5E3PA

Crystal strcuture of dapd from corynebacterium glutamicum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
284
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
total genus 92
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3pA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3pA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3pA01
4KNRA 1S80A 4KPXA 4IHHA 4E6UA 1FXJA 3DJ4A 5U2KA 3VBMA 1TDTA 2IC7A 3OU9A 3TK8A 3R8YA 1HV9A 3VNPA 1XHDA 3KWCA 3OTMA 3FSYA 4M98A 4E75A 3R5CA 1QRMA 4KPZA 1KQAA 1QRLA 1XATA 2I5KA 2RIJA 3P47A 3R5BA 3EH0A 3MC4A 1V67A 4E1KA 3BFPA 3FSBA 3R5AA 3EG4A 3Q1XA 4HZCA 3I3AA 1MR9A 3NZ2A 3VBLA 1KK4A 2FKOA 3GOSA 4EQYA 5ADXU 4J18A 5DG3A 4R7PA 4EAAA 1KGQA 3MQHA 4N6BA 2IU9A 5F42A 3FSCA 3TISA 4MYOA 2IUAA 4G3PA 1MR7A 2OI7A 3FSXA 3OUPA 4FCEA 3VBIA 3V4EA 3BSSA 3FWWA 1SSTA 4MFGA 4EABA 1QQ0A 5DEMA 2WLGA 3T57A 4EA8A 5DEPA 2JF2A 2VHEA 5E3PA 4KNXA 2QIAA 5E3RA 3D8VA 3ECTA 4N69A 1KRUA 1KRRA 1KRVA 3F1XA 3R3RA 2IU8A 3R2WA 1KK6A 4AA7A 1QRGA 2V0IA 2WLCA 4E6TA 3DHOA 2OI5A 4HUSA 1SSQA 4DCLA 4HZDA 1YP3A 2V0HA 2ICXA 1QRFA 1FWYA 4M9CA 4R36A 2OEFA 3C8VA 1V3WA 3OTZA 3IGJA 3TV0A 3I3XA 1YP2A 2GGQA 3VBPA 4EGGA 3GVDA 1HM0A 3BXYA 4ISXA 3FTTA 2P2OA 1J2ZA 3CJ8A 2NPOA 3MQGA 3R3IA 1OCXA 5AFUU 1G97A 3HJJA 2WLFA 3TDTA 3BRKX 3KWDA 2WLEA 4G3SA 2TDTA 4E79A 4IHFA 3BSWA 3PMOA 3R5DA 4M2BA 2XATA 3FS8A 4EA7A 5L6SA 4M2AA 1MRLA 2AQ9A 4M28A 2OI6A 5E3QA 3KWEA 2V0KA 4N6AA 4R37A 4H7OA 4G87A 3D98A 2JF3A 4HCQA 1KK5A 4IHGA 4K6RA 3TWDA 3OW5A 4J09A 3SPTA 4MZUA 5L6VA 5AFUV 3R1WA 3DK5A 4M99A 2Q4JA 3GUEA 3P1BA 2QIVX 3VBJA 4EA9A 1T3DA 1G95A 2WLDA 1LXAA 4G3QA 3SRTA 4N27A 3VBNA 4AAWA 3JQYA 2V0LA 4HURA 3FOQA 1KGTA 1SSMA 1HM8A 2W0VA 4KQLA 1YP4A 1KHRA 3R0SA 3ST8A 3IXCA 4AC3A 3HSQA 3VBKA 1THJA 2W0WA 1HM9A 2GGOA 2OEGA 3EEVA 2QKXA 2ICYA 2VD4A 5ADXV 3TIOA 2V0JA 1Z90A 1QREA 3BSYA
chains in the Genus database with same CATH superfamily
4FNIA 2GVZB 1FE0A 2IAJA 3CTRA 3M8WA 4OYZA 3RW7A 3MD1A 5DLFA 1VQLS 2BJDA 4R5PA 1RUSA 1QAXA 1M0SA 4JI1J 4WP9A 1H7XA 2FUG9 2GX8A 2XLKA 1VIXA 3G9CA 4WE1A 2FNFX 3NCRA 1SCJB 1PGZA 2GAGC 1XHDA 4WBFA 4FKDA 4MKBA 3CD6S 4PG8A 4ZJQA 4I1TA 5KT6A 2DISA 2W7AA 1H38A 3H2LA 1VRTA 2B6AA 1VQMS 3FSIA 4B3TF 1T9VA 3AD8C 5KFQA 2HMIA 2D9OA 2NU1I 3PYDA 3MMBB 4NA2A 4TLRA 3T6BA 2YQ3A 2DR5A 1DURA 3CEDA 1TK8A 1NKEA 2W2NP 1VYAA 3KG0A 5HQMA 4QU6A 3PACA 2ADCA 3DKDA 1X4CA 2J6UA 1BLUA 1TKTB 4G1QA 1RAGB 3FSCA 3TISA 3PCOB 4USVA 5GAGU 3CCUS 1CULA 4G3PA 2B5JA 2R3VA 3TVYA 4DF4A 4JI7F 2YNFB 5T14A 3V4EA 1JLFA 1TUGB 4LSLA 4DR3F 5A2QY 2VG5A 4P2MA 2ALYB 4RPFA 4ZN1A 5JUMA 3MM6A 3HH2C 2VA3A 2QMWA 4NXNJ 5JMNA 3FKBA 4FXVA 4K4ZA 5E3PA 1QAIA 3H5SA 4CT8A 1B99A 1VRTB 3CJ4A 1KQKA 1DQ8A 2ZNZA 3IRXA 5LOQA 4F7VA 3OW2R 2MEWA 3KLEB 1A9NB 5IV4A 5ADZA 2XWYA 4ITSA 3QRQA 2ASDA 3W2VA 1EZZB 2I6WA 2VASA 3QIDA 2JFDA 4FN5A 4B3SF 3ELHA 3W7BA 4OJ3A 1CGII 4IQXA 2ALZA 5CA5A 2KFYA 1Q8LA 3TAMA 1HQEA 1L3SA 4GC6A 2HIQA 2WSFC 2V94A 1NHUA 5C7PA 2G2OA 3DC2A 3IA0A 2K1RB 2GIQA 4MAKA 1VCTA 1FD8A 2GQCA 3HHEA 3EICA 5J2PB 1LWCA 2Y9HA 1FKPB 3MEEB 5KFTA 4B9MA 4U7UK 2C2EA 1KBRA 4ZPCA 1WC5A 4JYAJ 3BH7B 2ODDA 5DGAA 2CPDA 4MFBA 3BRKX 1GX6A 2HBZB 1FY7A 2LMIA 2N17A 4UW2A 4WU3A 4DSFA 3LGHA 1HBOB 1JLGB 1PYSB 1Y10A 1YBUA 2COLA 3P8BB 4EFAC 4E1RA 2DPJA 1SL2A 2KI2A 3IMQJ 2WVCA 4LMZA 1TBQR 2MKKA 4RW6A 3M1VB 1ZZNA 2FJWA 1FAQA 2RNEA 4TLQA 4ZVHA 1JNRB 3BH6B 2E1AA 4ALZA 2RRAA 4QWDA 2OPQB 3X1LB 1RHUB 2XMJA 3KFWX 4FS2A 5K9FA 5AE3A 1RT5A 3D6TB 2AEMA 5KG2A 4QR0A 3EMTA 1FESA 2OVOA 3N9UC 4WJBA 3SCLE 4CLPA 3PKYA 1K9MT 1VRUB 3OXLA 2ROGA 1GFWB 2HAIA 5EX3A 2HQGA 4F2SA 3IG1A 1U09A 3QPIA 4Q5VA 2FVSA 4CO2A 3FBEA 1WOOA 3AY0A 2KFNA 2HVEA 5DAEA 2XO6A 2D9PA 2ZD1B 1WACA 2A0FB 1S9GA 2CPHA 3PTWA 5A0YA 1URNA 4HT7A 2BZ2A 2OEJA 4YQWA 3CDWA 1JJHA 4KV8A 4KGVB 5K20B 1SSMA 1MWZA 3O6QA 4TQSA 1NSQA 4LF4F 4K4SA 3GU0A 1SL1A 1WGTA 3ST8A 1RT2A 3IXCA 2IJFA 5DETA 4B3SJ 2QV6A 2RAQA 1Q81T 4DV0J 3EEVA 1RDRA 4ICLB 4NLWA 3RZAA 3BDPA 2UXCF 2O5DA 1FO1A 2CQGA 3E2EA 5AXLA 3PFOA 5HO4A 1V3SA 4XDDA 1M5KC 3EXCX 2HHUA 3BSYA 3H90A 4WXWA 4Q0BB 1S80A 3E51A 4KTQA 4M5GA 2H5IB 2ZDPA 4E6UA 4DQSA 2PQ8A 3OT9A 4F3OA 4O3NA 2F4VJ 4LRCA 3TK8A 4HR2A 4CWBA 4DLEA 3CE8A 2DGSA 1H7WA 1QM9A 1U0HA 2GJFA 3IP0A 3O44A 1FK9A 3QIPA 3V4IB 3VF0B 1ITPA 3G8QA 1E6YB 3IN5A 4ILMA 3H98A 4MPIA 1WG5A 3E3XA 1JLAA 4DDFA 1VISA 3MC4A 4L76A 3LAKA 1NO8A 2HFVA 3BFPA 4X84A 3PYFA 4ID5B 4K5SA 4ZVQB 1EKRA 5K8PA 1NK6A 4USWA 5D0GA 1MR9A 3VBLA 2FJEB 1BHNA 3ILIA 4G6VB 1QY7A 2ARPF 1C0UB 3B4DA 3ZFVA 5HMWA 3TZZA 1HBNB 4M94A 4X4VA 1WOSA 2PEBA 3KLIA 3MFIA 4FYVB 4TKTA 4DQRA 1TV6B 4ES2A 3GWCA 4ED3A 1VQ9S 4UXIA 1RXOB 1EJ7L 4KY3A 1FJCA 2CKWA 1HW8A 3MR7A 1FVSA 2DHGA 1C1CB 2VC0A 3BN7A 3KG1A 4I6WA 4UOGA 1B0PA 2MKIA 4JI3J 2C3OA 3FWWA 3PEHA 3ETMA 4DUTA 4EABA 4X65F 2BE9B 1H73A 1CJVB 2MQQA 1YJWS 1YBTA 1LR8A 1OWXA 2YKNB 3T57A 1FDAA 3IAS9 1NDCA 3WIUA 4B3OB 1KBEA 1D3WA 4DV4J 3UE2A 1VDHA 4W4MA 2KU7A 4LRFA 4OYMA 4URGA 1CHOI 2IRXA 2MZTA 1RK8A 4OX7A 1Z2FA 3ECTA 2V2ZA 3HHKA 1KRUA 1A0OB 1JLEA 4KT0C 4CLTA 4OZ1A 2CZVC 4AQYF 3KHGA 