D8HB 1C4AA 1V67A 1SCJB 3AJ2A 2OEMA 4PWDA 1U45A 2GO9A 8ATCB 1YTYA 4HTJA 2K06A 3TZYA 3BRKX 2V1CC 1Y8FA 5J1EA 3D00A 5HANA 1CC8A 3V6KA 3H2LA 1FT8A 4OHVA 5D77A 3ZTQA 5KFKA 1PKUA 3D3BJ 3T41A 3CMES 5DM7Q 4J9RA 5L9XA 1RT4B 1ZM9A 3W3SA 2ORVA 5E0OA 3FSCA 2QPOA 3IBCB 4KIAA 5K9FA 1KHWA 1G3OA 2W8KA 1RT5B 2L41A 2B43A 2BZ2A 4F26A 3PO5A 3D0IE 1NJYA 2OI5A 4DV6J 3UI3A 2H5IB 4ZIVA 3OXLA 1YP4A 1WACA 3CGIA 1IM6A 2FJBB 4E0DA 4KHRA 1G4CA 1RQ0A 2EFNA 4FF1A 2HZVA 5HN0A 1N0VC 2UXCJ 3AHPA 4RR5A 2HNDA 2QIAA 2E9RX 3R2DJ 3CJ5A 2R7TA 3CCVS 2IRYA 1N36J 2CPXA 2KVIA 2AKWB 2UUAF 3PHTA 3M6XA 4LBHA 3SV4A 1Z2LA 3IMQJ 4NZ7A 4DV7J 2NU0I 4NLQA 2ZBIA 2EK6A 4CLKA 1RWOB 2WOMA 3AA8A 4ZPDA 5KFEA 3SIPB 1F2HA 2GKVA 3CJ0A 4IRCA 4A48A 4E98A 4X4NA 1HW9A 2HHQA 3MC4A 2VJVA 2GQCA 3M1VA 4M1KA 4N41A 4C2MA 2ZWOA 1UPMB 4F67A 3CVKA 2Q6CA 2C2EA 1U0HA 2RUSA 3M05A 3CJ4A 5KFHA 2V8PA 4FCEA 4LRFA 1CULA 2XRCA 1HQ2A 1MSWD 1N32J 1K8AT 3VAHA 3C6UB 4IH6A 2GJFA 4M5LA 4Y3CA 4QW9A 1IR1A 3R0SA 4TKTA 4DMZA 4LR7A 3CDBA 3ISND 4C3KA 1DQ8A 3B4MA 5MLCV 2ZITA 3OTMA 3NCPA 2MLZA 5KFRA 1T03A 2D3ZA 5F8JA 2EBGA 3KY9A 4Z7YA 5FDLA 3TZWA 3A13A 3IWLA 5D15A 3HVRA 1SJFA 1EETB 3UE2A 2UVUA 1NMEB 1AW0A 1KHRA 1OYVI 2HK3A 3OHBA 3BDPA 1LOUA 4J9SA 3V6HA 1NJXA 1P8GA 2EWHA 1JMTA 3H0PA 1CLFA 1TL4A 4RU2A 1PJUA 2C1EB 1Y3JA 1S0VA 1SGQI 3U1MA 3TZXA 3IWXA 1T8EA 1Q9BA 2J0QD 2DRAA 5H9FJ 4AYBD 5DDQC 2FVRA 1KKHA 1SKSA 3TA2A 2LEAA 4K59A 5LXRA 5EUHA 3BKFA 1CT4I 2KXHA 3V4IB 1LWCB 4N5SA 4ECZA 4IOBA 2GX8A 2GVZB 2Z58B 4HGUA 3AXKA 3VNPA 2Z2ZA 2HQFA 2X3GA 1X4SA 1SC3B 2V8DA 4MK8A 2K3IA 1CEZA 1KRPA 4PWWA 1D3WA 3DGVA 3MMJA 2UUCF 2WSCC 1RWWB 1HI8A 