5E3PA

Crystal strcuture of dapd from corynebacterium glutamicum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
284
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 92
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3pA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3pA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3pA01
4G3SA 5E3RA 2Q4JA 3EEVA 4HZCA 4K6RA 1KGQA 2GGOA 2OI5A 1QRLA 4KQLA 2AQ9A 3C8VA 1YP2A 4M28A 2WLFA 3R5BA 4N6BA 5DG3A 2I5KA 3I3XA 5ADXV 3GOSA 2QIVX 3D98A 4DCLA 2WLGA 2IUAA 2OEFA 1QRMA 1SSQA 1SSMA 3CJ8A 1QREA 3DK5A 2NPOA 2ICYA 3R5CA 4HCQA 1OCXA 2V0LA 4M99A 2OI6A 1V3WA 3HSQA 4G87A 3VBNA 4AC3A 4KPXA 4R37A 3I3AA 3FSXA 4IHHA 4ISXA 1HM9A 4AAWA 4R7PA 3SRTA 3EH0A 2ICXA 3VBIA 1FWYA 3V4EA 2IC7A 5DEPA 4EA8A 3Q1XA 3TWDA 3VBPA 3TK8A 3EG4A 5E3PA 3TIOA 3MC4A 3PMOA 4J18A 4G3QA 3ST8A 1G95A 3D8VA 4M2AA 1KK6A 3R2WA 4E6TA 3VBKA 1SSTA 5E3QA 3BSYA 3R3RA 2JF3A 3BSSA 3FSYA 1KK4A 3DJ4A 2GGQA 3OTMA 5F42A 4FCEA 2RIJA 2V0IA 3TISA 4E6UA 3GVDA 3T57A 3OW5A 3R1WA 3TV0A 2V0HA 3KWEA 5U2KA 1QRGA 4M98A 1V67A 3BXYA 4R36A 4AA7A 4EGGA 2V0KA 1XHDA 3MQHA 1HV9A 1J2ZA 3FTTA 4EABA 1MRLA 1YP3A 2WLDA 3OU9A 5AFUV 3VBJA 2OI7A 4KNXA 5AFUU 1KHRA 4HUSA 3BRKX 4KNRA 3FWWA 1KK5A 4J09A 2W0WA 1KQAA 2TDTA 4EA9A 1TDTA 2QIAA 3F1XA 4N27A 4EQYA 2FKOA 2JF2A 4MFGA 1G97A 4E75A 4MZUA 1MR9A 3R0SA 4IHFA 3OTZA 3FOQA 3R5DA 1QQ0A 4KPZA 1THJA 4M2BA 4N69A 3BFPA 3R8YA 3VNPA 4EAAA 3FS8A 4E79A 3IXCA 2OEGA 3GUEA 3P47A 1HM8A 3NZ2A 2W0VA 3VBMA 5L6SA 3VBLA 1Z90A 2V0JA 1FXJA 2WLCA 1S80A 2XATA 3MQGA 3SPTA 3FSCA 2P2OA 1QRFA 3R3IA 2VHEA 2IU9A 2VD4A 3KWDA 3DHOA 2IU8A 2QKXA 4HURA 1KRUA 1LXAA 3FSBA 1YP4A 3KWCA 4IHGA 4MYOA 4E1KA 3IGJA 4G3PA 1HM0A 1KRRA 4HZDA 1MR7A 3ECTA 3JQYA 1T3DA 1XATA 3R5AA 3OUPA 1KGTA 5ADXU 3TDTA 3BSWA 4H7OA 1KRVA 4N6AA 4EA7A 5DEMA 3HJJA 4M9CA 5L6VA 2WLEA 3P1BA
chains in the Genus database with same CATH superfamily
3L7UA 4FPRA 2AEJA 3RZAA 5IV4A 1IY6A 4OLOA 4RW4A 3AD7C 4JI6J 3AT1B 2FC8A 1SL2A 2DXDA 2G2YA 1NEEA 3KG0A 1N48A 4O3QA 3R7NB 4O23A 2EFGA 1FFGB 4Q2LA 2L8EA 4NLSA 4TYBA 2IVFB 4CDIA 2J7WA 3SDEA 2QYCA 1J5OB 1LK5A 2QJ3A 1W4RA 3ILOA 2DNOA 2ENNA 2K8GA 2VOPA 4IFYB 1YGYA 3GVDA 4LF7F 1QTNB 4L3NA 1VHFA 4A8YA 3MMAA 1HW8A 3TW0A 1N5YB 1M8CA 4KNXA 4LF5F 1OYEA 4N27A 2JDJA 1WOPA 3O44A 3CCES 2HVDA 4J7CA 4JI8J 4IH6A 5HQLA 2GQ2A 5LMUJ 2LXIA 3GUEA 3TQEA 6FD1A 1XX6A 3TWZA 3NOGA 5J2MA 3W2WB 4ZN1A 2WZ1A 1NJZA 2V2VA 4A8KA 1RAHB 2OTJS 4KH1B 2B43A 3EVMA 2KRRA 2LDYA 1R8BA 1UVFA 1XR5A 4X62F 2OFGX 3MM5B 3MURP 4F25A 3QAHA 4ANEA 5DLFA 1BWVA 3B4VC 4QQBA 2F9DA 4Q8FA 2CJQA 3D98A 3CPWR 4LF1A 4P2FA 4ECXA 4ENOA 1RKIA 4CQ1A 2AGPA 3M2UB 5EDWA 3M8RA 3A8IA 3SRTA 3NXZA 3SV3A 1QSLA 1Z1ZA 1TIHA 4PG7A 3MEDA 5KFOA 3GE9A 2DD8S 1LR7A 2N4DA 4X4VA 5KG1A 2GZOA 1A7GE 2O66A 1CT0I 3NMRA 4B6DA 3OU9A 2V8VA 1KHRA 1HI1A 5KFHA 4IG3B 1TDTA 1RT1A 2KHCA 1T0TV 3ZTSA 2K3IA 2WBRA 3AB4B 3T1HF 4YS2A 1UHAA 5KG3A 3M6WA 2OFHX 4B3MF 3LO3A 4MYOA 4LF9J 4I2PB 3TOBA 1UP1A 3NAHA 3W2VB 5EWGA 3W62A 1RT2A 1O8BA 1KBFA 4FF2A 1MG7A 1GAOA 2FY1A 1S0OA 4JI3J 1TK8A 2RJZA 5J2NB 3ILIA 4KQZA 3HPOA 5T14A 1T7PA 2X1AA 4PQUA 3SMZA 4F0MA 5D3GA 1RWNB 1KWMA 3NEKA 2LLZA 3W9JA 5KG4A 1HBNB 1TR0A 3QGGA 2FLOA 2HKEA 5C2GA 4M98A 5AE2A 5FUVA 4ZITA 3O5TB 1ZM3A 4NA1A 3EX7B 3RBZA 3D1QA 2WW4A 4DL2A 3BJIA 3OVAA 4QYZJ 1MWZA 4NI2A 4PAAA 3UPFA 1TKXA 1D9DA 4EBDA 2QLXA 3ZZUA 5DAEA 2RC4A 9ATCB 1CSOI 2HS3A 2DH7A 1NPRA 4GO7X 1XNRF 2DTJA 4RW9A 1F6TA 2V2QA 3DHWC 4B9MA 1TGSI 3D4JA 3ZZ0A 5JUMA 1F3FA 1VS3A 1YZ7A 4QIEA 3TARA 2W4DA 2M4MA 2FVRA 4P2XA 7FDRA 2IDLA 1ZYQA 1KNZA 1KSPA 4MYTA 4O44B 1U2FA 2CQ1A 2GAHC 1SGPI 5D0HA 3UN5A 2R8GA 2YWHA 5LMNF 1FRLA 2HVHA 3P5BP 1R8CA 4W92B 1TBOA 4AYBD 3CMAS 4B3TF 3TISA 4ZPTR 3GWCA 4LFBF 2RNEA 1S1UB 1FDBA 7FD1A 2MPUA 3RW6A 4WYLA 4F4AA 2AEFA 3FBFA 4J9UE 3FZ2A 4UZCA 2KT3A 1AW0A 1KP6A 3OT9A 4KTQA 1MWYA 1HYSA 