5GVQA 2NU4I 1CC8A 1OVOA 1RAAB 2WVDA 3KUGA 4HACB 2DNZA 1LR7A 2V5HG 2WONB 1X60A 4O0IA 3C2PA 2IVMA 2CJXB 1S1UB 3JQMA 2AX0A 4OX8A 3RTVA 1YX2A 1YJTA 2VODA 2NPIA 4Q44A 2KT3A 2DIPA 3MUVP 3OUYB 2GO8A 3ET6A 3F0NA 3BGOP 2AGPA 2MQ8A 4JI8J 4ZVTB 2LEAA 3G4SS 4PR6A 2EKNA 4RKUC 3NBPB 1X74A 3SDEA 3EZOA 5IQQA 3KJVB 2ZOFA 5BR8F 3GVDA 2YUUA 1FNMA 1VFJA 4IG0A 4KO0B 2MQOA 4QIFA 4DSEA 3UCUP 1XQIA 2WBMA 3TO7A 4HEA9 4RL1A 1FRXA 1GQEA 2NSBA 3QLHA 5KFDA 2W8KA 4OX9F 3NXZA 1D09B 2YPYA 1OMUA 4B9UA 3QRRA 3TDTA 2J0WA 1B64A 5F8IA 3ULHA 2KH9A 1S0MA 1Y5NB 2HURA 3KUEA 4TYBA 3PEJA 4LQ3A 1MMLA 2MKHA 3CIMA 3FS8A 1R89A 3HFVA 2VD3A 4L3NA 5L46A 1L3KA 4M2AA 4MIAA 1HNXJ 2OI6A 1MN9A 1MNEA 2C3YA 2K7JA 4WFXA 2N71A 3FZBA 1CJKA 1W26A 4ED4A 1YRUA 5HVFA 1KQGB 3W9IA 5KT3A 2B7CB 4FF1A 4CO4A 2VG7A 4OV6A 4K6RA 1G4CA 1WDTA 2ZH2A 3T5JA 2FDNA 3UEJA 1PCAA 4LBIA 2EBGA 2XMTA 4OQJA 4CM0A 5KFRA 1CQMA 3I5CA 2BQUA 3KDOA 4X4RA 3MM7A 4ERDA 4MIWA 4JV2A 1WDDA 3N5BA 2W01A 3SRTA 2Z57B 3BGUA 5A8RA 1OSCA 4ED7A 5EUHA 3GQ7A 1F1BB 1RTIB 4CT9A 3MCNA 4MH8A 2XQCA 1Q8KA 1KGTA 2OLWA 1PPFI 3HHLD 2E44A 2GIFA 1T95A 2IMOA 3OL7A 1H6KX 4ETZA 5B0FA 2IDEA 1AROP 4HH1A 3MMAB 1XEZA 2WW4A 4P7TA 1THJA 3M9MB 1WC3A 4RLEA 1Y9OA 3HSDA 5IWAF 1SKWA 2KMQA 1MW7A 3KNAA 2QKXA 1U5KA 2CVIA 2VD4A 2QMUB 4Q2LA 2VIHA 4MTPA 2UUCJ 4WYWA 8AT1B 4BC7A 2VFUA 3OJSA 4KNRA 1VLYA 3CJ3A 2C2OB 1TL4A 1V5VA 5FUWA 2KN4A 3MCOA 4GVBA 4DCOB 2OIHA 1ICEB 2FVPA 3DJ4A 2PN6A 3BBFA 4CP5A 3D7SB 3MM8B 2AW0A 4QWCA 2F40A 1CJVA 2QL5B 2AX1A 2FYXA 5D4NA 5EWGA 3PRVA 3W8GA 2AGQA 4ELVA 1UVNA 3VNPA 2FJBB 3KWCA 4LSNA 3G82B 1KVKA 3M2RA 4ECUA 4ELUA 2ORVA 4R0EA 5HP1A 2FHMA 5J8FA 1Y3KA 4OI6A 1NUEA 2QQ0A 1XMOJ 1T03A 4L9MA 2A2DA 1RWPB 1KLMB 1FT8A 3CIZA 1TUVA 2J9DE 2DY1A 5C24B 3V5RA 3R5AA 1TL1A 4PG6A 4K4TA 4ECQA 2YH1A 1G3OA 3MEGB 4OX6A 5HN0A 2XY7A 3KMQA 4OV1A 3UR0A 1ZM3A 4F50A 4MKAA 1JK9B 4QU7A 2ACMA 3PW2A 3A13A 1CSOI 2MZQA 3BJIA 4FYXB 4DHVA 4IYQA 3S6EA 2W8LA 1TKDA 2DNYA 2ZKUA 2LYVA 3S8SA 4GKKF 4JV5F 3IAM9 4WP4A 3DM2A 3VVUA 4XPCA 1BMQB 3UN3A 5CYMA 3M30A 4DQIA 2VOOA 2QQEA 3JYTB 4YB1P 2H1YA 3EZUA 1RT4B 1Q86T 1UKUA 2IJNA 1S76D 3IR5B 2KCXA 4RNHA 1ZBTA 4A8YA 3I4PA 4YN3B 2PMZD 3OTOF 2VDIA 4HH0A 4RWWA 1XJWB 3P3DA 4I7FB 4BWMA 3US5A 2QA4G 3WC0A 1I3OB 2MZRA 1RTHB 2V4JB 3K59A 2KZZA 3RRKA 3D8VA 5F8LA 2BMBA 2M4MA 1N36F 4LF8F 4USIA 4X62J 4OZ2A 4Y2IA 4HT5A 1RTZA 3UVJB 4AA7A 2BM0A 2BBEA 1LNQA 2V50A 3M6UA 5HAOA 4BWJA 1RTDA 1NLKL 1H3DA 4Y6IA 1NDLA 4OYIA 3CO9A 4M95A 1ZS6A 3H7HB 4LIRA 1LW2A 2KYZA 3GIMA 3QQCD 2H4YB 1SSQA 3TO9A 2E5IA 5D3GA 2AKWB 1H2TZ 1HWUA 2DEIA 2F7VA 3IO1A 3M8ZA 5KAKA 3HVTB 5HATA 3V6DB 3EPGA 5HP1B 3Q83A 3TYTA 2QE5A 4J9SA 1RWOB 2XZDB 3IG1B 3AA9A 1BQNA 1T02A 3NRBA 1CT4I 4EMDA 4QYZJ 4IR9A 5IWAJ 1RT7B 4ZDNA 8ATCB 2QG9B 1FI4A 5D15A 4CRJA 3A4TA 4I0WA 2OSRA 1UVLA 1N33F 3UR3C 4ZIWA 3MAAB 4JI0F 3OQ2A 4KRWA 2JLGA 2BE7D 5ETSA 3BGLA 3LP2B 3CUNA 3CVKA 3PO4A 1V9OA 1ZM9A 4P72A 2OPPB 1KSPA 2WONA 4B9NA 2Z2LA 4WWSA 4K4UA 1TMMA 3Q8SB 1WG1A 3CNQP 2FJVA 5B0DA 3MMAA 1SKSA 1YRTA 4LF2A 1MJBA 2Y1IA 5KFWA 2WTFA 2OD6A 4LFCF 1WTBA 2MKJA 3IFEA 1SJ1A 3T1HJ 1KK5A 4PKDB 2UZ3A 2H4WB 1EETA 1F3VA 2XHWA 3CGIA 3NOCA 5GMKa 5EWFA 1U49A 4W92B 4MZUA 1FNOA 1Q8BA 3QRPA 2XMWA 1XWLA 5D8HB 2UV8A 2AEFA 1V6HA 1TTHB 4NLDA 5HROA 1X7VA 2VICA 4DV1F 1VC6A 4ZP8A 1F5BA 2V34A 4LREA 4BDPA 2N1AB 4N77A 4YFUA 1VHFA 1QUPA 5C5JA 2W0VA 2JEIA 5KFFA 1CT2I 1SIZA 2ABYA 1CJKB 2DIUA 3M6XA 2E66A 3MF5A 3MTKA 4KFBA 4F4KA 2W0WA 4UXJA 2EXUA 4MMOA 3M2VB 4O3QA 3DYAA 2ICYA 3KLEA 1S5ZA 3CJKA 2FZGB 5M2RA 3DMJB 4CO3A 1JMTA 2RILA 4K2XA 1CS4A 4WP3A 2GMHA 4ZP6A 3T41A 5L39A 2UVUA 1OMSA 4QW9A 1JLQA 2PDAA 1FJ7A 4ZPWR 1OIAA 1UP1A 3N28A 2IM2A 3DOKB 3MM7B 4C6AA 1XMOF 2DRBA 3H20A 2DR8A 1Q53A 2KXFA 5KTQA 3LGNA 1TIHA 4ILRA 1YG0A 2VV5A 4LSLB 5THWA 3TJ9A 4ATNA 1YIJS 1HI0P 4GKJF 4LR7A 2AGOA 2KHDA 4E75A 4H4MA 1QRMA 4YHHJ 1HBUB 2BOAA 2YX4A 2VQFF 4AQYJ 5LSOA 1I51B 4A8XA 3EH0A 1Y5LB 3CMQA 2HFZA 4NPOA 3FSBA 3MPYA 4OYAA 4RW8B 4B3MJ 1C0UA 4LFBF 3CJKB 2XHCA 3U1MA 1PYTA 1Q7LB 5ADXU 1QJHA 1S99A 4ETXA 5KFZA 4UF4A 2ERWA 1CJUA 1NEEA 1UFKA 1NDKA 3N6LA 4J5OA 1NK8A 2ZE2B 1RTDB 2BKPA 1FHTA 2HHHF 2ASYA 3JSRA 3H2VE 4O4RA 1LEOA 2QA1A 1S77D 2F3CI 3I0SA 2NXCA 3DOLB 3OFHA 3K5NA 1UVGA 1IY5A 1IBLF 4AL6A 3QAEA 1SB6A 1QD1A 1RWXB 2EWHA 2Q79A 3CDUA 3U02A 1Q16B 9RUBA 1Y11A 1WEXA 1LOUA 1BD6A 3SDEB 2B56A 2LKZA 3Q2TC 2EPIA 4QPXA 1IR0A 4FYYB 1RAOA 1GEHA 3L4BC 5LXYA 1WEZA 1J5OB 3P5BP 4OZJA 1HHTP 2BOPA 2I5JB 2I9SA 3ZNJ1 2HFNA 2AJ4A 3CULA 2JZMA 1UW4A 1SH3A 1ZAVA 1O6XA 2H5EA 3DLEA 3SQGA 3WX8A 3K58A 4O0NA 4RW6B 2WVFA 4DQPA 2KM8B 3NAHA 2R2RA 1N5YA 2DR9A 4M5IA 3VTIA 2M8DB 4CH0S 4FKYA 4H4OA 2DGWA 1CEZA 4DL4A 4HZDA 3DRRB 2U1AA 4H4OB 5D6GA 5LJ5Y 2G1DA 3LQVA 3K5PA 4ES3A 3J7ZT 2PEHA 1Q5YA 4KSEB 4IR1A 3M8YA 1CGJI 4ZHRA 5CD4A 5A8WB 5AJ3J 4ECZA 1FRLA 2ZOGA 3EYZA 1FJGF 3IM8A 3Q8YA 4C8LA 1N5VA 1KEKA 2NPOA 2W0TA 2AV5A 4ZPBA 3N0VA 3SGBI 2B8PA 1G97A 1RB0A 2ZBRA 3MM5B 4CO5A 3CCSS 1FFWB 3FC3A 2ZUGA 2DXEA 1X4SA 1WF2A 4KKOA 2QEXS 4IHFA 2LA6A 2CQDA 2JW6A 4IFVB 1TV6A 3IWNC 2PI4A 1FVQA 4U8VA 5GAEI 4RNFA 4KQZA 