4AXIA 1VRTA 1T9XA 2AGOA 1BUXA 4LFAJ 3G87A 3K0JA 2ZOMA 3I6PA 1HIYA 3J80Y 4QWBA 3ZTOA 2JJ4D 3D1HA 3LA0A 3OXGA 1C0TA 1P1LA 4USIA 3NWGA 3FBBA 3ZZUA 4JYAJ 2CWKA 4AA7A 1IN0A 4N77A 1KN6A 1W25A 4RW4B 4HHJA 4PXEA 5CABA 2QLBB 2F7VA 5HBMA 4ZVSB 3J80U 4NMXA 1CQMA 3R5JB 3RB6A 4AT1B 1AROP 3E8OA 4KPXA 1X9MA 4I6YA 1PG5B 4JI7J 2O1PA 4NEYA 3GOXA 2CPIA 2V2ZA 2XLIA 1TFYA 1YJUA 2B5JA 2CQ0A 2CXEA 2BE9B 2RH3A 3RAMA 2MJNA 1LR8A 1SSTA 3NLCA 2V9KA 3GIIA 1S57A 5B08A 4AL7A 2WAQD 1XERA 1TKZA 2OD1A 1DLOA 2V67A 4DV4F 3D68A 3X1LB 3GMGA 2XWYA 4KR0B 4JI0J 3W2VB 2QLFB 4M5DA 1CBKA 1OWXA 2B8PA 3UOEA 3R3RA 3D0HE 3M8WA 3HSDA 4ZHRB 3J7AN 3E01A 2MSTA 3M2UA 3SUCA 3DRRB 2XSJA 5K14B 4KJIA 1K1QA 5U47A 2R8KA 1YITS 3MFIA 4J90A 5L8RC 4F4YA 4Y65A 4WCEQ 3NRBA 2OPPB 1ACMB 7FDRA 1N34J 1N88A 1XN9A 1TVRA 2ERRA 2XM3A 4C11A 1RHUB 3SSRA 3Q86A 3G6ES 4RW9B 5GAGU 4DL2A 1TP7A 3WDOA 4K7QA 3CEDA 2EG1A 2PSZA 1UP1A 2GA7A 4CTAA 2DIUA 4NLTA 3HJJA 3VTIA 3LAMA 4CYUB 3MPDA 4I2PA 3W63A 1R0RI 5GADU 2BX6A 1Y1CA 2HVHA 3DRSB 2Q4JA 2ENZA 2CQCA 3LGHA 2CPEA 1YJRA 1TL7A 3N28A 5C42B 2M3DA 4OX6A 2J8SA 1M1HA 2C2OB 2ALYB 4E8UA 4FYVB 5LMUJ 3TAQA 3FZ2A 2DNRA 2J0WA 1SPBP 4J91A 1DZ5A 1HYSA 2JX2A 1DFDA 1MWQA 1I1GA 4RW8B 5L1KA 2O3DA 2F8HA 2X7IA 2QQCA 1JNRB 2QFIA 1KP6A 3ZC4A 4GI3C 5G4DA 4HZCA 2V53A 2PMZD 3QO9B 5E2QA 1X5PA 3K89A 3N4WA 3ITHB 1MG7A 2CQIA 3NOCA 2KL8A 3AB2B 1C4CA 1CG2A 2C2KB 1OYDA 3HK2A 1JK9B 4CLFA 3AJ1A 3PTWA 4XDDA 2Q43A 2ASYA 2YWHA 1V3WA 3F56A 4IDKA 2RQ4A 5ETNA 1FWPA 1AFJA 1IBKF 1ULRA 4DU7A 1UJ5A 2CKWA 2HGLA 4PABA 3SPTA 2W9BA 1YJ7A 4P2FA 1LKZA 4LF6J 2DHHA 2YWGA 3IR7B 3VQTA 2FJXA 2GGQA 1SL2A 4OQJA 4O3RA 