2J9DA 3FOQA 4ZOSA 2GKVA 4F3QA 4DV7J 4CCHA 3MQGA 1N13A 3IWNC 4AFFA 2YKNB 2EKNA 3HO1A 2GA7A 1WC0A 4X4SA 5KT5A 3HFKA 4X66J 2MYFA 1B0VA 1FD2A 1H2TZ 2IPOB 1WG5A 4OYPA 2DNHA 2VQEF 1HQ2A 4J9QA 2M9KA 3MR2A 1HPZB 2UUBJ 2J7KA 2CQ0A 3TVZA 1RT4A 2WLGA 1BUXA 1JXLA 4M5NA 1G4CA 3VGUA 1BUSA 3JTOA 4ICLA 3QZ8A 2KXHA 4AQYJ 2MY7A 4OZJA 4A47A 3JQKA 3DLGB 2D41A 3PMOA 3L3CA 2Z0GA 3KHLA 2CQDA 1D8ZA 4DFMA 2QTWA 5MAOA 3ITHB 4DPXA 3NNAA 3DRRA 4FBTA 2QV6A 4JI1J 5A8RB 3MM8A 4IH5A 3I55S 1TKZB 5AJ3J 4ATNA 1QVFR 2J8AA 1RHUB 2EVZA 1T9VA 4WCEQ 5FUYA 5DJBA 1O51A 3CC7S 1Z7KB 4WK1A 2HFOA 3OR1A 4KGMA 4DCJB 4X62J 1Q7LB 3D0HE 1MJ9A 3W5YA 5D4NA 5DGBA 3QT7A 2L9WA 1BQMB 1KGQA 2HS4A 1TFWA 4EI2A 4BWJA 3FUYA 4ZHRA 1RT6B 1QUVA 1LFWA 4OIXA 3D1HA 4N7TA 1VDDA 2RH3A 1IKXB 1HLWA 3FFIB 1UW9A 1URNA 3Q23A 1KOOA 1FWYA 2UUTA 3TA2A 3TX8A 5G0RB 3TUZC 3WHIA 3TWDA 3M9NB 4ECQA 3T5KA 1Q82T 3IG1B 1B0TA 3RB3A 1TL1A 2NUUG 3N5FA 1N33F 2ROEA 1RAEB 2DBBA 2VG6A 3MCNA 1SGYI 1IVZA 3UN2A 3I5BA 4OX7A 2KM8C 2M2BA 2GAGC 4DV1F 3M32B 3C15A 3T1YF 5HANA 5KFDA 2MHEA 5KFPA 2HFVA 5KFIA 8ATCB 1Y7PA 1RFHA 1OYDA 3EICA 3LGHA 1HBOA 5CAAA 2ZHBA 5LSRA 4ZP6A 4ID8A 3DHOA 5CH7B 4PPDA 2NU4I 1UUCA 1WNEA 1UZDA 1RHMB 2B4PA 5ETSA 3PYDA 3FC3A 2ZOMA 1UVGA 2BDPA 4C0OC 1MMNA 3UVJB 1VC6A 1WGCA 4J9OA 4ZVPB 3KK3A 4QU7A 3D6TB 1RQ0A 2ZWOA 2FD2A 2HGNA 3VVUA 1NB7A 1JIHA 1SVDA 2D74B 3CSKA 3BREA 1KK6A 1YIJS 3FSYA 4FZVA 1VIXA 3ZC4A 1FK9A 1LK7A 1JLAA 1DFDA 4DV0J 1XNQF 2EC2A 3D54A 3TUPA 5KG5A 3QIDA 5DDOC 3OFFA 4LR7A 1TVRA 4A8MP 5KFXA 1NHUA 2F3CI 1CT4I 4JUZA 5J2QB 3SFGA 1J27A 1VK8A 1S1TB 1VR6A 2L41A 4M5HA 2FGOA 1ZS6A 2ZM6F 2E9ZA 2QA4G 3W9IA 4H4OA 2IM1A 4LRFA 5D0GA 4RW6A 1BXNA 3AH6A 5GVQA 1IR1A 1AA1B 4LR8A 1NDCA 2H5JB 3AB2B 1HQEB 3PJXA 2V67A 4F7VA 1TOTA 2K06A 3MOJB 3T5JA 3ZZTA 2HGMA 2Z30B 3G87A 2CPJA 2IUAA 1S48A 2J87A 1MJAA 3K7RA 3KJNB 1WHYA 3OR2B 2NXJA 4I7FB 4X84A 5KOWA 3QO9B 4JI0J 2Y1LB 2DRBA 1LWCA 1WTJA 2Z8QA 3IR5B 3CDAA 2ACMA 4ERDA 1FVSA 3UDCA 3OH1A 4LFBJ 4IOCQ 3TEGA 1Z2IA 2D9OA 2J5AA 1NHVA 3GYXB 3QTLD 3POTA 2KFZA 1OMUA 3OL7A 2JSXA 2JC1A 4F26A 4ELUA 3IBWA 2KN4A 4LF8F 3R5DA 2C2MB 4XO0A 1FERA 3A4TA 3OPKA 4N69A 4J91A 4OZLA 1W25A 3P47A 3BGRB 3CEDA 4GC6A 3TYTA 3BR9A 2NYHA 2UV8G 4R25A 4ZCKA 3L7OA 4X4UA 1T03B 2JWNA 3CDEA 4E1KA 2JC0A 1IM4A 5A0YA 3JQYA 2DKOB 3HHLD 4IUFA 3DLEB 4C8MA 1J2VA 1DBDA 4O3RA 3HJJA 2AKWB 4U7UK 1M5PC 3BKTA 3OL9A 3EZUA 3HJVA 2OI5A 1UKUA 2LU1A 4C3KA 2J9CA 4K59A 2OEFA 2GHWA 2ICYA 2AYEA 3E01A 2MQNA 2HQDA 3Q2TC 2RMLA 2RS8A 2AX0A 5BR8F 3KLEB 2UVOA 2NUHA 3FKBA 4QIFA 3S7RA 1XMQF 2ZZNA 1I94F 3O6QA 1VGYA 3GG1A 3RB0A 4U8VA 3KLHA 1FTCA 4KFBB 1RAIB 1KLMA 5HBMB 1O6XA 1XWLA 3FTTA 2ZOGA 1RHRB 2DNYA 2LVWA 4MZUA 1SH2A 4C0HA 5LL6d 3D67A 4DG1B 1WI8A 2OPRB 1VRTA 3EYZA 1X5SA 3G6XA 2NU3I 2GO8A 3RR7A 3DYAA 2HLTA 4LFCJ 1S1WB 4QU6A 3RAMA 1AFJA 2WVCA 3K89A 1TL4A 2QQDA 2YQPA 2E5LF 1NK5A 2VPYB 1KQFB 2KG1A 4M5KA 1TKTB 2RE1A 5D4PA 1U1QA 4UOGA 1PAUB 1HHQA 2KYZA 1OS5A 4UOFA 2VBZA 1SSQA 1V3RA 3BF4A 3NGTA 1V3WA 4NX9A 3MM6B 4FYDA 3KDOA 1JLCA 5KAKA 2ADCA 2B9WA 1N33J 5BXIA 3Q8YA 2FJAB 3UFCX 2RIJA 2ERWA 2ZHAA 1QDUB 4ZS6A 2R7VA 4K2XA 3F56A 4HI2A 3BXYA 3AY0A 1HWLA 3QQCD 4DV1J 4EABA 4H4MB 4O0NA 4DX6A 3F41A 5F8MA 2YH0A 2GGPA 5LJ5Y 4Q5VA 2B56A 3PFOA 3V5RA 3B8HA 3C6UB 2QPOA 2XMVA 2XS2A 1KC8T 1AUDA 3VCDA 4KGZB 1C0UB 2HIYA 2W7AA 2HWIA 2IU8A 4ZP9A 2BJ8A 2B9XA 4FKYA 2Y8WA 2GIVA 1WTFA 2WSEC 4NXMF 3S01A 3DM2A 2CNNB 3BBBA 2IMOA 3I96A 3AFGA 2JVOA 2AP6A 1KTVA 4IOAQ 5B08A 1IBMF 1OPIA 3MEEB 3KG1A 2UUAF 2VBYA 3IWLA 2E1PA 1LW2A 3HFZB 3TOAA 1EKRA 3UI3A 1HNWF 3OH4A 4G1QA 4FS2A 2ALZA 5F0UA 4A8FA 1N4IA 1QRGA 5H9EJ 4R36A 4RUBA 1NK6A 3KMQA 3G4SS 4IRDA 4HUSA 1A6LA 2CPIA 1RAJA 5A8WA 2C2DA 2CJYB 3DU6A 3HHLA 2OKQA 1SJQA 2IMWP 2VPXB 2OMLA 1FKOB 3QSYB 2ZM6J 4B9UA 3T6JA 2HVZA 1X0PA 4NLGA 1X0FA 2UXBF 2JEGA 3PR5B 4K50A 4DPWA 4KAIA 5IFMA 2CVIA 3JQJA 4FP9A 5IWAF 1RSCA 