2RQMA 2XSJB 3OLAA 3TW0A 1U48A 4M5JA 2IVYA 1EQMA 1R8HA 4ZPAA 3MDFA 2EFVA 3B4VC 3FRZA 3VDPA 2XGPA 2XLIA 1HWIA 1HWKA 2EG2A 3MZIA 1WF1A 5HK4A 1OYVI 4IOCQ 1CJTB 1EB0A 3EUNA 4ZLJA 3RRHA 3SFGA 2FY8A 2V8PA 4CLLA 1CJUB 2W2OP 1X5SA 2Y1LB 4F0HA 3G96A 1U1KA 2IM0A 4RNNA 1YLXA 3L7UA 2NXNA 3MI7X 1FWPA 2GZOA 4XAKA 3C46A 2IFXA 3MMCB 4Q8EA 4RR5A 4R25A 1HJAI 4ZVRB 1S79A 3D3CJ 5BYSA 4FPRA 4JBCA 1FRJA 3G6ES 5T7LB 1YJUA 4DZDA 1U6ZA 2KRBA 2O3DA 3DDIA 1HBUA 5K8MA 2PSZA 2ZZMA 2V0LA 1U02A 3D6MB 3DRPA 4NWBA 3T1YJ 4K0KJ 2BRKA 3AJ1A 4DR7F 2WVEA 4AC3A 1H0ZA 1RADB 2OPQA 3TEGA 1C1BB 1IVZA 1IBMJ 2ILZA 4AYBD 5CCLA 3GG1A 2R7WA 3MMBA 1RYSA 3OXGA 2B9WA 2JC0A 2CYYA 1GXLA 1OYEA 4CO1A 4RO0A 4KJIA 2YX1A 4LF6J 3RG6A 3T9ZA 3SSSA 2J8AA 1SC4B 1UPMB 4PZVA 4C7QA 3CCMS 1JLFB 4RBTA 2H65B 3IBCB 1U1QA 2J7UA 1IBMF 5CHCB 3QTLD 3VAIA 2BX6A 3TAQA 4G65A 1XATA 5G0RA 5A6PA 2YPZA 4G1PA 3DDKA 3NMAA 1S20A 2VL1A 5HMZA 4DUZF 1KOOA 4PQUA 1IN0A 3VDUA 3A8KA 2CQ0A 1YJ7A 3GOSA 4Y2AA 1DLOA 3AOCA 3VAHA 2BUSA 2DNQA 3JQKA 3FMBA 4EAAA 5A6WA 2HEKA 2NUHA 1SGYI 4RBVA 5IS2A 4HGUA 1RFHA 1S1XB 1RAIB 2LU1A 5B0CA 1P6TA 1MJAA 3TR5A 4U67Q 2X1AA 3W9JA 3GV8B 5KFJA 1Q7YT 4ELTA 3ITHB 4HTJA 3RB0A 2CQ1A 4ZPDA 3VBIA 3GZ7A 2IJRA 5DM6Q 3SV3A 3M32B 3BSSA 2CIMA 1VGYA 2UUAF 1U6BA 3F44A 2Y0SD 5IC4B 2CJQA 5J2PA 1QUVA 2HAFA 2F5GA 4FXDA 2C2ZB 1MT1A 1NHVA 2DGUA 4W98A 5E33A 5F9LA 2JF2A 1UJ4A 3OXFA 1Q5VA 2SGDI 1RBAA 2VFVA 2LFVA 2P6TA 2YH0A 3FNNA 2GJ2A 3CJTA 3FQLA 5G0RB 5KG1A 2JRSA 2PA8D 3GR0A 4QOTA 4BCAA 4OJHA 2E9RX 1TOTA 1H98A 1R6YA 3I0RB 5J2QB 5F3ZA 2JHEA 1IM6A 1PBAA 3R2WA 2QRRA 1NK5A 3PO5A 4V19J 5H9EJ 1TQLA 2OMLA 5C25A 3UEYA 5HMYA 2JWNA 5DDOC 4WCEQ 3J81Y 2ZZNA 3U27A 1U45A 4C2MA 4A47A 1RKJA 1F9HA 5D0RA 3B78A 5C2CA 3E01A 5I3UB 2R7TA 4MT1A 5KG0A 3TJ8A 4B17A 4YHHF 4R36A 1SC3B 1UA1A 2SGPI 4JP8A 4E2FB 4YR3A 1N33J 1FK9B 3QMQA 2WSCC 4I2PA 2B9XA 2J5AA 3GJSB 4M5KA 1U26A 3MM6B 4NOHA 3R9LA 2D3OR 1NK4A 1N8RT 2CJKA 2ZKTA 3CO0P 3FTTA 1IWAA 1S6QB 4IG0B 4KO0A 4ECSA 1N48A 1NPKA 3B54A 1I5OB 2JL9A 1N36J 3DLBA 4DG1A 4U95A 2D74B 1RTHA 2HVZA 5KFVA 3MEDA 1UA0A 3MAQA 3GILA 2FZCB 4NZ0A 3SCJE 3BQ0A 1NAQA 2I2YA 3PMOA 3MCMA 3P6YC 3UO0A 2B51A 3DFEA 4ENOA 3BPDA 1OJ4A 4YMEA 5KFLA 5CAAA 1CT0I 2IY5B 2J87A 2NPFA 3SEOA 3H42A 3DOLA 2C42A 1Q0NA 2LQJA 1O51A 1RT2B 2OD4A 3L09A 3LANA 3PJXA 2V0KA 4N6AA 3RUBL 3GCXP 2IIHA 1UVFA 1WSRA 3CJRA 3D6FB 1C0TB 2ZOMA 3F56A 2FJDB 2JXDA 3Q24A 1TFYA 4ZITA 4C8YA 1RT3A 3OW5A 4ZOSA 2F65A 1NCLA 2XZTB 1Y0HA 4A8OA 2BXJA 2P5VA 3D68A 3NG8A 5IT4A 5F8JA 2QGFB 3GUEA 2W4DA 4LRBA 3DI6A 2N82B 2Z2ZA 5L1IA 3DDNA 1VBZA 5HJXA 1XMQF 4RUAA 2DNNA 1ZZFA 4KKOB 3OLBA 2XZWA 2E5LF 3FOQA 2UUTA 3BQ1A 4TXSA 4DBQA 3CJQA 1YP4A 1FRIA 1VR6A 2FLOA 2V2KA 5E5NA 3SFUA 3TQ1A 1B4SA 4RW7B 3R7NB 4NLPA 1PAUB 2OELA 3VBKA 4JI5J 4I67A 1WKJA 3M1VA 4IH7A 3HZGA 1CVJA 1HBNA 3OTDA 4KPYA 4LQ9A 3H0PA 5J2NB 4ZP7A 5KFXA 2L9NA 4NCGB 4ZMMA 2L8EA 1GMWD 2BDPA 2ZBQA 4IRDA 2MY7A 3I6PA 4D3GA 1DHMA 3VAFA 3DHWC 2OFHX 4KPCA 4X4UA 4KPXA 4NMXA 1XC9A 4R0JA 2WRMA 2P6AC 3WQPA 3PW5A 2W7PA 3NWGA 3AOBA 4PWUA 2AT1B 1N32J 2X1GA 2Q1LA 4IO1A 3D0HE 2H54B 4DL7A 4JUZA 1XBWA 2POKA 1Y1CA 2K1RA 4WU2A 3M9NB 2WCXA 1RKIA 1N6QB 3NL0A 1T9XA 1M8BA 4E8UA 4KGZB 5KFCA 1X4GA 2IA0A 3C15A 3U1NA 2CZ9A 4DG1B 1HQ2A 1SUQB 3SSQA 1Q1KA 2GVDB 2HNZA 2VFTA 2FC9A 4EQYA 5DQHA 1Z2LA 2D3O1 3QGHA 1KWMA 1KOHA 1MU2A 2HWIA 2XMMA 1HBOA 2FGOA 3EXYA 4ZA1A 4DJBA 4PCQA 3EJMA 3HHDA 4LUBA 2KG0A 2A6OA 2IU9A 3P5TL 1R8PA 4TN2A 4O4GB 2AQ4A 4WFNQ 1FRKA 1S1XA 5SUHA 3UDLA 5ETPA 5AXMA 2PT0A 4ZLPA 4NXNF 3Q89A 2MQPA 1V3RA 2ZVSA 3FEYB 5HBMB 2EVZA 4AMLA 4FDFA 2G0IA 2X3DA 1QQ0A 4C3MA 4DV1J 2U2FA 2MHEA 4IDKA 2WLGA 3C6TA 5KFIA 3KK3A 1S10A 2V9WA 4QIGA 4BHQA 1F5AA 1H2UX 3MCSA 3QSYB 1SJFA 1ZPWX 2PFDA 2O1PA 4DV0F 3HP6A 3A8JA 1BQMA 3M8QA 2BABA 5G4DA 3F1XA 2K3IA 4JI4J 2OI2A 1KK6A 3D54A 1QRGA 2VBYA 2CPEA 3NCPA 4RWXA 3T5KA 3HHLC 1HYSB 3IR7B 2F9JA 1ROFA 2NXUA 4FXWA 2N52A 4Q7AA 2B43A 4BBYA 4NLTA 4MKYA 4USMA 3P49B 2VPWB 1ZA1B 4EWTA 2F8MA 3KYLA 3A3PB 3ITHA 3HT3A 3TZWA 3BO2A 2BEFA 3KJFB 3DYAB 1RAFB 4QBUA 1V3WA 1JB0C 2LQBA 4IG3A 1NU4A 4FZVA 3OJUA 1VBXA 2DYAA 3AQOA 1HM0A 2J76E 2E1RA 1WELA 2YKPA 2Y8WA 4JOUA 4RW9B 3TUZC 2XY5A 4N76A 2B4VA 2ATCB 1UWAA 3ICLA 3GJQB 1UVIA 4PQUB 4IFVA 5KFYA 4ECWA 2MPUA 4QIEA 2CNLB 1VJWA 3BSWA 2EI5A 3PIPQ 1RU1A 4M2BA 1EARA 3ADAC 4DV6J 2V8GA 2LXFA 1TELA 2OFGX 1S4FA 2FIUA 4UOFA 5EWEA 3OPKA 2WB1D 4JI5F 5KFPA 5GMEA 1SJ3P 1AUDA 5B0BA 2BJEA 4Y65A 4LFAJ 3J7YU 2UU9J 5KT5A 4JI3F 4C97A 3EM1A 3MTJA 1LFPA 3M8PA 3PHEA 2HBYB 1WSVA 3ONQA 4X4QA 3R1LA 3L3CA 1ELOA 2X52A 1RCOB 1U6FA 4NCGA 5AT1B 2FQQB 3HD2A 2C2KB 2A1BA 4P2XA 4EK2A 1X9WA 5D77A 4R5PB 4E0DA 2C2DA 2J9CA 1NJZA 4A8QA 1F5CA 5I42B 3SQGB 3MAAA 4CLZA 1GXTA 5KFNA 4OYBA 1S7IA 1MSWD 1RYRA 1T03B 4F8RA 3OH0A 9ATCB 2YX7A 3GQ8A 4UY85 3M2RB 4DPXA 2GVIA 1FFGB 1VQYA 1RBLA 2CQ2A 4LIWA 4WF9Q 1DY3A 4EO6A 1ZM2A 3R0SA 1B70B 4M5LA 2GMLA 1O5JA 2YQ1A 4N8NA 4C98A 2XCAA 3HSQA 2F4VF 1TUSA 1OQ3A 1OQ6A 3TUJC 2MQLA 4X4OA 2M7SA 1RHQB 2GMJA 2YNHA 4IO9Q 1VDDA 3LP1A 4L72B 1M1GA 4X66J 4TQRA 2A10A 4J9LA 3GFXA 5A2QU 1M90T 