2AV5A 4NZ6A 2SXLA 3ZZ0A 3OGZA 2KMOA 3KHLA 4E6TA 4DV1J 1TKTA 3AD7C 1JKHA 3GSIA 3PRDA 5RUBA 4TLRA 3K5MA 1KVIA 1QSLA 5HATA 3JS9A 4LSLA 4F50A 1FD2A 2CNOB 3D7SB 3CCWA 1S0NA 2NU3I 1TL5A 4TU9A 2N7YA 4KGZB 5H9EJ 2M4MA 4HDGA 2XS5A 5D3GA 2XBPA 2AX1A 3WX4A 3R8YA 4Y28C 1U1QA 2ATCB 1RAAB 3PW7A 1U8SA 2G9OA 4KNRA 2KM8B 2K7JA 3C15B 4DR7F 1D09B 3KXDA 4E1PA 1WEXA 2PGCA 4OLOA 2F9JA 5EN1A 3VQSA 4TNOA 1QUVA 2MYFA 2RDDA 4UOGA 2MKCA 5B0GA 4C8MA 3IBWA 4RUHA 4O3PA 1AUDA 1VQ5S 5ETKA 5EX3A 3PIOQ 3RAXA 1ZYQA 3CJSA 2PN6A 4L74A 3RW7A 4QYZJ 5CYQB 5KT2A 2KT3A 2HQDA 2F4FA 2DJWA 2LECA 1HM9A 3W5XA 4LF4F 3V81B 2FHJA 2LLZA 3MHYA 2DYAA 4WXWA 2VOPA 4W4MA 2B4VA 1JLEB 1HNWJ 2QL9B 4JI3F 2ZH4A 2FLNA 4A8QA 1MMNA 2V2KA 2KI2A 3I3AA 2IA0A 2OFHX 4DOZA 2J9DA 3SV3A 4FYXB 3KLEA 4YHHJ 4AQYF 1T05A 2KJVA 4ZN1A 2CADA 3S8SA 2HIYA 5KFXA 2KXFA 3M2VB 4A8MP 4X66F 1SGRI
chains in the Genus database with same CATH topology
3WZ0A 1B0TA 2B9YA 3SSQA 2B4PA 1JLAA 3LP1A 4AL6A 3VBMA 2RF2B 4H4MB 1RI7A 3KG0A 4MIAA 1R8HA 1LW0B 3QGGA 1XR5A 1NKCA 4A8FA 4QU7A 1U6FA 4NYOA 1GQEA 1Y9OA 5F8MA 5GVQA 3UD3P 2MDAA 4DV7F 1FK9B 2YNGA 3R1WA 4LMZA 4ES2A 2BM0A 3H59A 3N79A 2ICXA 4B02A 2OD6A 2W4CA 4Y00A 1RKJA 1F5AA 5A6WA 3RYLA 3KWEA 4DS4A 3OL9A 4F2RA 3HHDA 4WFAQ 2XZWA 2DR9A 2DHSA 1H0HB 5KFVA 1MMLA 3TRGA 5F42A 3QPIA 1QRMA 1N54B 1RT3A 3GIJA 5HMWA 4QW8A 2OAUA 3CDUA 3Q8SB 1SIWB 2J6UA 5KFOA 1VC0A 3M6WA 3M9NB 3HVTA 3MOZA 1D9DA 2DTJA 2HHHF 3SXLA 4HH1A 4DR2F 1QE1B 2E5IA 3QGPA 3NS5A 4PG5A 2ZH9A 4GC6A 1VBYA 4MYUA 2LQBA 1QY7A 2NYIA 2Z4PA 5J2PA 3GIMA 4C0HA 2CQDA 1KTVA 1DQ9A 3BB5A 2ASDA 2AJQA 2ALZA 3V4EA 2POKA 4CH7A 5C24A 2AQ4A 1TK5A 