3OD2A 4K0KJ 1EZZB 5EN1A 1OIAA 3OTBA 4KY3A 2L7XA 2O01C 3KLIB 4LRCA 3GSIA 2PE8A 5A76A 1ZOTA 4DCLA 2VQFF 5BYQA 3O8WA 1S1XB 2XSFA 1HBMA 3Q1XA 2EKYA 3LP2A 2MGZB 1OQ6A 4KB7A 2ZDOA 2HNZA 5FLXU 3MAHA 1RE1B 2NQPA 2FJBB 3QWUA 2WCYA 1TURA 3DRPB 1TV6A 2G1DA 3E3XA 2JA1A 4LF8J 3PR4A 4IH7A 3G6VA 4BC7A 4CLPA 2Q1LA 4DL5A 1DLOA 2C3PA 3C16A 1TQLA 3FS8A 4MIWA 3H2LA 4EYHB 3SPTA 2GVZB 2JVRA 3FJ2A 4NEZA 4HURA 5J1EB 3VZHA 4KHMA 1IBCB 3VTIA 3M8PB 1NCLA 1VCTA 2F4VF 4G1IA 4YN3B 2C42A 2KZMA 2CZ9A 1JLFB 3J7A1 2FHJD 3JTNA 1MU2A 3K57A 3MCSA 1IKVB 2VKRA 4ZP8A 3CGIA 2VJVA 4K4TA 2C2KB 2AT1B 2CYYA 5GAHI 3OFEA 1XMQJ 3OTOF 4Z37A 1BQNB 1I94J 5FDLB 1Z4UA 4E1PA 1KQKA 3PVXA 4X4OA 3H2UB 1SSTA 1NH8A 4FXWA 2RDDA 1RBOB 2VC1A 2MKIA 3I9V9 2HHHJ 3IGNA 2V0KA 3OFGA 1Q86T 2YX7A 4GVBA 4L6V3 4UOCA 2BYCA 5DQIA 1S20A 1H72C 4QIWD 3MM7B 5C24A 1RA6A 3FCWA 2V8PA 2HURA 5DG7A 2AZ1A 2JLGA 4E79A 2F8EX 2YKMB 1AZSA 4H4KC 4TKTA 2B7BB 4LSZB 2M70A 1RAOA 4LBHA 1IW4A 3K5LA 3KWDA 1KMAA 1SV5A 4J90A 2AU0A 1VISA 5CABA 1MT1A 1ICEB 3PX0A 2MZTA 4OX9J 3KNAA 1PBAA 3MECB 1RTDA 2R42A 2KG0A 4G3SA 2MQQA 3NNCA 4PG4A 1QRLA 2W4CA 1YG0A 1DURA 3W65A 2YX1A 3OTEA 4AC3A 2QG9B 3KYLA 5CD4A 1RWMB 3MMCA 5LXYA 1Y5LB 2HLUA 3OLBA 1RT5B 5JXSA 3MMAB 1U1MA 2IRXA 5KFCA 4E6TA 5DQGA 3JYTA 1FRJA 1KFSA 2P5VA 2K1RB 1QY7A 3AJ1A 1S76D 2JEIA 3D9BA 1P9QC 1YJRA 2MLXA 1FDDA 1U45A 4R5PA 2FKOA 4TY8A 4NLYA 5DM6Q 2XSJA 2F7VA 1E6VB 3V4IB 1N8RT 4NCGB 2BOAA 4B9VA 1U02A 2OEGA 4C9DA 1F3VA 4G1PA 2BQ3A 1X8DA 1R0BG 2Y0BB 1W7WA 1HHTP 2FHOB 4OZ5A 2QIFA 4DUYF 2U2FA 1M8BA 5ETKA 2ROWA 1NO8A 1ULNA 2SGDI 4U7CA 3SI8A 3WQPA 1KGTA 5KFSA 4O0IA 4K4ZA 3F0NA 4PXDA 4OV6A 3KK1A 2MJUA 2R8KA 4USVA 1IR2A 4CLFA 2YNIB 1IBMJ 2DIPA 2RU3A 3G8QA 2F40A 1R89A 1HWKA 3NGRA 1ZM4A 2HZCA 4ID5A 2CNLB 4HT5A 4CNZA 4B3SJ 2WONA 2M8HA 1GT8A 1VOMA 3I3AA 2G4BA 5HMYA 4AAWA 2B5JB 5KG0A 2JEFA 4YDDB 1DRZA 1VI7A 2UZAA 3ULHA 2FIUA 2BOPA 4DL6A 3WX4A 4ZVFA 2KCXA 3UR3C 1CJKB 4X4QA 3HSDA 4OJ3A 1PTQA 1N5VA 3FBCA 3F1XA 3CJKB 4MFGA 5KOXA 4NOHA 1KR4A 2MLZA 5DDRC 2W24A 2DT9A 1U4BA 1R0CB 4GKKJ 1MROA 4TXSA 5I42B 2L48A 2FHJA 3QJJA 5IT9Y 3IAS9 5C2CA 3NKYA 3LP1B 3FZBA 3L9ZA 1JKHA 1FESA 4HHJA 3FCVA 2AV5A 5D3GB 1GTHA 4KHPF 2PI4A 2WVFA 4MT1A 3BYPA 2YH1A 2VQFJ 3NCPA 2BQUA 2V2ZA 1FVQA 3R5CA 2V68A 1EJ7L 5B0CA 3P49B 3I87A 1RBAA 2CPFA 4HKQA 1VIOA 2J7UA 2UVVA 2J9DE 1HIYA 1FDAA 1MSWD 3QIPA 2DR9A 1NPKA 2ATLA 3ZZRA 1PJ5A 2OP5A 3HSZA 4ECRA 1X4FA 2VZ9A 2XMUA 3UCGA 2RF2B 2K3KA 2JFKA 2C2NA 2DPJA 1TKXB 4C48A 4Q8EA 3EPGA 2GNKA 1R6YA 1RABB 2O5DA 4CI0B 2K2PA 2XY7A 3AD8C 2EFVA 3VNPA 4EAAA 2WBMA 2HNYA 2V50A 3PJWA 2O1PA 3CF5Q 3TQ1A 1VJQA 3H2VE 3VR1A 3AOBA 1GX5A 3GG0A 5KTQA 3BO3A 1M1HA 4BS2A 5ADXV 3R5AA 2ASJA 2F4VJ 3KHRA 3OTCA 1V5VA 5B0AA 1WUUA 4ES1A 4UY8T 1NJWA 2MKYA 4CLZA 2WVDA 1J5EF 1Y00A 2P6SA 1RTJB 2D3ZA 1QREA 3PV8A 2OLWA 1IBKF 1P27B 1QUPA 3M7VA 3OL6A 4KYZA 1FX4A 1PYTA 4Y2AA 3NBPA 1G95A 2N52A 2Z58B 1SC3B 3BQ1A 1C1BA 5GAEU 3I4HX 1HYSB 3O1LA 4LIRA 1EAYC 1J2ZA 4DMZA 1PAEX 3IBFB 2EK6A 4OJ1A 3B54A 3G82B 3IR6B 2MKCA 5CYQA 3B4DA 2BJ7A 4WF9Q 2FDNA 3GR0A 1HNIA 4TY9A 2EEYA 1VQSA 2DHSA 3O2IA 4Y65A 2ZWPA 5KG2A 4CYUA 2IVYA 4X4RA 4M1KA 2ROGA 2XYPB 1TBRR 4PQAA 5EWEA 2HZVA 2HHSA 4C98A 2Q6BA 4DCPB 3K5NA 4OYXA 5L1LA 4FYXB 5LOQA 1IM6A 4NLXA 4WFZA 2VU5A 5IT9U 3MAAB 4DV5J 3DKDA 4ER8A 1U48A 1WDDA 3SEOA 5DDQC 5JHWC 2MHNA 2HHUA 1R0AB 2KJVA 5AXNA 1S9EA 1FI4A 4F4KA 4I64A 4F4WA 5E3QA 3BSYA 1S57A 1T3OA 3HFVA 3US5A 3DRRB 4OI1A 4X65F 1CS4B 2KMPA 3Q8PB 2Z2YB 4P73A 2XHWA 4ZK7M 2MKHA 3DRSA 2ATCB 3TO7A 3CXLA 1O5JA 2GJFA 1LXNA 4WE1B 1CQMA 2BKOA 4K4VA 2K7KA 4PG6A 2UVWA 4B02A 1FXLA 2CJSC 2QYGA 3ZZYA 3UEJA 2HRUA 3W3SA 1Z2ZA 5HROA 3BN4A 3QYYA 2NREA 3GQCA 3TP2A 3UCZP 1K7UA 2WTFA 3VE5A 5ADXU 4I2QB 3V4MA 3K59A 3P45B 1KEKA 4DV2F 1HKAA 3KLVA 2CA9A 3ZZPA 4DQRA 3TO9A 4UUXA 4LBPA 1BD6A 2CWHA 4J9KA 5HLFA 3QATA 1L3SA 2GJIA 2OSRA 1I3OB 2BVZA 