2XI3A 3BB5A 4RW9A 5CCMA 1N5YB 3ENWA 4ZP9A 1VQ6S 2E5JA 2ILYA 2YXLA 1N88A 2F3JA 3DLKA 4ZLLA 5CD4H 5L1JA 4DS5A 1ZTTA 2SGFI 2RC4A 2H9ZA 4CTAA 3TOAA 4EGLA 4RUHA 2DNKA 5K8NA 3FSYA 1TR0A 4YB5A 3SGQI 5E7OB 3TZXA 3T5HA 1EQ0A 3BGRA 1KQAA 5H9EK 3C8YA 2DXDA 3PW4A 3NOGA 1UMJA 3B6BA 1KS2A 3W65A 4OYXA 4DV7F 3FCWA 3OTCA 1X4EA 2AZ3A 4NA1A 2PE8A 2UV8G 4DPYA 4K4YA 5KG3A 2DITA 1FDNA 4X4TA 4UQTA 1B3TA 5C25B 3T5LA 3G87A 3MPVA 1DRZA 2R7XA 2FLPA 1DTTB 3C16B 4A48A 4XK8C 2BE2A 1IKYA 3UCZP 3GYXB 1KC8T 3SZ2A 5F42A 3CCZA 1Y5IB 1Z1ZA 3D66A 2V0NA 4MYOA 2YBVA 3NS7B 2IUAA 3GTYX 5DO2A 3VALA 4GVBB 1REVB 5K14B 5IFMA 3FUYA 1N34F 3FMWA 2EK6A 3E01B 4NEYA 4QZVB 1Q95G 2Z30B 4KC5A 5I3UA 9WGAA 1SSTA 1FDBA 4WK1A 3BYPA 2EFNA 2E9TA 2DK2A 3DRYA 1UVMA 1AUSL 3GJRB 5IC6B 3HSZA 3BSOA 4DL3A 3RBDA 3TUIC 1QE1A 3VGTA 2MKCA 2ATLA 1NZ8A 1UWBA 2XNRA 4LR9A 2OEKA 3OVSA 3J7A1 1I6JA 3KLGA 1KRRA 3OD2A 4FYDA 1KQFB 1RWMB 3DLGB 3RAQA 2GVDA 3CJ2A 3U1LA 2F4FA 4UQGA 1FKOA 4ANCA 4DUZJ 3W60A 2G0JA 3MD3A 3UFCX 1SXLA 2YNIB 2YTCA 4ZIVA 1YITS 3IBFB 4CIOA 4IRCA 2UUAJ 2RU3A 3BR9A 3DOMA 2BQRA 1UTAA 3CCVS 4V1Ak 2V0HA 1HQEB 3O8WA 1FWYA 5DG7A 4K50A 1JXVA 2BR0A 1SGQI 5HQ8A 1J27A 4SGBI 3K5MA 2MDAA 3K89A 1WF0A 4PPDA 3JSMB 1D9DA 4OX9J 1OMTA 2YWEA 2VQEF 3I5BA 5F0WA 3OVOA 3R2CJ 1OCXA 2N4CA 4TY9A 1XR7A 2WLFA 3CJSA 3G71S 4GRSA 2I1RA 3KWDA 2WLEA 1GX5A 3AD7C 1D9AA 2NXEA 2HQCA 2LXIA 4TU8A 2UXCJ 5D0EA 5KOXA 3HZEA 3H8YA 3R7BB 3A1YG 1DS3I 1FE4A 2XNQA 2JOQA 4QR1A 4RW7A 1U7LA 3W5XA 2YY3A 3Q8RB 1AYEA 4M28A 4ZPVR 2KVIA 2GHPA 2MSSA 3T1YF 3FRYA 4O3OA 3J80U 3EZ5A 2R7RA 4JI7J 2X1FA 3W62A 2Y1RI 1K47A 2YKOA 3UNYA 2KB2A 3ET6B 4HCQA 2B9EA 2APOA 2ZC4A 3OVBA 5KOWA 5E3AA 4N56A 2LEOA 2OMOA 1X4FA 2OPRB 1W3SA 2IM1A 2I38A 3I32A 4P6QA 5CZVA 3ZZPA 2N7CA 3KK2B 4FF3A 5RUBA 3OGZA 3OH3A 1AXQA 4M99A 1R31A 4I2QA 2VC1A 2PI5A 2HS3A 4DR7J 1G95A 4C11A 3E59A 4X65J 2QZ8A 4TU7A 1QAJA 5F8NA 2ASJA 2IHR1 4DR6F 2ACYA 3QGPA 3ZZTA 4USHA 4KQLA 1L3VA 4M5NA 2FLLA 2GFFA 1X5OA 2KM8C 2JEGA 1GNKA 5J2NA 2GGOA 3C14B 3V6DA 4OZ0A 4Y2MA 4HI2A 4ECRA 1TBOA 3DLGA 3S7RA 1EETB 1K0VA 1FEEA 2XO7A 2HSEB 2XEXA 1S57A 2SGQI 2GKTI 2CQCA 3EGNA 3PXGa 2R8HA 4IHHA 4I68A 1S1UA 4QIVA 2FVCA 3HHLA 2IYIA 4F26A 2HHPA 2NSCA 2RJZA 2LEBA 3IWLA 4PEOA 2DNLA 2C3PA 4KHRA 4F0KA 1K8AT 4DV7J 3BO3A 3BYRA 1FEHA 2VPXB 4RU2A 1HNZJ 3T3FA 3HXMA 2WVBA 2DIVA 4HDGA 3CB4A 3MM9A 5L8RC 4PG4A 4DV3J 3HK2A 2I5KA 1FX4A 5J2MB 2QL7B 1PG5B 3W2WB 1ULRA 4E1KA 3VGVA 4CM2A 4DF8A 1UHAA 2QPOA 1GH8A 4N47A 4O3SA 3GOXA 3HDSA 2PC6A 3H4DA 3TA1A 2FKOA 1U1OA 2GNKA 1W2IA 4K5RA 4CI0B 2QMXA 2XWXA 2YKAA 5J2QA 1Q79A 2JZ5A 3DLEB 1N13A 4NASA 4E98A 3MQHA 4OI4A 1M5PC 2R7QA 3NCQA 1RQ0A 1T9TA 3O3LA 4OHWA 4GI3C 1D8ZA 3UD3P 3D9BA 1RWWB 5B0AA 4M8LA 1S6PA 4ECYA 2IBOA 3M7VA 2ENZA 1TL7A 3DLLQ 4FCEA 4MYUA 4CDIA 1H72C 4OVOA 2RT3A 4F4XA 3PVXA 2CDQA 5KFOA 1BC6A 1Y1BA 1K44A 3Q8QB 1BMOA 1YJNS 3NLCA 4I6AA 3VGSA 4WP8A 4DR3J 1IBLJ 1KVJA 4EA8A 2XG8A 2FHKA 4L73A 3J7AN 1XTZA 1M5HA 1UZDA 2HHTA 3W5YA 4JI2J 3W5ZA 4PWDA 4KNXA 4FPIA 5DGBA 1NSAA 4X64F 2MKSA 5DJBA 1RA6A 3E2IA 2FLNA 2R7VA 3GLJA 1KRVA 4FF4A 4OI3A 3H5YA 4UT4A 4OL8A 3FFIA 3GCWP 2R8JA 4DV2J 2W1BA 1RSCA 4LFBJ 2HRYA 1KMAA 2ADBA 2L7XA 2E1PA 3AH6A 3V6KA 2C2RA 4H54A 2HHVA 2OI5A 4BLGA 3OTEA 1NB2A 2YVSA 1K1QA 1WUUA 4IQMA 1Q9BA 2E73A 1H0HB 1YP3A 1TKZB 3NAIA 4J7CA 5CQGA 3MURP 4AL7A 1JLBB 1S72S 4LFAF 2HFSA 2HHHJ 1TAUA 1R0AA 4LT6A 3OTZA 4WFZA 1RWVB 2CJAA 3TWZA 3K5LA 1UEVA 4DUYJ 2HHSA 4MJKA 3CC7S 3KK3B 2WW8A 2WBRA 1G2EA 2P2OA 2QYGA 2QX0A 5F0UA 3R3IA 1AZSB 2CPXA 2IPOB 2FD2A 2Z0GA 4F4YA 1IQTA 2AYMA 2BKNA 2HGLA 2W2MP 4LBHA 1TBRR 1WHXA 1JLGA 3KK1B 1FNXH 3JSYA 4EYIB 3CWJA 2BYCA 5E0OA 4Y3CA 3TX0A 5B7WA 4CCHA 2RE1A 1KONA 2IRUA 2MSTA 5FDLB 3ILLA 2YWKA 4EO8A 4Q43A 1T05B 1PJ6A 2AEJA 5GAGI 3TA2A 3PX4A 4OLOA 4R8UB 4I6YA 1TKXB 3C15B 5BJRA 3TQEA 3LW5C 2I8EA 3MGJA 4QW8A 2A20A 5D4PA 1RT5B 3F41A 4LR8A 4P73A 2PMWA 1VQNS 4IHGA 2EC2A 1F3FA 3GFZA 3QT6A 3OFFA 1FX2A 3UDCA 5DQIA 3UD4P 4UY8T 1MMNA 1DQAA 1RJJA 2UVOA 1WKKA 1TURA 2C1EB 3FEZA 3I9ZA 5BYRA 3TJAA 3ZC4A 4RUCA 5JHWC 1LK5A 3AD9C 1MG7A 3MMJA 3RYLA 2JYYA 2CVEA 1NUBA 5D4LA 4CNYA 3UN5A 5DDQC 1S12A 2EFOA 5DG9A 4DL6A 4MFBB 6FDRA 5IT0A 2L08A 1K1SA 1VK8A 2HNYA 3MR6A 4F4AA 2N4DA 2QQDA 1RWNB 3D28A 3RR8A 5LSLA 1X8DA 3L9ZA 2QJ3A 1PILA 4LSZB 1N32F 3BSCA 4CZCA 3QJLA 3VWSA 3BM7A 3CD0A 1WHYA 3KLFA 3RW6A 4QYZK 1ZAXA 1IY6A 1VJQA 2CJBA 3T1HF 1QVFR 4HVZA 4J9VA 5GADU 5E41A 3WBZA 3PY8A 4KGKA 4BS2A 2KRRA 1DBDA 1ZTWA 3BKTA 4GMKA 3VBMA 5CH7B 3M8RA 2I0XA 4RJVA 2GKVA 3OR1A 1RCXB 2YNGA 2ZZTA 4URSA 1NXIA 4J9QA 3MMCA 3C6TB 2GAHC 3ISNC 2V9KA 3NGTA 3VCDA 1XMBA 4DPTA 3JAMU 2P6SA 3K0JA 2B4OA 4CH1A 2R2TA 2GHWA 1KRPA 2Q6CA 2ZITA 3QAHA 2RIJA 4RW4B 2HMIB 2WSEC 2XTJP 3PDNA 1E6YA 1LWFB 3CJ5A 1AZSA 3N01A 3ZTPA 2OO4A 3V6HA 1SQEA 4FBTA 5JVHQ 3NNHA 2CJYB 4LF9F 4ZJOA 1S48A 2HYIB 3PJWA 1SPBP 3UVJA 1QSYA 2GIVA 2JVOA 2M70A 3FCVA 1CG2A 4NA3A 2UVRA 1XIQA 1TL7B 1NRKA 4AE5A 2IAJB 2NYIA 3LGMA 1NZAA 5ETNA 3RAMA 4ZKAA 3CC2S 4ED8A 1VQKS 2HQDA 1TL5A 5E2QA 4EBCA 2J0SD 3LH2S 2KTQA 1N5TA 3EE3A 1Q8IA 5AXNA 3NGUA 1NBEB 4WZMA 