2ROGA 2RSQA 1YJWS 1S9EB 1DTQA 2CZ4A 2JL9A 5DEMA 1WHWA 1RTIB 2RILA 4U67Q 3NNAA 3CJKA 2N7CA 2R7OA 2EG2A 3KK1B 4ERDA 1Q1KA 2M8DB 3DXBA 4YR2A 3VBKA 3K59A 5D6GA 1KLMA 1VQ6S 2QA2A 3DHWC 4ID5A 4EO6A 3KJVB 1G2EA 2E29A 2V0HA 2A1BA 2BUNA 1O0PA 3I82A 2ZUGA 2A18A 3MM9A 3O1LA 4FZVA 3I55S 3QJJA 2HHSA 2W0VA 3DCAA 4J37A 4CO1A 2PA3A 2CJBA 5DETA 5DM6Q 2CFXA 2IUAA 2VA3A 3U1LA 4CO0A 1B7FA 3U7JA 1DJ0A 5E33A 2HHUA 1N32F 4OL8A 2VFVA 1ZTTA 1S6QB 1UW4A 4Q0BB 4EYHB 5E3AA 2KZMA 2JEIA 2UVWA 3KK3B 1N5YB 1H2UX 1HMVA 1BQMB 3MQHA 4KHPF 1Q8IA 3TANA 4F25A 1VGYA 2WRMA 2ZC3A 4HZDA 1M5SA 2U1AA 3FEXB 1O8BA 3DJ4A 4X84A 4P6QA 1JLFA 1N52B 2PO4A 3PFEA 3OQ2A 2KRBA 3M8PA 3KLIB 1X4EA 5BJRA 4EWTA 2ZFHA 4DL0C 2G1DA 4KO0B 4GKJF 3C6TB 2NPIA 5KFIA 3KLEB 4LVOP 3VZHA 1FE0A 2RRBA 2YNFA 1T05B 1LXAA 2W0WA 2N4DA 3LANA 2VB6A 1MR7A 3DRPA 3LAKA 4I2QB 4XAKA 2OMOA 2ZD1A 5DS7A 3T19A 3GQCA 1RTHB 1YSJA 3RW6A 2NQPA 4N6AA 1E6YA 5FD1A 1VQNS 2OD4A 1N5TA 2YKQA 2MSSA 1XEZA 2DHAA 4HEA9 3BR8A 4CO3A 1KQSR 2HQIA 3MECA 4NLVA 2MQQA 4ECXA 1C1BA 4OJ1A 1F5CA 1GH8A 2JEJA 4CT9A 1GTHA 2PMHA 2PC6A 2CJ9A 3R2WA 3FMWA 3T9NA 4CQ1A 4O3NA 1JLAB 4G1QA 2R2RA 4PPDA 1TAUA 1S72S 1L3SA 4TY8A 2JSXA 4OI6A 1I94F 2Q1LA 3D28A 2XHWA 1FJCA 5FLXY 1WTBA 1X0PA 5HO4A 2B56A 2YNGB 3DYAA 4YR3A 3PFOA 2R7WA 1D8YA 5F9NA 4NA1A 2VG6A 4XK8C 3TR5A 4X4SA 4ISXA 1TZ0A 1U09A 3WBZA 4X4PA 2BRLA 1T3NA 3KWDA 2RQKA 4ZPAA 2E5LF 3IO1A 4OZLA 1RTDA 2HIQA 2IC3A 2MPUA 3VBIA 3T9ZA 1TV6A 4OJGA 2XATA 1XATA 2M9KA 2GQ2A 3CCTA 1TKXA 4CH0S 3M8QA 2GJ2A 1FVQA 2DPIA 1VC6A 2ZE2A 4EFAC 3FOQA 1U1MA 2BANA 2R7VA 3HZGA 1HARA 4H4KA 2HNZA 4AL5A 3HVWA 5U2KA 4DX8H 3MM7A 2DVIA 