2IDEA 3OL8A 1CT2I 2F9JA 3C66A 2DRDA 4DR2F 5DS7A 5B0DA 2MQ8A 3DLBA 1M8NA 3QT8A 3ELHA 4KO0B 3GB0A 2X51A 2W2QP 2OGUA 5A6PA 3CXCR 2COLA 1T05B 1JJCB 2B9YA 3R1WA 2ARPF 2CVEA 1WC4A 3RRGA 3TNVA 5IM0A 3BS9A 2BM1A 2I1RA 2UUWA 2K7JA 3TANA 3IA0A 1WG4A 3TJAA 4TU9A 2ZJRQ 2CUYA 1Z2LA 2B6AB 2GHVC 2XM3A 4XPCA 2Z2MA 2C2EA 3LPEA 2WW8A 2YTCA 4DLGA 2XGQA 4RW8A 4WFBQ 4OHWA 2GIRA 3LALA 2CZ4A 1YU6C 2HSEB 3P3DA 4DV4J 3PM9A 5HJXA 2GMHA 4Y6IA 1IBLF 1MJBA 3TJQA 1VK3A 4ED2A 1X4EA 2XBPA 4HH1A 2GKRI 1K0TA 2M3DA 4RWXA 4TU8A 1FKAF 1VQ9S 2UU9J 2AJ4A 4OJGA 3EE3A 2G2OA 1HNZF 4NZ0A 2QL5B 1PCAA 3I32A 5J1PA 1PYOB 4K4SA 3KOAA 4C8LA 3FQLA 3BYRA 2N71A 1SGNI 2YNHA 3DN9A 5HJYA 3EJMA 3LP0A 2RQ4A 5SZTA 1YZ6A 4DL4A 3FMWA 3H42A 2QL7B 4U6PA 5HVFA 3DGPB 4R0EA 4RPFA 4GC7A 2ORWA 2DNZA 1Q7YT 1RCOB 4NLUA 3SZ2A 3HHLC 2BXJA 2D69A 4URQU 2CJ9A 1YRUA 4P52A 3VHQA 5IV3A 4IO9Q 4SGBI 2FJDB 5K8MA 2N7CA 2PEHA 4FNIA 4KPZA 4X2BA 2YNFA 3GPAA 4HACB 3BFPA 1FFSB 4H4OB 2FLLA 2OPQA 3KHGA 2BANB 1NNDA 1C1CB 3K2YA 3SQGA 4L75A 1Y1CA 3OUYB 2ZZMA 3BDEA 2IM0A 3QRRA 2I5JA 4JI5J 2XQCA 2A0FB 1ROFA 2R7RA 1SI9A 3PY8A 2E9TA 1GQEA 2SXLA 3NAIA 4USIA 5L9XA 1FTRA 2E44A 3QGIA 4P7TA 4I6AA 3BSCA 2PMWA 3FVYA 4DR3F 4DV3F 2EW9A 1WHWA 3I56S 4DR4F 1VRUB 4RL1A 1IBKJ 3M6UA 4HDGA 1LWCB 5L8RC 2R2UA 2BKPA 2OI6A 2QGFB 4DCOB 3TX0A 4TLRA 3ENQA 2XY6A 2HBQB 2ELIA 1UCNA 1IJFB 4B3OB 1WC3A 3RRHA 1RT3A 4J9SA 4UOHA 4I67A 3JSRA 5KFLA 2L08A 1T9TA 1U0HB 2JRSA 2LQ8A 1RTIA 2R7XA 2WB1D 3CJQA 1F5CA 1T8EA 4ZA1A 2BQRA 1P8GA 4IG0B 1NSQA 1M5OC 4CH0S 1V3ZA 2YPYA 3M1VA 2VPZB 5A0YB 4WFNQ 1S7HA 1NSPA 2HHPA 2PFFB 2J0XA 3PEHA 2WSFC 1N36F 1XMOF 5EUHA 1SGRI 5G4DA 5EWFA 3TJ8A 4J9PA 3GFYA 1Y5IB 2NLWA 4H54A 1RAAB 2P9CA 1H0ZA 3M2RA 1FARA 3JSMA 2CQ2A 2ZD1A 1RK8A 1S99A 2IAJA 2QIVX 1R0RI 4RNHA 2BJDA 3P5TL 4GRSA 1UJ4A 3VGTA 1V1HA 1F5AA 1REVA 4OMFG 3KLGA 1S5ZA 3KK2A 4K8RA 4OYBA 2XO6A 2GGQA 2KVIA 2A6OA 3PIOQ 1NKBA 4JV5F 4PWDA 3RR8A 4DPYA 5EX3A 2BJEA 1UVMA 4NCBA 2QLFB 3QWPA 1U1NA 5CZVA 5DQHA 1SKWA 2NXNA 5D8HB 3RG6A 2OELA 4EGLA 5KT4A 3U02A 3GQ7A 1WKXA 4NCAA 2MQPA 4HT7A 2EK1A 2AIRB 5C7PA 3L7PA 1JLBB 1RADB 3EM1A 3IRXB 4DS5A 1JLCB 2CQBA 2ZBQA 3VDPA 4WFYA 2DY1A 5F8HA 2J76E 1HM9A 2JW6A 2XS7A 2B3TB 3HXMA 5E3PA 5HK4A 2CQ4A 5CD4H 2X1FA 4OX6A 1RYRA 1XEZA 4HH0A 1GEHA 2Z4PA 5KT3A 4FVMA 2LKZA 2JF3A 2GGPB 3BSNA 1HMVB 2F5GA 1IWGA 4OI4A 5L39A 3BGLA 3U1NA 2HHTA 1RI7A 3VAKA 1PKUA 4EA9A 2LA6A 1K0VA 1U8SA 1LW0B 4IHFA 1FJGF 2VKZG 5BYSA 3DOMA 4NLOA 1BMOA 3C14A 4DQQA 3NZ2A 2XZTB 2G0CA 4B9LA 2C2RA 5KFAA 4LJMA 5CZXA 2DXFA 4U96A 4CTAA 4JI6F 3BH7B 1YJUA 1FYBA 3OJUA 4NLTA 1D09B 2IA0A 5M2UA 2NSBA 4WBFA 3DOKB 3D3BJ 3Q8SB 2OMOA 2VIHA 2KZZA 3CCVS 4FKXA 1HFEL 4JBCA 5T7LB 2FJXA 3HP6A 3H0PA 2GIFA 3AOAA 5KG7A 1EQ0A 2D3O1 3IS9A 1ZA2B 4YHHJ 1WWHA 3AJ2A 3H59A 4DFJA 4M2AA 4NXNJ 4P10A 4X64J 4WK3A 4E6UA 4JI8F 1P9YA 5LMUF 5BJRA 2JHEA 1UFLA 1RYSA 2MDAA 3MQHA 1S77D 4M5IA 1U09A 3GTYX 2DGSA 3H98A 4J9RA 2L3MA 4ZCMA 4KPYA 4YB7A 4LF6J 4QW8A 1WF1A 3A3OB 5DO2A 4O4RA 2SGFI 4CO5A 4DLEA 1GMWD 1XJWB 1VQLS 1KRUA 2UUCJ 1SC1B 4U67Q 1H2UX 3CMQA 1Y3KA 1R3NA 2HHVA 4WPAA 3UN3A 2V9KA 2VJUA 3QMQA 2RRNA 4OYIA 4NLRA 3LP2B 2O67A 3UGLA 1Q0NA 4CLLA 2HAFA 1NK4A 3J80Y 1WI6A 2HNZB 4KPXA 2C3OA 4I4BA 2DNLA 5K8PA 2J6TA 4USTA 2QFJA 1WEZA 4K5SA 1UL3A 5FJ4A 1NRKA 1RTHB 1JJ4A 4OYMA 3BBFA 1TV6B 2I6WA 2PDAA 2LQJA 3QNWB 2FZKB 4MK9A 2CQ3A 3LQVA 3K17A 4E2FB 3Q8UA 5AE1A 2JZ5A 1LQ9A 3H40A 3D0GE 2R7QA 1KS2A 2NU2I 2PMHA 4C7QA 3AD9C 1Q95G 4OHXA 1JQGA 3VAJA 4LF9F 2AJ1A 2H5EA 1S7IA 3BH6B 2AYGA 1J5OA 2W9BB 5EX0A 1PBUA 2VA3A 2FZCB 4GMKA 3ILJA 1XMOJ 1C0TA 1TTHB 4IFYA 4JI3F 2KXNB 1KRRA 1YRXA 2IFXA 2E7XA 1S6OA 4HDHA 5DZ6A 1OYVI 1NDKA 4KJIA 1WHVA 2R7OA 2R8HA 4M28A 3T3FA 2XWXA 3AODA 4JP8A 2PD1A 3PRBA 4L74A 1NHKL 2V4JB 4YUDA 1JK9B 3W2WA 4DPUA 3Q0AA 2H4WB 3JB9k 3HVTA 1F5BA 2IY5B 3C6TA 3BZQA 2XMWA 4Q7AA 1VQMS 1HBUA 3OVSA 2G13A 3J81Y 1KQGB 