2AYGA 2ORWA 1XN9A 2DNHA 2QIFA 3TRGA 1EIYB 5DEPA 4F3QA 5A8WA 5FIIA 3CCLS 1NKBA 2M5YA 4FVMA 3OFGA 1HA1A 2V68A 4YR0A 1GAOA 2CZ4A 2CUYA 1R0BG 2JSXA 2PA3A 3HT0A 3IGVA 3K8WA 2FJAB 4OIXA 4XDCA 5CXTA 1KFSA 2ZD1A 4K4VA 2RHSB 1WHWA 4J90A 5D78A 3V81A 4OFZA 2Y0BB 1YKWA 3UN2A 4E6TA 1TK0A 2P2CB 4UZCA 4WXOA 5H1SV 3ZZYA 1IR2A 1BQXA 3SI8A 5DM7Q 2R7UA 4F3MA 3M30B 1OPIA 2GJIA 3CDAA 3V6JA 1T3NA 3KXDA 2X1BA 3UDVA 2WOMB 6AT1B 1C1CA 2J7KA 1WTJA 2W7OA 2J0QD 4CNZA 1HNWJ 4NXMF 2Y8YA 1PYOB 4GKKJ 2RF2A 2DH7A 3VAMA 1S9EA 4F02A 5BXIA 1NK7A 5EGYA 5HLFA 1KQSR 2UUWA 1NSPA 4C3LA 4ZHRB 5AE2A 3IRWP 3DU6A 3ZZRA 2LB7A 1R7IA 1OPZA 3FBCA 4FVCA 4Q2MA 1KD1T 2HK2A 3GQAA 2MZ1A 1N5QA 1OY9A 2JJ4D 2CWGA 2FHOB 1RP5A 1VQ7S 4E79A 1RT6A 1YI2S 2TDTA 4KYZA 2AYEA 2EFPA 2MKYA 4M5DB 3GIJA 3ISZA 4NXMJ 4LF4J 4C11B 4QWAA 1JJ4A 3ENAA 4KFBB 4DSKA 1T9WA 3VR1A 4DFJA 1X9SA 4B02A 1GTEA 2Y3YA 4L74A 5ETLA 1VK3A 4DXLA 4R37A 2W9CA 3DOMB 1IUJA 4PXEA 1XBTA 2CPYA 4OLPA 2UP1A 4EYHB 1R6VA 3AJDA 1B0VA 3E8OA 5KFAA 3VZHA 5EN1A 3QZ8A 1SGEI 2M0GB 2GW8A 3VE5A 4NLXA 5HVHA 2DJWA 4ZVSB 2WK4A 1TP7A 1WG4A 1LXAA 1EAYC 1VS3A 2CAJA 2D3ZA 3VBNA 3AQPA 4AAWA 3D1HA 1RE1B 3PG9A 2HQIA 2LCWA 1IKXA 1H74A 3G6XA 2XS2A 3QGGA 4Y2CA 1NDPA 2LQ5A 4ZCKA 3UPFA 2YKMA 3BPSP 4NX9A 4S0MA 4WZQA 3LTOA 4A8SA 2CADA 1HWLA 1S6OA 1C1BA 2CQPA 2E1MC 3KG4A 1EX8A 3KJQB 4NLOA 1HARA 4FF2A 1T7PA 2XMAA 3TIOA 4IRKA 4F04B 4KHMA 1S0OA 4UXHA 1CULB 1WC4A 3PX6A 3OVAA 1S7HA 4G1QB 3BGFA 1L3UA 2KKHA 3KNGA 2ERRA 1X31C 2V2VA 3NKYA 3IC1A 2HWHA 2LEPA 2UVWA 4IDKB 2AJ0A 2FZKB 2IRYA 3A3NB 1RAEB 4M1KA 3Q8VA 5LL6d 4PG5A 3MAHA 1E6VB 1ZM4A 1VBYA 1NJWA 3T1AA 4NYPA 2GIRA 4YP3A 2E9ZA 2G1HA 3PRBA 3RJMB 3SV4A 3M2VA 2KXNB 3OSPA 2CPJA 5ETMA 4JV1A 1MU2B 2ZBIA 2HWTA 3VQTA 2OAUA 4C4WA 4DR2J 2HNZB 3VQSA 1DLOB 2MGZB 3B8HA 4DV5J 1T11A 3J7YI 3KDNA 2DEJA 4PYDA 3QT5A 5HQLA 3TO6A 4A4JA 4DMZA 2DGVA 5HROB 3GSDA 3HSGA 2FY1A 1APSA 4QCLA 1FYBA 2EC0A 2A3JA 3VGUA 4WFAQ 5FUVA 2YWWA 4LF6F 4PQAA 3LWMA 2JX2A 1Y00A 2ROWA 2B6AB 1HBMA 1S1WA 2ZVIA 3D67A 5KG5A 4N41A 4PABA 2VPYB 2ZJPQ 5E3RA 4ID8A 3W2WA 4KHPJ 1ZAWA 2HZCA 4B9VA 4LF7J 1IXKA 3I56S 4PWDB 1SQGA 2OGUA 2DTJA 2OPSB 2QLJB 1KKHA 4KB7A 4LJMA 1WTFA 2AP6A 2VUGA 2IDLA 1S0VA 2GGPB 2LQ9A 2LP4A 3I9V9 3LP2A 1PTQA 3HHNB 1S6PB 4A8KA 4NYZA 2J8SA 3CXLA 1SQFA 3D0GE 4RBUA 1P1LA 2Z58B 1YU6C 3CDEA 3UW1A 2OEMA 3M4XA 3OBIA 1FTCA 5KT7A 2OP5A 1QRFA 3IS9A 2J7WA 4J9NA 2DH9A 3D5MA 1J2VA 3PR4A 1N54B 1Y7PA 3MOZA 3FVYA 2ZFHA 1TMJA 2GQ2A 3LP1B 2GGQA 1VMBA 4I7FA 3KMSA 4K7QA 5IM0B 3MEKA 4QWEA 3D4JA 2DNGA 3GG0A 2ROEA 1MWQA 2QSFA 5AFUU 5E3CA 3ZXWA 3QJPA 1MN7A 2VKZG 1EKSA 6FD1A 4DX5A 4Z7CA 1PJ5A 1D0EA 4NI2A 3TZYA 1RT1B 3JB9k 1GMUA 4CTAB 2ZE2A 3AHPA 2D1CA 2BV3A 1PAEX 5L6SA 3TJQA 3BEGB 3L7PA 4P7VA 2AD9A 2DHSA 3GJTB 2N3LA 3SYZA 1XNRF 2KFZA 1NSKL 2NUUG 4YDXA 1JLBA 2EBEA 2AZ1A 3TUPA 3DRSA 3UGLA 1HIYA 3LWLA 4CLWA 1TKZA 2BACA 4DL2A 2BQ3A 2VHGA 3POTB 1FFSB 4Q0BA 1S6UA 2RRNA 2GVZA 4NLRA 2ZC3A 3H5UA 3QYYA 2O67A 3MXHP 1HR0F 1VQ4S 3PFEA 4YEAA 2XC9A 1SIWB 3HO1A 5AFUV 3DK5A 1T8EA 3AAWB 3C6UA 2HRUA 3RBXA 5L9XA 5CYMB 4WTYA 1LW0B 1FXDA 4WIIA 7FDRA 2ZHBA 1HMVA 3R6LB 3EX7B 3JQYA 3IBWA 3QT8A 4RW4A 5I4MA 4N7TA 1KP6A 3MUMP 3M05A 4YOEA 2OSQA 4JI6J 4ZLNA 1N6QA 1W25A 1HD1A 3A12A 1TGSI 1HHQA 3PIOQ 1HQUB 2VBXA 1N34J 1YTYA 3KJNB 4NRTA 3PW7A 1VRUA 5B0EA 3S01A 1Z90A 1QREA 4X4PA 3OL9A 3HKWA 3GQCA 1F9EB 4P52A 3UI3A 2NREA 2PD1A 2NU3I 1KBFA 1JIHA 2CRLA 2D41A 3SEKC 4KGXB 2E5GA 3N6NA 4ED5A 2IC3B 4K2JA 5ETRA 4I69A 1CSJA 1HV9A 2CNOB 2IC3A 2DHXA 2XLJA 2P9EA 2RD5C 3VAJA 4K4XA 5J2MA 1SI9A 2MQNA 4ZJLA 1JLCB 1U25A 2DNPA 1IKVB 5EHHA 3OHAA 1RTJB 4GC7A 3PYGA 3W1YC 3LPYA 2V4QA 5IXUA 4DFPA 4HZCA 4HTIA 3JTNA 4ZPTR 5J1NA 4PG7A 4JYAF 4HACA 1DZ5A 4YS2A 1T9YA 2HIYA 3DXBA 4R7PA 1Y4ZB 1HNIA 5AXKA 5LM7E 3M8SA 2C2NA 3GIRA 2HFOA 4IFYA 3G8SA 4U6PA 4KE5A 1RA7A 4PYAA 4RU9A 3OR2A 4U9RA 1MROB 2XULA 3VZIA 2YNIA 4F4ZA 3G6YA 1X4DA 4F2RA 4IUFA 2UXDF 3BR8A 1S0NA 3M2UB 1LW0A 1TKXA 4HL9A 2YKNA 3T19A 1RHJB 1CQNA 2BA9A 2GS8A 3GPAA 1LR9A 4I4BA 4J37A 1NNDA 4EZ9A 1IQZA 1BQNB 1FF2A 1KVIA 1LWXA 3ZTRA 2V8VA 3WHIA 5CZXA 2EFGA 1UWBB 3AB4B 3OL6A 1VIOA 2RSQA 4NZ6A 4B6DA 3I87A 2VRWB 4IH6A 2JLEA 4DU8A 1M5OC 2R9LA 2WZ1A 3DMJA 3F73A 1ZH5A 3MECA 2W9BA 3UCGA 2OTJS 2Z4PA 3MECB 3OFEA 2WLCA 4OI2A 2W9BB 5GAHI 4J9PA 4LF7F 4AL5A 4LFCJ 5F9NA 4TYAA 1REVA 1RWKB 5K14A 3FQKA 2O66A 4YY3J 4HUSA 3V4MA 2RS2A 3PZPA 1UETA 3R3TA 4DCLA 5IT9U 3R1HA 4NLVA 2Z8QA 2CPIA 2GKRI 2B5JB 4M9CA 1JKHB 5LSRA 3CC4S 2B8QA 2J0XA 3IXQA 4MIBA 4Y28C 1WI6A 3A8EA 1W4RA 1U8WA 4F25A 2B0GA 2YNHB 3Q23A 4I56A 4EGGA 1UVJA 4DR5J 1OS5A 3TP2A 3BN4A 3BXYA 4F36A 2XRCA 2RDDA 5AE1A 2SXLA 2HGMA 2JNJA 2R8KA 2EFQA 3SMZA 5HSPA 2C3MA 3MEDB 3HX9A 2QSWA 2Q66A 1G1XA 4FNHA 1OY6A 4OJGA 2A18A 5IZHA 4B3TJ 2QO3A 2RHQB 4NCBA 1T3OA 1JQGA 1LKZA 1YDLA 1C4AA 1HNIB 3QZ7A 3MR3A 4AXIA 2UUBF 2NR0A 2CNNB 3KLVA 2K06A 3HCXA 2DHAA 2Z2MA 3KHHA 4YY3F 3PX0A 1NK9A 2GGPA 1MRLA 4DFKA 1RAJA 2XI2A 3ILJA 3VV2B 2VONA 2CWHA 1TL1B 1SGDI 4J9KA 4K4WA 1WI8A 3P96A 4UZBA 4PWWA 2MQMA 1K7TA 4E1PA 4XTTA 1KNZA 2H3EB 5ETOA 2KO1A 3R2DJ 1FRHA 