3DOKB 4HTIA 1LXJA 3EUNA 3J7YI 2X1FA 2WONA 3EGZA 2UZAA 1RTJA 1XWLA 2AJ4A 1OPIA 4RUAA 3CCRS 1GXLA 4KHMA 4LT6A 4DG1B 1ZPWX 1X4CA 5J2PB 3VALA 2ICYA 1ZM2A 1URNA 1RYRA 2NZ4A 2IMWP 1SJQA 4MH8A 1N5SA 4HL9A 5C24B 1JLBA 3VZIA 5CYMA 2MZQA 1HM0A 2UVVA 3CJKB 3F41A 3CJ8A 4J9PA 4J9NA 2GGOA 5M2UA 2EC0A 3FSXA 1KLMB 4NLXA 2AX0A 4K4XA 1REVA 1YI2S 1RA7A 1YJTA 2JHEA 4B3RF 2B9XA 3Q22A 3MDFA 1HM8A 4O4GB 2BW2A 1U1OA 1C0TB 1NK6A 2RDJA 3HP6A 3VAFA 3KMSA 1KOOA 2E1AA 3S01A 1TUVA 4H4OA 2VBZA 1W2BR 3H4DA 2JZ5A 3BQ2A 1U1LA 1R8CA 5A2QY 2CJQA 3N9UC 3HLUA 2W7AA 2BACA 4EEYA 3FQLA 3GZ7A 1HBNA 2YWEA 1NNDA 2DGXA 1X4AA 2HS0A 2C2DA 2AF6A 1FKPA 2IM1A 2JH3A 4NLGA 3TP2A 3U1NA 3M9MB 4DSIA 2LU1A 4J9OA 3DU5A 2PI4A 2RU9A 1ZH5A 4ED5A 1NEEA 2DNLA 3PY8A 1KFSA 1FKOA 5HBMB 1WELA 3CB4A 4ECUA 3BEGB 4LFAF 2FLPA 3BS9A 1KR4A 1FXDA 4YUDA 3C66A 4QIGA 4OX9F 4LJMA 3M6VA 4KBIA 2WLFA 2E5HA 1Z90A 2YNFB 2XY7A 4QU6A 3TK8A 3JTNA 4M9CA 3DI6A 3DRPB 3G8SA 4PQAA 2XEXA 4URQU 3MUMP 2EFQA 2VA2A 3PX6A 1E6YB 4CZCA 1LWEB 3HSQA 2KT2A 3EZ5A 5H1SV 1NK5A 2XMVA 2YKMB 1DTTB 2CVIA 1Q8LA 1S6UA 5B7WA 1S1UA 2RIJA 2RU3A 2K8GA 3BF4A 4MK7A 2QZ8A 2WBRA 2P9CA 2CIMA 2YNIA 3EG4A 3UDCA 1R6YA 2XB2D 3TVZA 1WWHA 4Y6IA 4IOCQ 2LQ5A 1RT4A 1RJJA 4RBTA 5D4PA 5J1NA 3M30B 1U49A 4Q7AA 3H20A 3IR6B 3QZ8A 4W92B 4WJBA 4ICLA 5ITHA 4WFXA 4E75A 2XS2A 3G6YA 4DS5A 4M2BA 1DLOB 5DEPA 5DDRC 2VG6B 3KLGA 1RT5A 2OPRA 4TYBA 4F4XA 4ZPVR 4WZMA 3JSYA 2KJWA 2Y1IA 2LDIA 3SYZA 3K57A 1RTDB 2IC3B 2MQMA 4BC9A 4MKBA 3H40A 3DXSX 3P96A 5A0YA 2M8HA 1LK5A 1HQUA 2LKZA 2RJZA 2V0JA 1OSDA 4O44A 4WYLA 3P6YC 3I9V9 1K1SA 2ZE2B 5DG9A 5DLFA 3V6DA 2BANB 3O8WA 3KLHA 4DL5A