4GVBB 5L1IA 3MM5A 3EDQB 4KRWA 4NE9C 4C8NA 3QPIA 4DU7A 4PXBA 2CWKA 5HI7A 2QMWA 1CG2A 3W66A 4B9NA 3DLJA 2OI7A 4A46A 2D7SA 5ETQA 3TO8A 4KHRA 3M2UA 2ADBA 4JOUA 4WU2A 1H73A 4YOEA 4HI1A 3IXCA 4F3OA 4X4TA 4AD6A 5C25B 1RWWB 3HHNB 3D0IE 4QBUA 4DV6J 1SUQB 2DXEA 3V81B 4L72B 2HQ3A 4TU7A 4WWSA 2OD6A 1PILA 3G96A 5IC4B 1EX8A 2CJBA 1NSAA 5J8CA 4IG3A 2DITA 1PPFI 3MMCB 3I3XA 4CRJA 3CW2C 5HAOA 4ECSA 5L46A 4HCQA 1Y1BA 1QJHA 1SJRA 3NS6A 4BBYA 4V19J 3JYTB 2XO7A 2BA9A 2IJNA 1VQ4S 2ICXA 3FRYA 2R2TA 1AUSL 2DK2A 3TK8A 2H5IB 2ABYA 4I2PA 2L9DA 5B0GA 2VG5B 3CIMA 1JLEB 4F02A 5DGAA 5F42A 4W4MA 2W2NP 4TY8B 1ZA1B 1LWFB 1GMWA 2JLFA 1I1GA 3PXGa 4F8RA 2XMAA 4HVZA 3H5YA 5J2NA 3CO9A 1RDRA 4RU2A 1A9NB 1NXUA 2DGTA 2IBKA 3LAKA 2UXDJ 4X66F 2BJ3A 2YWKA 3N28A 1FDNA 1LKZA 1V5IB 4DSKA 1OSCA 2AX1A 2GVDB 1HBNA 2IVMA 2KU7A 2MKKA 2UUBF 2M0GB 1DQ8A 2ZH1A 1KBRA 3S8SA 3LAMA 5F41A 4NPOA 2ENZA 2NR0A 4Q2MA 4L9MA 1EQMA 2WONB 1RAFB 5E3RA 4JI2J 3OFHA 4AQYF 1L0SA 3LA0A 4DF8A 3H90A 4AT1B 1QSYA 3MPWA 2ZBRA 2MY8A 3K5OA 2FC9A 3DK5A 2XWYA 1CVJA 3IC1A 1GMUA 2DR5A 1N34J 2VFRA 5HMWA 2LA4A 4CLYA 2CNOB 5U47A 4JI1F 2XMMA 4F67A 3PW4A 2DNPA 4Z7YA 5AJ3F 4W90B 1CULB 1ZBTA 4F4XA 3CIZA 2FJEB 4RWWA 5K14A 2JF2A 2E7WA 1SL0A 5D0RA 4CO2A 4O44A 3VDUA 1JNZB 2V8HA 1E6YB 1S1VA 4WXWA 2VA2A 1SKUB 3DHXA 2B51A 5DZ7A 4WP8A 2FLPA 1HNVB 2QKXA 4G3PA 4ZPVR 2A2CA 1S1UA 1DQAA 4URGA 3ILLA 2F4FA 4WP4A 1PTRA 4ZDNA 4DR5F 4HZCA 5H9FK 4TNOA 1KQSR 4I68A 3CULA 4QR1A 2YKQA 3I0RB 2Z2LA 2V69A 4LF2A 3UQSA 3TVKA 1SSMA 4A48A 3BN7A 1RU2A 1DTQB 2N3OA 1JLQA 2YKNA 3R2CJ 1WD6A 4USWA 1TAQA 2BE7D 2WAQD 5HN0A 1HEVA 3NY0A 4DL3A 4TN2A 1XTZA 1WOSA 2AJ0A 3E59A 2XYGB 3I9ZA 5F8IA 4ZVQB 3AOCA 3ET6B 2V2KA 1HPZA 3CC4S 3A3NB 4DHVA 1Q53A 2A20A 1AXQA 2V4QA 2HNYB 4KE5A 2E1RA 3V6DA 1XMBA 5FIIA 4G65A 4X4NA 1N6QB 4ANDA 1TBQR 1KN6A 3IM9A 1CSJA 2J0QD 2VD4A 5A8KB 1QLNA 3CJRA 1U0SA 2NPIA 1H38A 4FN5A 2GQCA 3ITHA 1NK9A 5DDPC 3Q8VA 4WIIA 3OSPA 3V2UC 2V4RA 1TAUA 1Q5YA 5A8RA 4QIVA 3W63A 3THTA 5DG3A 1RWUA 2GKTI 4QWCA 4NRTA 2V8GA 4Y34A 2YXLA 1K7TA 1OMTA 2UP1A 1C1BB 1CGII 2C2OB 3MAQA 4DV0F 2DO4A 5ETVA 1T02A 2ILYA 3EGVA 2KHDA 2HMIB 2EBEA 4KKOB 4GKJF 1ZTTA 4I6YA 1KBEA 1WSVA 1SH3A 1BQMA 5CYQB 5CYMA 2HVEA 2GO9A 1RT6A 1K1QA 1LV5A 3T19A 1HNIB 2KI2A 4ZVHA 2IBOA 2LYVA 4NZ6A 2ORVA 1IKXA 4YB6A 3H5XA 3FFIA 3I5AA 4LMZA 1V9OA 3BEGB 3AA8A 1Y0HA 2AJQA 5G0RA 5KFKA 4NLQA 1W2IA 2CDRB 4NMLA 3IG1A 2VHEA 1CJTB 3IWXA 4JV2A 3EVOA 2OD1A 1AROP 5ETMA 3MXHP 1DAXA 4O3NA 3H4BA 1IY5A 5FUXA 3M32A 1UVIA 4UXIA 1T9YA 4IYQA 4JI0F 4OI0A 1X5OA 3IAM9 3R5BA 3GFXA 1FD8A 1P1LA 1DARA 4D3HA 4G87A 2EFQA 2EI5A 2HQGA 3OVBA 4DQPA 3JSBA 3GMGA 2G0JA 3CWJA 2W9AA 2GX8A 3EVWA 4G3QA 3DRSB 2FVPA 4DR1J 4O3OA 2EXUA 4ELTA 1HQUB 1DTTB 2HK3A 2KJWA 1I6JA 2V0HA 3OH0A 4FS1A 3QJPA 2X3GA 2ZH8A 4K5RA 3IM8A 2CADA 4OYAA 2LQBA 3MM9B 1F9EB 4C0BA 3HZGA 3UVJA 4C2MA 1CEZA 2KRBA 4IQXA 1N4LA 4DZDA 2DH8A 4ECVA 2DY9A 3R8YA 2WVEA 2AEMA 5I3UA 2IJRA 1SC6A 4Q43A 3FGVA 3PHEA 2MZQA 1VBKA 1X7VA 1S79A 4P7VA 3E8OA 1FNOA 5C5JA 3ADAC 2DCUB 4F0HA 4WTYA 3NS7B 2HQFA 2F8HA 1S6QB 2DNRA 2W1BA 5J2PB 3GZ7A 3WBZA 3W64A 2F3JA 4ECZA 5AT1B 4ZKAA 3A3PB 2KT5A 4UZBA 2RRBA 2QO3A 4PRFA 2VBWA 1S1TA 4OZ3A 4ISXA 4A8WA 3HHEA 1P9ZA 2AYMA 3V4EA 4EA8A 3KMSA 1UWBB 3EG4A 1UA0A 2DEJA 3NGSA 1FE0A 1TK0A 3PRVA 5A2QY 2NS1B 2LQ9A 2VV5A 1V67A 1HQEA 2MZRA 3V6HA 3TR5A 2YWFA 3LANA 1Y9OA 4DQIA 4J09A 4HR2A 3CD7A 4A8OA 3GIMA 1NU4A 4LFCF 3OR2A 3QFWA 1VQNS 1KONA 4XAKA 2QQ0A 3H5SA 5KFFA 1IWAA 1CJUA 4RKUC 4UXJA 3MR5A 3BKUA 5AXLA 4ED7A 1EIYB 3GQAA 1BLUA 4C8KA 1RTZA 3DOLB 3FMBA 3KJQB 3OH3A 3O3LA 1HM0A 3KG4A 1REGX 2P9GA 3GIJA 2U1AA 4DR5J 4DF4A 4K4UA 4DX5A 3SGQI 3T1AA 4F4YA 2ZH2A 3SSQA 2HRTA 3BGRA 4ETXA 1M5HA 1T03A 3LGMA 5DLGA 4P72A 4NRUA 3DDNA 4N56A 3DLEA 8RUCA 4FNHA 4I56A 1U25A 2IC3B 1JB0C 1D1UA 3M9OB 4ZLNA 1N0UA 4MFBA 1ZM9A 1X5PA 4ZVRB 3C46A 4MK7A 4LF4J 1PJUA 1WSRA 2CPYA 