1SV5B 5IT9Y 1WNEA 3LALA 4JI4F 1TU0B 3R1WA 1U24A 3D1QA 1MMDA 4YB6A 5D0HA 4C8OA 4LF8J 2UVVA 3PKMA 2F8HA 2B7BB 4JCVE 2ZNYA 2Y0MA 3BBBA 3MM8A 4USKA 5A76A 4G3QA 1K7UA 1N5SA 1U2FA 1HNVB 4UOCA 2BANA 4HURA 3L7OA 3CXCR 1HM8A 3BGRB 4KBIA 2NCKL 1QTMA 4N5SA 4KIAA 3MEGA 1R43A 5F41A 2XBPA 1OY8A 4ICLA 1D1UA 3C3LA 5C24A 1DAXA 2F1FA 1OYDA 1VQ5S 3BREA 4IG3B 4I2PB 3KK1A 2AU0A 1WGCA 3TNVA 1TVRB 4NLQA 5CYQB 1FCAA 3I82A 3BSNA 1VOMA 2JEJA 1IKYB 4WFYA 1NJXA 1NM2A 2MJNA 5IQ6A 2VPZB 3C6UB 4QJVA 8RUCA 3M6WA 1X0FA 2OKQA 2RUSA 3QNWB 1FARA 4DZ6A 3OU9A 3HULA 1NXUA 3QWUA 1GMWA 3RBEA 1NH8A 5KFHA 1RT4A 2KHCA 1NB7A 5LJ3Y 1IBKF 3ENVA 1M5SA 1RHKB 1BXNA 2QLFB 3LP0A 2RDJA 4PAAA 3SQOP 3L95X 3Q86A 2FJXA 4JI0J 3K5OA 2WVJA 1H2VZ 5I3QA 1PC5A 5MAOA 3BO4A 2L3MA 1I94J 3I31A 4DV6F 5EX0A 5JJBA 2BJ1A 1PSDA 1BWVA 3DLJA 4ZK7M 2ZH4A 3FEXB 1M5VC 4AUKA 1EWWA 2CJ9A 1RT1A 5DDRC 2NZ4A 4L75A 4ZCMA 4LRAA 2EK1A 1JXLA 2AIRB 3Q8UA 5J1EA 2RQCA 1SC6A 3ZNUA 2CA9A 2ZM6F 1KHVA 4AD6A 3OV7A 1R3NA 1U2RA 2XGQA 3RGIA 1RWUA 3OL0A 1JNZB 1G7CB 3KY9A 3AOAA 4GKJJ 3FJ2A 2K7KA 2BUNA 2YNGB 3CCWA 1UFLA 2VG5B 1KHWA 3AT1B 1U1MA 4EZ6A 2F63A 1QTNB 4DR2F 2WB4A 2NZCA 3BF4A 1VLOA 1HPTA 2FGCA 3KKFA 4GO5X 3TOQA 1SV5A 4X62F 5H9FK 1URRA 2PMHA 1HR0J 2UXBJ 3SSRA 2HPUA 3WDOA 1X5PA 3I5AA 2QLXA 1YQHA 3KLFB 1HHSA 1U0SA 1SH2A 2QLBB 1X4AA 2KT5A 4P71A 4C48A 2VJVA 4G1IA 3GV5B 2E1CA 5KG6A 3BV8A 1AFIA 1JJCB 2HVHA 3FBBA 5DG8A 2E7XA 2P9GA 1R8BA 3PHTA 3DLHA 4C8ZA 1HNWF 3NGSA 3GFYA 1QLNA 2M3DA 4O4GA 3QO9B 4ZVFA 4C0BA 2M9KA 3M8PB 3O5TB 2ICXA 1WJ9A 1U4BA 2A2CA 2CPZA 3DCAA 4KH1B 1KTVA 2V1CC 2L41A 2LA4A 3IM9A 4HYKA 1W2BR 2IMWP 2KZMA 4ISXA 1YJVA 2L9WA 5HLFB 1ZYQA 3CJ8A 2AJ2A 4WYLA 1YZ6A 2DT9A 3GMGA 3W3SA 1DQ9A 3J7Z5 1XERA 3EDRB 1R0RI 1UAWA 3O1LA 3D6HB 3KLGB 4WK3A 4MK8A 3MM5A 3GIKA 4A24A 2QL9B 2MXYA 1U1PA 4A8FA 3DRPB 1EP4B 2B8TA 2FC8A 2XMVA 1SJRA 1U8SA 1SKUB 1VHIA 1TKTA 1WOPA 3B4MA 3QJJA 3DHXA 4K59A 4C8MA 4DR4J 3W2VB 2UU9F 2WGCA 2HLTA 1GMVA 2Q6BA 2AQ9A 3GB0A 4OYWA 2OPPA 2B0UC 3BSAA 3HI9A 1WC1A 2YQ0A 2AMCB 4Q8FA 4P75A 2WHOA 3EGVA 2WCYA 1UW9A 3PM9A 4TNOA 1VC0A 3PV8A 3HSJA 3ZZ0A 3KOAA 1UZHA 4Z2XA 2K9HA 4DU7A 3TWDA 5L38A 3NEKA 5FD1A 2BE2B 3CMES 1MWYA 2GV1A 1YTPA 3QLHB 3BQ2A 3R5GA 3TANA 2DGTA 1HKAA 3M8QB 3OL8A 2YNFA 1YJRA 1WEYA 3DN9A 4WFBQ 4ER8A 1J5EJ 3NWRA 4FBUA 4AT1B 2G2ZA 4DL5A 1IBKJ 1R8AA 1IM4A 2VF3A 3W64A 3D3BJ 4OZ3A 2JDJA 2RDIA 4JB8B 2ZEJA 2RKIA 2ZH7A 4KHPF 3OSNA 1HPZB 1M1KT 2QT7A 3JAMY 3KWMA 2HHQA 2LVWA 3ENQA 4M5MA 2DNRA 3QATA 1PJUA 3SCKE 1UJ5A 2H48B 2EKYA 4DR4F 4UOHA 1TAQA 1C0TA 1AA1B 4G3IA 2ENNA 3J81U 1XMQJ 2E5LJ 3VVTA 5GAHU 1CJTA 2FB0A 1HD0A 4ED1A 1RISA 2J9EA 3KJVA 1GK8A 1I1GA 4J9MA 3X3UA 3NS5A 3TARA 4IOBA 5I42A 1V1HA 3C66A 3UOEA 4DSJA 4DLGA 3UQSA 1YRXA 3DNCA 4DOZA 3CF5Q 5HL7Q 2R2UA 3OTMA 2W4PA 3RB4A 2HBRB 2GC8A 3DGPA 1OSDA 2ZJRQ 1S9EB 4M98A 1Z7KB 2HBQB 4KPZA 4NLSA 1UL3A 4O23A 5ETTA 4ZVPB 2V6AA 1LXNA 4O3PA 1ULNA 4YUDA 1QDUB 1X0PA 2I5JA 2X51A 2LLZA 1N0UA 1J5OA 1F2GA 3Q1XA 2HHWA 2BJ9A 3THTA 2F8EX 1KK4A 1Z2IA 2QYCA 2YWFA 4TVAB 3JSBA 1IR1A 1XA6A 2GO9A 2R2SA 2X7IA 2F9DA 3CD7A 4TY8A 3I0SB 3GE9A 4OZLA 2UXBF 3MPUB 2VOPA 3OUPA 1JXEA 3LA0A 4BC9A 4XO0A 4ZVUB 3KLHB 2Z2YB 2GA7A 3G82A 4DX6A 4QYRA 4P10A 5HBMA 4DUYF 1KTQA 1WKLA 5KFUA 5KG4A 1U1NA 2Q43A 4DPUA 2UUBJ 3EPIA 3AFGA 2HK3A 2Y1JA 4MK7A 1S49A 1XR6A 2HGNA 1HDLA 2KT2A 1M1HA 2K2PA 2EEYA 3ISND 5LMUJ 2N3OA 3SUCA 2ZBPA 5KFSA 4N69A 2E29A 3DI6B 1M8NA 4QR2A 1TL3A 4FYWB 4DCPB 1U1LA 3GV7B 2UUCF 1IKWA 4KAIA 3J80Y 3NGRA 3V2UC 5A8KA 3PRDA 1HEVA 3DHOA 2RVJA 1D8YA 2CWKA 2HNYB 3QSIA 2QQCA 1IWGA 1KFDA 2VU5A 4GO7X 4DQQA 4DCJB 3A8IA 1NJYA 1P9QC 3PNIA 4URQU 5LMNJ 4ZVOB 3IGJA 3TV0A 1LWCB 3BDEA 1ACMB 1YP2A 1Y3JA 2XS7A 4UTGA 3KK2A 3H40A 1X4HA 2GCFA 2E5RA 3N4WA 5IM0A 4RW8A 3TVZA 2DGOA 4HLBA 3HMJG 3KHLA 2C2MB 1VC5A 1JX4A 1AW0A 3QBCA 2BJ7A 3DXSX 1YBAA 4G3SA 1C2PA 2MTLA 3QGIA 3WIVA 2VA2A 2YWHA 2MGZA 4DWIA 3R5DA 2W4CA 5T7LA 1RI7A 2B4PA 2CWXA 2GHVC 1U2CA 4N8OA 5AJ3F 1VQOS 2KJWA 1T05A 2CQHA 4EEYA 4NMLA 5M2UA 2K8GA 3PW0A 2DY9A 2VKRA 1SVDA 2RQ4A 1LWFA 2W2PP 2VDHA 2YKMB 4K8RA 5F8GA 2KMOA 2BJ8A 2HHXA 2UXDJ 1AFJA 1CBKA 1VI7A 3D98A 2V67A 1P9ZA 1HNZF 1MJ9A 3AXMA 3OTBA 1SJQA 2M2BA 4I64A 5GAEU 2DNMA 3TI0A 1D9FA 2R42A 2QC3A 2ZH6A 4PUOB 2W25A 1KN6A 2ZDOA 2LDIA 3OR1B 3W61A 4OHZA 1BY9A 3JS9A 3ZZZA 2L9DA 2DXFA 2Q4JA 1P9YA 3FK4A 2RU9A 3I0RA 3MHYA 3H5XA 1EP4A 1FA0A 4NL5A 4NYOA 2AJQA 2DH8A 2FVRA 2KJVA 3LUYA 4MYTA 1ZETA 2OH2A 4JI8F 2R8IA 2MLZA 2VBZA 2ZWOA 2ZH9A 2O01C 1UUCA 4OHXA 1LK7A 1UVKA 2WAQD 1CPZA 1HWJA 4O44A 3TAMB 3WZ0A 2W2QP 3IR6B 2ROPA 2IA6A 1O0PA 4QPTA 1S9FA 2EW9A 5C42A 1L5UA 3FZ2A 2DCLA 3HJVA 3R27A 4OHVA 3J81j 4K0KF 2M88A 2LECA 2OU2A 4J91A 1TVRA 5CYQA 1X4BA 1PTRA 2V0JA 3LAMA 2C22A 3A3OB 2AYBA 4DFMA 4F67A 4C8NA 4PUOA 2DRAA 2V8DA 4X4NA 1HLWA 5DZ7A 1V3ZA 5B09A 2ZH5A 2BM1A 1JWWA 4J9UE 1LW2B 2M5XA 2HQ3A 1NH7A 1WC0A 2IC7A 4NEZA 3CMAS 1VQ8S 4Z7YA 5C2GA 2ZJQQ 1TFWA 3R8YA 3Q2SC 4JI6F 3FBFA 1NJIT 3GQ9A 2VQFJ 2RF2B 1BUXA 1HNVA 5JXSA 1P27B 2V1CA 7FD1A 3BBCA 3CJ0A 2RS8A 2J9RA 2AF6A 2VH7A 5J1PA 2KG1A 1KLNA 1RT7A 1JJ2R 5BYQA 