4NYOA 4L76A 4KGVB 1TMJA 1U26A 2UXCJ 2Q66A 4LSLA 1QE1B 2YX4A 1DJ0A 3KLEA 2ASYA 3UD4P 1F9FA 3PKYA 1FXJA 4ZPAA 4MKVA 4MKYA 1NLKL 3VAMA 3AHPA 2JNJA 3EPIA 1Y8FA 4PABA 2MZJA 4M5JA 4OI2A 2AGOA 3MMJA 4KFBA 5HBMA 1L5UA 1B7YB 2OEKA 3OBIA 5FD1A 3RB6A 2XMKA 1IKWB 1TFYA 2PA3A 3D2WA 3ONQA 1JWWA 2R7TA 2VF3A 1OVOA 4LVNP 4BWMA 3RUBL 3H4DA 3HSGA 3MR7A 4DG1A 4HHUA 4Y3CA 3M30B 2OPRA 3J7AN 4DUZJ 3JXOA 3MTJA 4DN0A 2DNGA 2ZJQQ 3VF0B 1Z2FA 1U2RA 2ZFHA 1S1WA 2N82B 4GKJJ 3VAGA 2OO4A 2RD5C 1S0MA 3R3RA 3FNNA 3OQ2A 3VWSA 2CJXB 3AXMA 2CWGA 1TKTA 1G6BA 4E1RA 3M1VB 1XHDA 2R2RA 4U95A 4IO1A 2LEAA 3A8JA 4LSNA 4A24A 1DQ9A 3CCRS 3UNGC 4AE5A 2OPSB 2A3JA 3JQMA 3UW1A 1TL7B 4N77A 5A2QU 2Y0SD 4K0KF 4YR0A 3VAIA 2GV1A 1R8HA 3ZTRA 4AUKA 4MK8A 2XLIA 2VG7B 1AN1I 1LXAA 2VFTA 1Q9BA 3RBXA 3ZXWA 3JSMB 3V6JA 3MOZA 2ZD1B 3MEKA 3PW5A 3MCMA 2FVCA 1MMLA 4H4MA 2E29A 1UTAA 1S0NA 3GJQB 5HVHA 4MIAA 1YKWA 3NL0A 1FRHA 1XBTA 3SIPB 1NZ8A 3C6UA 4OHZA 3PG9A 1FO1A 5E2QA 4R37A 4O3SA 3ISND 3SBMA 1M5KC 4DU8A 2HHQA 2MLYA 1UEUA 3DU5A 3UE2A 3CCTA 4PWDB 2H1YA 3QGPA 4PWUA 1FRMA 2HGLA 3T57A 2HBYB 3BSAA 3CD5A 4NLVA 1X4DA 3BSOA 2HNDB 3THPA 1OMSA 5IOLA 1NZAA 3TZYA 3OTZA 1YJVA 3BR8A 3EXYA 1S72S 1S12A 2R7UA 3G6ES 1ZTWA 5C42B 1EARA 2ZE2B 4DEZA 3FSCA 3M8SA 5L1KA 3PACA 2KVQE 1WOOA 1D3WA 5M2RA 3K8VA 4Y00A 3NCRA 5D4LA 3UR0A 3K58A 1NK8A 2F1FA 1DZ5A 1MMDA 2EFOA 5L6VA 4JI7J 1VQ8S 3IBCB 4HTIA 3PO5A 3ZTOA 4DZ6A 1WKJA 2GIQA 1U5KA 5CQGA 1OCXA 1Q1KA 4DR6F 4ZP7A 3NGDA 5EGYA 3WX8A 1WC6A 4KV8B 3TAMB 2HHHF 4N5SA 3DMJB 1PYSB 1SGDI 3UEYA 2HFNA 4CLWA 1YJ9S 5ETPA 1JLGB 2PMZD 3MTKA 3M05A 3TA0A 3M6XA 3D3CJ 2J9RA 4CLSA 2ODDA 3KLIA 1HARA 5KT7A 1GXUA 1H74A 2I0XA 3RGIA 4YQWA 2SGPI 3BRKX 2B0GA 3CNQP 1S1XA 5K20B 1SGQI 4J9VA 1THJA 1U6BA 1YSJA 1WKKA 4Y2IA 3MMBA 2MGZA 1LXJA 4OX9F 1UAWA 2YBVA 2Y1IA 3A8EA 5DG9A 3BGUA 1T3DA 4M8LA 4OYOA 3MF5A 4H7OA 2Q6CA 3NGKA 3OXLA 3DRPA 4GI3C 4OZNA 1QSSA 3IS9B 1ZPWX 3N9UC 6AT1B 5MLCV 2AHOB 3GOSA 3VQTA 2BE2A 1X60A 2KM8B 3BV8A 3T9ZA 2BACA 3ZTQA 3KJVA 2G2ZA 2GVZA 5JVHQ 4ED6A 2DO0A 2KO1A 5J1EA 5FUWA 4AXIA 3HVAA 4QIGA 2HQIA 2ZH7A 4OZ2A 2LEBA 1JLFA 4HLBA 3HF5A 2A10A 2LU2A 3VBJA 4V1Ak 1TL3B 3UD3P 4LRBA 1HR0J 5AXKA 2ZUGA 5CYJA 4QYRA 5SUHA 4WP3A 2O3DA 3GYGA 1FA0A 3W5ZA 5I3QA 4GO5X 2XB2D 1BQNA 1LWEB 5FDLA 3HVRA 2HWTA 1QM9A 2HWHA 2BX6A 1B7FA 1N54B 5CA5A 3SCIE 1DHMA 4EBCA 3QLHA 4J9NA 2A18A 4ZIVA 2FGCA 7AT1B 4B3SF 2DR8A 5KFEA 5HSPA 5KFRA 3DI6A 4JI4J 1RBLA 3A8KA 3QT5A 4AXJA 3OV7A 3KWMA 4KSEB 3BPDA 1K9MT 5ETTA 2QLJB 6FDRA 3TOQA 4DN9A 4B3RJ 3R7SB 4USUA 3ST8A 2W01A 2RU9A 2HZAA 2V8DA 1L3TA 3MECA 2ZH6A 3KWEA 1JNRB 3SFUA 1EETB 4GKKF 3BQ2A 1TZ0A 1YI2S 1HA1A 4MAKA 2M5XA 3CCZA 4M5GA 3W8PA 1BWEA 1C0TB 2CDQA 1VQYA 2ZBCA 1WF2A 1OPZA 1RT5A 4F2RA 1F60B 2OD4A 1X4SA 2K1RA 3U27A 4CP5A 2KFNA 1VQKS 2XTJP 1HW9A 1VDHA 2LMIA 3KLFB 1NAQA 4K4YA 4WKRA 2RVJA 1W2BR 5GADU 3BGOP 2BRKA 2D9PA 3HVTB 1WF0A 3C6TB 1E6VA 3V4IA 3F44A 4NCGA 5I3PA 1HBUB 1YVFA 4RW7B 2VL1A 3A12A 3AA9A 2YQ1A 2A6MA 2ZH5A 2B0UC 4NYPA 3LH2S 9RUBA 5CCMA 2ZH9A 1WKLA 3VBPA 2HS0A 4B9TA 2BV3A 1M5SA 2FJVA 2WHOA 1G2EA 4ECUA 1NMEB 2X1GA 5J8FA 2F63A 3SGBI 1CJVA 3DC2A 3TV0A 2V0NA 3RRKA 4FXDA 1RT7A 3UDLA 2NXCA 5K5MA 3CJ2A 2YNIA 3FCHA 4DUTA 1VFJA 4C6AA 3AQOA 3J81j 3MD1A 4DR7J 2CWFA 4TQRA 5B0BA 3THVA 3QBCA 2RRAA 3ICLA 4K2JA 2B5JA 2P8IA 3HHDA 3R6LB 1CBKA 2B8QA 4C11A 1JMTA 1S6UA 3N79A 3G2XA 2GQQA 3GFHA 2KMRA 4B08A 4O4GB 1CQNA 4IRCA 4TQSA 4YEAA 4RO0A 4PZVA 4MPIA 2RDIA 1ZH5A 4UQTA 1CJKA 3D7SB 4OJHA 4NEYA 4OVOA 4USKA 4USJC 2DHGA 3EZ5A 4MKAA 3CJKA 2WK4A 4YP3A 4YFUA 5GAGU 4B17A 1QAIA 1LFPA 3D28A 4Y0FA 4LT6A 4DR6J 5I42A 4QWEA 2EPIA 2GW8A 3D66A 4C8YA 3S6EA 4N76A 3PFEA 1VQPS 4KH0B 3FEYB 3LP1A 5HATA 3NWGA 4IFVB 1KK4A 1PO6A 3DJ4A 5KFVA 2BUNA 5LT5A 2V0IA 4DPTA 4PYAA 1MLAA 3PW7A 2LUYA 1EP4B 1UPMB 3HLUA 3D00A 2DB1A 2MSTA 1UW4A 4JYAJ 2YNGA 4RW4B 3MUVP 4OI3A 4WU3A 4YY3F 2ZH3A 2G0IA 3D6MB 4LVOP 4DL7A 1CC8A 2AJ2A 1C2PA 4PEOA 3PEJA 1A0OB 3SDEB 4QWBA 3TEHB 1FT8A 4IHGA 1GXTA 4P2SA 1X5TA 1CE3A 3D6HB 4DV5F 1U7LA 3MCOA 2RF2A 1WGTA 4F3MA 1F0XA 4UTGA 4KIAA 3CDBA 2OAUA 3GV8B 4NZ7A 4ILMA 2BR0A 1CC7A 2LEOA 2DHAA 1RXOB 4J5OA 4MJKA 1KVKA 4EEYA 3JTPA 4QYZK 1CHOI 3LPYA 5J2MB 3W9HA 4QWDA 1T95A 1VQ7S 2DB6A 4C3LA 4EO8A 4CH7A 2NCKL 4MH8A 2HIQA 2B4OA 3EDRB 5K14B 1V1IA 4EBEA 3PX4A 2BMBA 5AXMA 1GMVA 1S1VB 1RTJA 3JS9A 5HVGA 3SYZA 4S0MA 2W8LA 4CO4A 2H3EB 3OTDA 3HMJG 1HNXJ 1WELA 1X4BA 3C2PA 4OHVA 2A2DA 1U2CA 4KPCA 3D1OA 4C8ZA 3PW0A 2YQ0A 3GSDA 4EYIB 3Q8RB 1Q16B 2OPPA 3MFIA 5GAEI 1CGJI 3MEDB 4HZDA 4LUBA 3PIPQ 2XG8A 4NASA 2FB0A 2AWZA 2CPEA 1NB2A 4H4KA 2CG8A 3G82A 1JLQB 3U7JA 1SB6A 4XIUA 1RHJB 4RUCA 2UVUA 1RT1B 2IA6A 4CLUA 1N0VC 2FHKA 2LXFA 2RKIA 3NNHA 2IC7A 3KDNA 4WYWA 5ETRA 4EK2A 2KXFA 3MD3A 4NLWA 5CHCB 3IN5A 1SJFA 2FJWA 2RAQA 2DVIA 3V6DB 1OO0B 3IR7B 4EGGA 1RT2B 2Z56B 4F4ZA 3MAAA 3IO1A 4EUVA 4DV4F 1KFDA 2QLBB 4I1TA 4ZPCA 4LF7J 1R0AA 2NPFA 1H3DA 1NSKL 1VHIA 4PQUB 2VPWB 4ILRA 3G71S 4ED4A 1NPPA 4F2SA 2WOMA 2B8TA 2FQQB 4ZLPA 3Q86A 4LF5J 3UGDA 3W7BA 4JCVE 1YJ7A 2HFUA 1CS4A 3DRXA 3MEGA 2UU9F 1VMBA 4PKDB 2YWEA 1FX2A 2Y1JA 2BRLA 1OSDA 2Z2ZA 3ENWA 1SKSA 2PC6A 2ZDPA 2FNFX 2ZKTA 4WE1A 4F0KA 4IQMA 1FWPA 4K6RA 2YPZA 5LSLA 1Y3JA 4RR5A 1QRMA 4Q45A 1P1TA 1T9WA 3MWBA 1U1RA 4M95A 4NI2B 3PDNA 2RSQA 2E73A 4WJBA 3C3LA 3CO0P 3M8QA 3SV4A 2QLWA 2SGEI 5CYMB 3HH2C 3DLKA 2QA1A 3H20A 4CO0A 3BSSA 4I2QA 3DLLQ 1FRIA 2ZBIA 2MZ1A 4R8UA 1RHKB 1M1GA 4RZRA 4DDFA 4RW9B 2BW2A 4ZN3A 4JI5F 1KHVA 4NL5A 4F36A 3HM9A 4P75A 2AQ4A 3GJSB 2FVSA 4CH1A 2QE5A 3UOEA 1TUGB 3WC2A 4KO0A 4ZLLA 2XCPA 1SJ4P 1MN9A 3GIKA 1FF2A 2OIHA 2CAJA 1H7WA 4DSLA 1X9MA 1T05A 4FYWB 2BBEA 5CXTA 4LREA 1RZMA 4ECTA 2BABA 2B4UA 3T1HJ 1OY8A 2DYAA 2RUSA 2YQ3A 1WORA 1SH0A 3C8YA 2B6AA 4B3MJ 3GP9A 2DKVA 4CO1A 4RJVA 2QQEA 1UZHA 3IMQJ 2KKHA 5HL7Q 2YKOA 3HSQA 3GV5B 4MYUA 2V1CA 5D77A 2AD9A 5F9NA 4M5DA 4LR9A 1Q81T 2F8MA 1FWKA 3IRWP 3HZEA 1IQZA 5F3TA 2HQCA 1IN0A 3HKZD 2MEWA 1YWXA 1OWXA 3CCJS 3T9NA 5E5NA 3A13A 4OZ1A 1S4FA 1MRLA 4LRDA 3J7Z5 1H0HB 3AAWB 4ZVUB 4FDFA 2V6AA 1VBZA 5I3UB 1BY9A 2X3DA 5KT6A 5IQ6A 3GLJA 4TYAA 5DRKA 4YY3J 1RT4B 2VHGA 4AL5A 1GX6A 5L6SA 1Q79A 5JVGQ 3M6VA 4ICLB 4RBUA 2KYXA 2KFYA 2W9CA 5B09A 1R31A 3BB5A 4FF4A 3DGPA 4USHA 5D6GA 2R7SA 4NWBA 3CJTA 3OUPA 3PYEA 4YR2A 4WKYA 2CKWA 2PIIA 4TVAB 4HACA 3W61A 2PO4A 1XNRJ 2V0LA 3MM8B 2BANA 1YQHA 1C1CA 1K44A 1X4CA 4ZVOB 3OUYA 1F2GA 3VBIA 4G3IA 2V94A 5E3AA 3BKFA 4K7QA 3FBBA 3JSYA 2AW0A 1UMJA 5LXRA 1QAXA 2QEXS 3OR1B 3BGFA 3NP5A 2HG4A 3R1HA 4ZPBA 1RACB 5IT0A 2XGPA 1VRUA 5LMNJ 1CJUB 2QZ8A 5KFYA 4B3TJ 3CMES 4ZHRB 1VJWA 1SJ3P 2QFIA 2CZVC 1HDLA 3QFHA 5I4MA 4RNFA 2XMTA 2WLCA 1XQIA 2E7VA 4B3OA 3KUHA 1AB8A 1LOUA 2XEXA 3GFZA 3CD6S 1UEVA 2M7SA 2J8SA 3ZO7A 1X4HA 1U0HA 1XATA 2QN6B 1KRVA 1S9FA 4N6AA 1TL1B 1RWKB 2FVQA 3TAQA 4IG0A 2HBRB 1EWWA 2DR6A 2VG6B 2RB7A 4Y2CA 2HEKA 1U1LA 2XULA 2I5KA 1RP5A 3MGJA 2YVSA 3C15B 3CJ8A 3Q83A 4M99A 1V6HA 2VFSA 2WCXA 1KHWA 2M8DB 1IKYA 2VQEJ 1S9GA 4MKBA 4JB8B 1RAGB 4RNMA 4Y2MA 4YMEA 3CB4A 2DISA 1TL5A 2HPUA 4YR3A 4MFBB 1HBOB 4C4WA 1FWLA 1ULMA 3L09A 2KH9A 5B0FA 1Q8BA 4USMA 2L9NA 1Q8IA 2DNNA 3WIUA 4IRKA 2WVBA 3U1LA 4LSLB 2ZH4A 3R27A 1MWQA 1N52B 3HCXA 3D68A 3TZXA 1FKPA 1KK5A 3I6PA 4EQYA 5KFQA 1XK8A 3AQPA 4OYZA 5H1SV 2IHR1 2LEPA 3OXFA 3KK3B 2ZVIA 1UJ6A 1FRXA 3TAPA 4W98A 3ISNC 2W7PA 4WFXA 3RAQA 2CPZA 5JMNA 5HMXA 1AYEA 1FK9B 2MXYA 3NOCA 2E1AA 1JLAB 3MPUB 2CPDA 4YHHF 2M88A 2GGOA 4PUOA 4N6BA 2GMLA 5M2PA 3UFFA 4DFKA 4NXNF 1U47A 1TK5A 2J0SD 3GU0A 5KFUA 4YDXA 1TVRB 4X64F 3WZ0A 2DEIA 5KFNA 1HWUA 5IXUA 5LM7E 1ULRA 4DI6A 2RHSB 5FLXY 1KD1T 3J7YI 4OL8A 4NMXA 3TRGA 2XMJA 2Y8YA 3HHKA 4CLKA 1TUWA 3LF0A 4LSNB 3EGNA 3I0SA 1M5VC 3VALA 2QC3A 3OW5A 2YWGA 1TP7A 4LF6F 3PYGA 1JLBA 4RW6B 3UGIA 3IRXA 2Y9HA 3CUNA 1RWVB 2G9OA 4XDCA 4ZJQA 1BE4A 2WSCC 