1LFWA 4JI1F 3NZ2A 3M6VA 2DKVA 4LF1A 3I96A 1LWEB 2BVZA 3KLIB 4CYUB 3MFHA 2V4RA 4C0OC 5DG3A 2ZBCA 1Q82T 1N0VC 2KL8A 4Z37A 1CLFA 3VHQA 1B7YB 1KGQA 3VAKA 4N6BA 1G6BA 1V5IB 3FFIB 3W66A 1PKUA 2FTRA 4P9SA 4TY8B 2OHDA 5DS7A 1HFEL 2G9OA 3HJFA 1MR7A 1XR5A 1RACB 3JXOA 1FWKA 3EVOA 3HVWA 2MY8A 1R8CA 5FLXY 1FJGJ 1FJEB 4MFGA 1U0HB 3UD5A 1B0TA 2FPHX 2MYFA 3THPA 4IKAA 3U7JA 1R0CB 4LBPA 4ZCLA 2QN6B 2VFRA 4DL0C 1X9MA 1HPZA 4ZVGA 1A7GE 1Y8FA 4RZRA 1WD6A 4OHYA 2J9DA 1NK0A 5LT5A 1KLMA 2BW7A 1Z2ZA 3ZTQA 5L1KA 4PRFA 4DN9A 1SKRA 1YK9A 2VQEJ 3K8VA 1NHKL 3R3RA 4C0HA 2DGXA 1ZA2B 1YVFA 1ULMA 4WKYA 3NGDA 5L1LA 3Q22A 4DV3F 3V81B 2OTLS 4PXDA 3GYNA 2OZUA 4X4SA 1T0TV 4DSIA 1PIEA 5FJ4A 3DOKA 1R27B 1FXRA 2NXJA 5K8OA 4AFFA 2ZUAA 1U1RA 1BE4A 4LF5F 2CQ3A 3HPOA 4ED0A 2OEFA 3DRRA 3EVMA 3HM9A 2QA2A 3WC2A 3MM9B 3I3XA 5FUYA 3AA8A 3VBPA 3EGWB 2ZH1A 3PYEA 3UFFA 2ZH8A 3ETOA 2CG4A 2IM3A 3EVWA 2VZ9A 2OD1A 2AHOB 5HANA 3LPEA 4H4KA 3NGKA 1P8GA 3NP5A 4ZCIA 4DR5F 3JQJA 1DARA 2CFXA 3MWBA 2HW3A 2H5JB 3Q0AA 2CQ4A 1U47A 1FDDA 1NMEB 4OMFG 1IJEB 5A8RB 3OH1A 4DR6J 2XYHB 2J6SA 2DHHA 1WC6A 4ZVEA 4O44B 3VAGA 1TK5A 2V8HA 3KWEA 3OUYA 4ZS6A 4F0MA 1HI8A 1RLDA 2BRLA 3GR1A 4DV2F 3THVA 3GP9A 3TOBA 1RABB 3ZZUA 2JF3A 1DTQA 1XNQJ 2MHNA 3TAPA 4WTOB 3HF5A 4J09A 3N79A 4DS4A 1YJ9S 3SPTA 2DKOB 3K2YA 1FKPA 3MEEA 2ZHAA 4EA9A 2XCPA 2QIVX 3TEHB 2DVIA 4PPZA 2WLDA 3UGDA 1AB8A 1IBCB 2M52A 4QWBA 4B3RJ 2DBBA 1DFDA 4O3RA 3R97A 2CNKB 2A6MA 4F4WA 4B3OA 1GXUA 1XNRJ 4EUVA 3CT9A 4ED2A 3ZTSA 1S1TA 4NZ7A 4XIUA 1P9GA 2HRTA 2OEGA 1P1TA 4ECVA 2HG4A 2DGQA 4JV5J 1T9UA 2JC1A 2VG6A 1M8CA 5DQGA 4DR1J 2JA1A 4X66F 1QAYA 5KFKA 2CQIA 2YWGA 1YHQS 4EBEA 1RU2A 1UPPA 4C9DA 5J1EB 3GIIA 2C28A 2VBWA 3M9OB 7WGAA 3NNCA 4B9SA 1TDTA 4FKXA 3TO8A 3NY0A 4L6V3 3NNAA 2NLWA 1HL6A 2JFKA 2MLXA 2QTWA 1RHRB 3DLKB 3FC9A 2BJ3A 3HFKA 1S1VB 3CD5A 3T6JA 3UNGC 5LXRA 5F8MA 3RR7A 1WWHA 2G2YA 3O2IA 2ELIA 1NKCA 3P47A 3V4IA 3LO3A 2HLUA 3R5BA 5ETKA 3LP0B 2HKEA 3P4UB 1IKVA 4OZ5A 2JLFA 2ZHOA 4R8UA 2HFUA 3R7SB 4DI6A 3EG4A 1QSLA 2CG8A 3I3AA 2E7WA 2MZJA 2P8IA 1SH0A 1SUQA 3G8TA 1TL3B 3MR5A 2Z56B 2ZWPA 4ED6A 4DPOA 2RH3A 2HS4A 1MROA 3CCRS 3ILOA 1XX6A 5LMUF 3DM2B 4AXJA 3AXKA 5KFGA 5LMNF 1F2HA 2MZSA 1CC7A 4GVLA 4EU0A 4B9TA 2R7OA 2IYGA 4U7UD 3QFWA 3QO9A 2B9YA 1REGX 2H51B 2XMKA 3CW2C 5DEMA 3RAXA 1PC4A 4WE1B 1R79A 1IJFB 2M8HA 2AJFE 2DR6A 1R0AB 3C19A 1AN1I 3OH2A 2QFJA 3HD1A 3RBZA 3RB6A 2E5HA 5CABA 5SZTA 2PFFB 4OI0A 2V4JA 1KR4A 3H2UB 4EBDA 2QIAA 4B3MF 2NYHA 5F8HA 2YQPA 2DB1A 4UUXA 3MR2A 1KDNA 3JTOA 4HKQA 3RB3A 3KHRA 5JVGQ 2AJ1A 2HVDA 2RQKA 2W24A 1RGVA 1LXJA 3QAUA 1RHMB 4IH5A 4QIWD 2IVFB 4CYUA 2V0IA 3Q8PB 5GMDA 3IWXA 4CLKA 1TBNA 2D7SA 4OYOA 1PCEA 2QFIA 1F60B 5FDLA 2WOMA 1VQPS 3N6MA 3ZZOA 5T41A 3HVTA 1GTHA 3D0IE 3OHBA 2DPIA 1Z4UA 2KDOA 1FD2A 4HHJA 3BS9A 1B7FA 3CPWR 2X3GA 1FRMA 4OI1A 4C3KA 2PO4A 3DRXA 2VJUA 4FP9A 1WORA 1S4EA 4A8MP 1J2ZA 3QWPA 3GFHA 4ID5A 2CDRB 2XYGB 5F3TA 2RRBA 3TX8A 3CCQS 3HHLB 3HJJA 1DS2I 4NLUA 5KFBA 1S59A 2Q3PA 4C8KA 1HMVB 2YKQA 4NI2B 3MUTP 1HW9A 4LVNP 3WX4A 4KV8B 4CLSA 1FWLA 4LSNB 3C16A 2G4BA 3QIPB 3PR5B 2JH3A 3DGPB 2KMRA 2XATA 3FDSA 5KFEA 3BKUA 5ETQA 4KH0B 2HNDB 2MJUA 1DJ0A 1BUSA 4H7OA 3G2XA 4DEZA 4G87A 1VQSA 2VG7B 3N5FA 3R5JB 5KT2A 4FS1A 1BWEA 3D2WA 2XM3A 4Y2KA 4MKVA 3K57A 3CDBA 3UGIA 2W9AA 4IOAQ 3PJ9A 4LF9J 3CCJS 5FLXU 1QVGR 4USUA 2JVRA 3P1BA 3VBJA 3QT7A 1LV5A 3RU0A 2N7YA 2AWZA 1LQ9A 2EG1A 2B3TB 2MLYA 4LRDA 2OPSA 1RTIA 4A8WA 2DR7A 5MLCV 4DPWA 4N27A 1E6VA 3W9HA 1ULKA 4XPEA 4DV4F 4ECTA 1A6LA 1S97A 4L3KA 3DU5A 2BANB 3NS6A 4H4MB 1J5EF 1YWXA 3AODA 5DLGA 4CQ1A 3HVAA 2NU0I 2NQPA 7AT1B 2V53A 4WIQA 1LWEA 2G0CA 2KVQE 4DV5F 2XB2D 4Y34A 2KMPA 1BQMB 3NBPA 2HQFA 1PBUA 3K17A 3LF0A 2ASLA 1GT8A 4Y00A 1JLQB 4DN0A 3GONA 1N4LA 2B4UA 3RRGA 1PJ7A 3MPWA 4YR2A 2DD8S 1CS4B 4M5HA 2CPFA 4IFYB 5D4OA 4I2QB 5ETVA 3TA0A 1FXJA 2DNOA 4U7CA 5U2KA 1C4CA 1FTRA 1SGRI 4A46A 4NE9C 2DO4A 2DCUB 2V69A 3M32A 3AJ2A 4RNMA 1Q78A 1IW4A 1IKXB 2X3TA 1QSSA 1VRQC 2RMLA 3CCES 3SCIE 1T94A 3R5CA 1SGPI 1RTJA 1QRLA 2VB6A 2G13A 4J9OA 3BZQA 3TVKA 3IRXB 1JLCA 1HBMB 1V67A 1S1WB 2D3UA 4PXBA 4KGMA 1ZOTA 3R6GB 2R8GA 1W7WA 3FGVA 1YGYA 3H59A 3JTPA 4HHHA 4YB7A 1S1TB 1YZ7A 1IKWB 4QQBA 4CH7A 4D3HA 3G6VA 3W8PA 5DZ6A 5H9FJ 4J18A 1FKOB 3C14A 3HKZD 4H4KC 1SBRA 5IV3A 5ITHA 3OTOJ 2FHJA 4PXCA 2ZH3A 4RX6A 4ZN3A 4DR1F 2C3UA 3OR2B 1MLAA 1RAHB 2D69A 3IGNA 4OYPA 4NCAA 4WPAA 4TU9A 2R7SA 5HJYA 3I4HX 4B9LA 2LU2A 5FUXA 2OI7A 1JKHA 3FSXA 3D00A 5U47A 4CLUA 5HVGA 1L3TA 1YSJA 2NU2I 4LVOP 1N52B 3T9NA 3UDEA 1F9FA 3KUHA 5BR8J 1S1VA 4HDHA 1UFWA 3KLHA 3KTQA 2V2QA 2XMUA 1DTQB 5EDWA 3MOJB 2VHEA 1RT3B 1VBKA 2OPRA 2R4FA 3LOUA 3SBMA 5KFMA 2JEFA 2BKOA 2GQQA 4DX7A 2LQ8A 2IBKA 2CXEA 1UEUA 5HI7A 2UZAA 4OZNA 4ANDA 5L9NA 2J6TA 5DRKA 4NLGA 2XY6A 1ZPVA 1RBOB 2DO0A 2IU8A 1DTTA 1SGNI 2P9CA 2VG6B 3GYGA 1N4IA 4MK9A 3G86A 4NLYA 1HYSA 3AB2B 1XNQF 1K0TA 4YDDB 5A8KB 1F0XA 2LXUA 4M63A 3I55S 4Q45A 3B82A 1OO0B 2SGEI 3M2UA 1PO6A 1UEKA 3S1TA 3DGVA 3POTA 5D3GB 4U96A 4ECXA 1HQUA 2BW2A 3C8VA 1SC1B 3DRSB 2ZM6J 2DRDA 5I3PA 2OUGA 4P74A 1S6QA 3BKFA 2L48A 3K7RA 3JSMA 2HVIA 3MQGA 1WKXA 1TUWA 3GSIA 5B0GA 4X64J 2FVQA 4WKRA 3FCHA 1BGXT 2CQBA 3CSKA 5B08A 5CYJA 2E7VA 2CJSC 2PGCA 4KR0B 4JI2F 1FERA 1WHVA 1UCNA 3UWTA 1RT6B 5DDPC 3HVRA 1X5TA 5A0YB 3P45B 4V19X 3H4BA 3EGZA 3BJYA 1L0SA 4EA7A 3SIPB 2PIIA 1UJ6A 2HNDA 2FHJD 2QA4S 2XSJA 4USTA 5M2PA 2RKIB 2CWFA 2LDYA 1CE3A 5E3QA 3QFHA 5IOLA 4JV0A 2HZVA 4LF5J 2XS5A 3MPDA 3EWGA 2RUGA 3JYTA 3H25A 4ANEA 5K5MA 4HHUA 1EHWA 2NS1B 2LUYA 3IS9B 2HZAA 1HI1A 2QLWA 4NRUA 2W9CB 4B08A 4CLFA 2K3KA 4P2SA 1I94F 1RZMA 3CCTA 1FXLA 1QE1B 3SXLA 2XYPB 3ZO7A 2XSFA 5L6VA 5KT4A 4UUWA 4CLYA 2VFSA 2OJ3A 1K7VA 2MMYA 3HLUA 1XK8A 1NPPA 3W63A 4EI2A 1JLEB 1TZ0A 1V1IA 1HNXF 4ES1A 1T3DA 1F6TA 4P2FA 4M5DA 2KXHA 4DNCA 1S9GB 4W90B 2DB6A 1JLAB 1RLCL 4RUBA 4J9RA 2MB0B 4B3RF 4OJ1A 3ZTOA 3EDQB 4U8YA 1K73T 4CO0A 1KHRA 1O8BA 3HFZB 2KYXA 1AT1B 2RB7A 5HMXA 5GADI 4ILLA 2HS0A 1NPRA 4Y0FA 1HM9A 5C42B 1FKAF 4DX8H 1SJ4P 5J8CA 2V63A 3OH4A 1Q4RA 4USJC 5ADXV 4HI1A 3D1OA 4RNOA 1SL0A 3NMRA 4X2BA 5KG7A 4DSLA 1N56A
chains in the Genus database with same CATH topology
4FNIA 1FE0A 2IAJA 3CTRA 5DLFA 1VQLS 3RW7A 3MD1A 4IR1A 2BJDA 4R5PA 1QAXA 1M0SA 1H7XA 2FUG9 2GX8A 2XLKA 1VIXA 3G9CA 4WE1A 3NCRA 1PGZA 1XHDA 4MKBA 3CD6S 4PG8A 5KT6A 4I1TA 2DISA 2W7AA 1H38A 3H2LA 1VRTA 2B6AA 1VQMS 3FSIA 4B3TF 2HMIA 5KFQA 2D9OA 3MMBB 4NA2A 4TLRA 3T6BA 2YQ3A 2DR5A 1DURA 3CEDA 1TK8A 1NKEA 3KG0A 4QU6A 3PACA 2ADCA 1X4CA 2J6UA 1BLUA 1TKTB 4G1QA 3FSCA 3TISA 5GAGU 3CCUS 4DF4A 4G3PA 2B5JA 3TVYA 4JI7F 2YNFB 5T14A 3V4EA 1JLFA 4LSLA 4DR3F 5A2QY 2VG5A 5JUMA 3MM6A 2VA3A 2QMWA 4FXVA 4K4ZA 5E3PA 1QAIA 3H5SA 4CT8A 4PWDA 1VRTB 3CJ4A 1KQKA 1DQ8A 2ZNZA 3IRXA 3OW2R 3KLEB 5ADZA 2XWYA 4ITSA 2ASDA 3W2VA 2VASA 3QIDA 2JFDA 4FN5A 4B3SF 3W7BA 4OJ3A 4IQXA 2ALZA 5CA5A 2KFYA 1Q8LA 3TAMA 1HQEA 1L3SA 4GC6A 2HIQA 2WSFC 2V94A 1NHUA 3DC2A 3IA0A 2K1RB 2GIQA 4MAKA 1FD8A 2GQCA 3HHEA 5J2PB 1LWCA 1FKPB 3MEEB 5KFTA 4B9MA 4U7UK 2C2EA 4ZPCA 5DGAA 2CPDA 4MFBA 3BRKX 1GX6A 4UW2A 2LMIA 2QEXS 4WU3A 1HBOB 1JLGB 2COLA 2DPJA 4EFAC 1SL2A 2KI2A 4LMZA 2MKKA 4RW6A 3M1VB 1ZZNA 2FJWA 4ALZA 2RNEA 4TLQA 4ZVHA 1JNRB 3X1LB 2E1AA 2RRAA 4QWDA 2OPQB 4FS2A 2XMJA 3KFWX 5K9FA 5AE3A 1RT5A 4NCAA 5KG2A 4QR0A 1FESA 3SCLE 3N9UC 4WJBA 1K9MT 3PKYA 1VRUB 2ROGA 3OXLA 2HAIA 5EX3A 4F2SA 3IG1A 1U09A 3QPIA 4Q5VA 2FVSA 4CO2A 3AY0A 2KFNA 1FHTA 2D9PA 2ZD1B 1WACA 1URNA 1S9GA 2CPHA 5A0YA 4HT7A 2BZ2A 4YQWA 3CDWA 1JJHA 4KV8A 4TQSA 1SSMA 1MWZA 3O6QA 4LF4F 4K4SA 1SL1A 3ST8A 1RT2A 3IXCA 2IJFA 5DETA 2QV6A 1Q81T 3EEVA 1RDRA 4ICLB 4NLWA 3RZAA 3BDPA 2UXCF 2O5DA 1FO1A 2CQGA 5AXLA 3PFOA 5HO4A 1V3SA 4XDDA 1M5KC 3EXCX 2HHUA 3BSYA 4Q0BB 4WXWA 1S80A 3E51A 4KTQA 2ZDPA 4E6UA 4DQSA 4F3OA 4O3NA 3TK8A 4DLEA 3CE8A 2DGSA 1H7WA 1QM9A 3O44A 3QIPA 1FK9A 3V4IB 3VF0B 3G8QA 1E6YB 3IN5A 4ILMA 3H98A 1WG5A 3E3XA 4YP3A 1JLAA 4DDFA 3OSPA 3MC4A 4X84A 3LAKA 1NO8A 1NK9A 3BFPA 5K8PA 4ID5B 4K5SA 1NK6A 1MR9A 3VBLA 2FJEB 4G6VB 3ZFVA 1SKRA 1QY7A 4M94A 1C0UB 3B4DA 5HMWA 1HBNB 4X4VA 3KLIA 3MFIA 1VQ9S 4TKTA 4DQRA 1TV6B 4ES2A 3GWCA 4ED3A 1FJCA 2CKWA 1HW8A 1FVSA 2DHGA 1C1CB 2VC0A 3BN7A 3KG1A 4I6WA 1B0PA 2MKIA 2C3OA 3FWWA 3PEHA 4X65F 1YJWS 4EABA 2MQQA 2YKNB 1OWXA 3T57A 1FDAA 3IAS9 4B3OB 1D3WA 3UE2A 2KU7A 4URGA 2IRXA 2MZTA 1RK8A 4OX7A 3ECTA 2NREA 3HHKA 1KRUA 1JLEA 4KT0C 4OZ1A 2CZVC 4AQYF 3KHGA 5GVQA 3GILA 1CC8A 2DNZA 2V5HG 4O0IA 2WONB 3C2PA 2IVMA 4OX8A 1S1UB 3RTVA 2AX0A 1YJTA 2NPIA 4Q44A 2KT3A 3MUVP 2AGPA 3OUYB 2GO8A 2LEAA 3G4SS 4PR6A 4RKUC 3SDEA 3NBPB 3PX0A 5IQQA 3KJVB 2ZOFA 5BR8F 3GVDA 1VFJA 1FNMA 4IG0A 4KO0B 2MQOA 4DSEA 4QIFA 3UCUP 3RB6A 2WBMA 4HEA9 5KFDA 1A9NB 1FRXA 1GQEA 2NSBA 3QLHA 2W8KA 4OX9F 4B9UA 3TDTA 2J0WA 1B64A 5F8IA 3ULHA 2KH9A 1S0MA 1Y5NB 4TYBA 3PEJA 4LQ3A 1MMLA 2MKHA 3CIMA 3FS8A 1R89A 2VD3A 4L3NA 1L3KA 4M2AA 4MIAA 2OI6A 1MNEA 2C3YA 2K7JA 4WFXA 3FZBA 1YRUA 1KQGB 5KT3A 2B7CB 4FF1A 4CO4A 2VG7A 3T5JA 4K6RA 2ZH2A 2FDNA 4OQJA 2EBGA 2XMTA 5KFRA 1CQMA 3I5CA 2BQUA 4X4RA 3MM7A 4ERDA 4MIWA 4JV2A 3N5BA 3SRTA 3BGUA 5A8RA 1OSCA 4ED7A 5EUHA 1RTIB 4CT9A 4MH8A 1KGTA 2OLWA 3HHLD 2E44A 1T95A 2IMOA 3OL7A 1H6KX 4ETZA 5B0FA 1AROP 4HH1A 3MMAB 1XEZA 3M9MB 4P7TA 1THJA 1N32F 4RLEA 1Y9OA 1SKWA 5IWAF 1MW7A 2QKXA 2CVIA 2VD4A 4Q2LA 4MTPA 4WYWA 4BC7A 2VFUA 3OJSA 4KNRA 1VLYA 3CJ3A 1TL4A 2KN4A 2OIHA 2FVPA 3DJ4A 2PN6A 3MM8B 2AW0A 4QWCA 2F40A 5D4NA 5EWGA 2AX1A 4ELVA 2AGQA 1UVNA 3VNPA 2FJBB 3KWCA 4LSNA 3M2RA 4ECUA 4ELUA 4R0EA 5HP1A 2FHMA 1T03A 1Y3KA 4OI6A 2A2DA 1KLMB 1FT8A 3CIZA 1TUVA 2J9DE 4ECQA 5C24B 3V5RA 3R5AA 1TL1A 4PG6A 4K4TA 2YH1A 1G3OA 3MEGB 4OX6A 5HN0A 2XY7A 3KMQA 4OV1A 3UR0A 1ZM3A 4F50A 4MKAA 1JK9B 4QU7A 3PW2A 2MZQA 4DHVA 4IYQA 3S6EA 2W8LA 1TKDA 2DNYA 2ZKUA 2LYVA 3S8SA 4GKKF 4JV5F 3IAM9 3DM2A 4XPCA 5CYMA 3M30A 4DQIA 2VOOA 3JYTB 4YB1P 3EZUA 1RT4B 1Q86T 1UKUA 2IJNA 1S76D 3IR5B 4RNHA 1ZBTA 4A8YA 3I4PA 2PMZD 3OTOF 4DSFA 4HH0A 4RWWA 4BWMA 3P3DA 4I7FB 3US5A 2QA4G 3WC0A 2MZRA 1RTHB 2V4JB 3K59A 2KZZA 3RRKA 3D8VA 5F8LA 2M4MA 1N36F 4LF8F 4USIA 4Y2IA 4HT5A 3KK1B 4AA7A 2BM0A 2BBEA 1RTDA 3M6UA 4BWJA 1H3DA 4Y6IA 3CO9A 4M95A 4LIRA 1LW2A 2KYZA 3GIMA 1SSQA 5D3GA 2E5IA