4UF4A 4J37A 2UUCF 1QQ0A 2DHXA 1B70B 4M63A 3DFEA 2OHDA 3QAUA 2OTLS 1KOHA 3SXLA 3OHAA 4OHYA 2E1CA 2P2OA 5ETOA 3T1YJ 3GOXA 4DWIA 3Q24A 1HMVA 4DOZA 1MR7A 3ECTA 3TDTA 1RB0A 2LP4A 2C22A 1ZAXA 4IR9A 4M94A 1LW0A 2ACYA 1PG5B 3POTB 1HHSA 2DNKA 2VFVA 7WGAA 1HL6A 3PTWA 4Z7CA 3OW2R 4Y28C 4KGKA 3B4MA 1UEKA 2C3MA 1C4CA 1BMQB 1XN9A 3M9MB 2IYIA 3DOKA 4EFAC 1WG1A 5LSOA 4G6VB 4WP9A 1SXLA 3ENVA 3NS5A 5T7LA 2CQPA 1M1KT 2GCFA 3X3UA 2FUG9 1WJ9A 1TUSA 3UWTA 2ASDA 2JXDA 3VV2B 3KUGA 1XNQJ 2P6TA 1OQ3A 3E01B 4ILLA 2ZITA 4EZ9A 4E0DA 3AJDA 2MZSA 2CIMA 2GFFA 1DS2I 4RUAA 3R3IA 2OU2A 1BQXA 2I9SA 1C4AA 1U1KA 2E9RX 3H8YA 1RUSA 3KLHB 1KLMB 4C3MA 2GS8A 1W3SA 5H9EK 3N6NA 1XR7A 1GTEA 3SUCA 4QPXA 2JJ4D 3HK2A 3HI9A 3VBNA 1V3SA 3FSXA 3R7BB 1QTMA 1B3TA 2DGXA 3K5MA 4LFAF 2MKJA 1R79A 4E8UA 3KXDA 1VRTB 1AT1B 3VBKA 1IR0A 3CJ0A 3DYAB 1CPZA 1X31C 4A8QA 4NYZA 3LOUA 1SC4B 5KFGA 1HV9A 1T94A 1LWXA 4DQSA 2EG2A 3MMBB 3J7YU 3W5XA 1S6PA 3CE8A 3LW5C 5IQQA 1XIQA 1RWPB 4DV6F 3R0SA 2P9EA 4PR6A 3N5BA 1AFIA 2CQCA 2V0JA 3A1YG 3PKMA 1L3UA 1MNEA 1RTHA 3C19A 4FF1A 1GXLA 1HWIA 1L3KA 2PA8D 4K4XA 1SL1A 1R27B 4Q0BA 3UDVA 2BE2B 1VQ5S 1PCEA 4F04B 4URSA 4AMLA 3KJVB 2V9WA 2WLFA 3ZNJ1 3B78A 4DS4A 3RW7A 2W9BA 1SQEA 2ZBPA 1UVKA 3PZPA 1KRPA 3IP0A 4ED5A 1B99A 4KT0C 4DSIA 5D0EA 3NLCA 2RDJA 4LIWA 2UXDF 2LECA 3MUTP 5BR8J 2NU0I 3TVYA 2CG4A 2CWXA 4PPZA 3DM2B 2JEJA 4ED8A 3T6BA 2XLKA 2QA4S 3M8ZA 2JH3A 2V4JA 1JJHA 3FRZA 3CCSS 4BCAA 2FHMA 2PSZA 3QT6A 2CPHA 3K8WA 1WACA 3OGZA 1PC4A 3QLHB 3N0VA 3CDWA 1LR9A 2VFUA 5E7OB 2J0WA 3OXGA 3HKWA 4JI2F 4IDKA 4ECYA 3HD1A 1LW2B 1RHQB 3DI6B 5L9NA 5HP1A 1ACMB 2DRAA 2ZOFA 2OZUA 4M5LA 4G1QB 3NGUA 5K8NA 3NMAA 3E2IA 2W4PA 3P1BA 2W2PP 1FEEA 2V34A 5HQMA 1N34F 3CCWA 3VQSA 4QCLA 1GNKA 5A8WB 1X9WA 2E5LJ 3HHLB 1FE4A 1R6VA 5C25A 2KMQA 1ZPVA 1B0PA 2VUGA 4Q44A 1SUQA 4U7UD 5E0OA 3FQKA 1NUBA 3MR3A 3V81A 2KT2A 4ZJOA 3PRDA 2AYBA 4Y2KA 2J6SA 2X1BA 4LBIA 2NU1I 4QZVB 1Y11A 2PI5A 1YJNS 4XK8C 3KTQA 4UXHA 4ZCLA 3MPDA 1WTBA 4RNOA 2E5HA 1FNXH 3UO0A 1M90T 4PXEA 1GK8A 3M2VA 3VGSA 2MTLA 5E33A 2QA2A 3LWLA 3H7HB 2VG5A 2HAIA 2XC9A 1JLEA 1WEYA 1HBMB 2X7IA 1PIEA 3FSBA 1OY6A 1LWFA 1FXDA 4ALZA 3FEZA 4I6WA 1RCXB 2WLEA 4OLPA 3DXSX 4ED3A 2VOOA 3K0JA 3HDSA 1T11A 2EFNA 4NXMJ 1KKHA 2DIUA 5KT2A 4ELVA 2GVDA 1DLOB 1CJVB 3C16B 4OYWA 2IRUA 4YB1P 4PG5A 1HI8A 1RT7B 1URRA 1KDNA 5ITHA 3CT9A 2C3YA 2UUAJ 5D78A 4DX8H 3LGNA 4C11B 5AFUV 5DM7Q 1HNWJ 2R9LA 2DR7A 3EMTA 2B8PA 1FNMA 2ALYB 2CXEA 2RUGA 1KVJA 1MU2B 3CJ5A 1N5YA 1Y4ZB 1X74A 3MFHA 4KGXB 5L1JA 2W0VA 2RQCA 4QPTA 5THWA 1UVLA 1ZETA 1G3OA 1YX2A 2I38A 2J9EA 5GAHU 3UD5A 5F9LA 1KVIA 1ULKA 1DY3A 2OSQA 1TKDA 1JXVA 1H6KX 1NK7A 1CULA 4OI6A 2XS5A 2XCAA 5IC6B 5ETNA 2YY3A 4IR1A 1B4SA 2UXBJ 1YP2A 2CQGA 1FJEB 2FLNA 5D4OA 2IJFA 2H54B 2V1CC 5IWAJ 2ZKUA 1E6YA 1PJ6A 1F1BB 3F73A 4LFAJ 1D9FA 5C24B 2ZC4A 1Q8LA 1Y5NB 3H5UA 1HNVA 3HT0A 3MR6A 1AZSB 3KJFB 3TIOA 1PSDA 3I82A 3NCQA 3D8VA 3UNYA 2ZUAA 4P74A 1FEHA 5F0WA 3OTMA 4DSFA 3G86A 4LRAA 2BE9B 1SV5B 3N4WA 2F65A 2YNGB 2POKA 2BJ1A 2XY5A 3I0RA 2LFVA 2E5IA 1RTDB 2W0WA 3PCOB 4M5MA 1I5OB 1FY7A 1KLNA 2XZWA 3SCJE 2BM0A 1DTQA 2VODA 2VDHA 3ENAA 3N01A 4LQ9A 3EZOA 3EGZA 2CRLA 4HHHA 2MMYA 8AT1B 4NA3A 2KB2A 3CCMS 4ETZA 3RU0A 1JX4A 1S97A 4DBQA 1HD0A 3ET6A 4O3PA 3GR1A 2X52A 3ZZZA 5B0EA 5T41A 3GJRB 1P9GA 3G8SA 2C2ZB 2G1HA 2JZMA 4K4WA 3CC2S 3OVOA 3W2VA 2B7CB 1XBWA 4DR1F 1N6QA 2HBZB 4R5PB 9WGAA 3P4UB 2XSJB 1IXKA 3BO2A 3VVTA 3J80U 3DCAA 1TBNA 5A8KA 5IS2A 2DNMA 3ZZOA 1VQ6S 1NH7A 2BJ9A 1FHTA 2LQ5A 4OFZA 4F50A 4FF3A 4XDDA 3QRPA 3ISZA 3K5PA 1K8AT 4PWWA 1RWXB 4ZJLA 2ZJPQ 4RNNA 3OTOJ 1YP3A 5AFUU 4N47A 3KK1B 3FWWA 1YBUA 3ETOA 3JAMY 4ZVEA 1UPPA 2RT3A 2UZ3A 2GJ2A 4M2BA 1VC5A 2OPPB 4ID5B 4X4PA 1SCJB 3VBLA 4I69A 4HEA9 2P6AC 3RBDA 1ZZFA 3DDKA 2HMIA 2ZC3A 4EU0A 2XLJA 1QAYA 4KKOA 2DH9A 3S1TA 2QMXA 4N8NA 2CJKA 1IJEB 2MQLA 3BO4A 3BM7A 5A6WA 5ADZA 2PT0A 2AMCB 4A8SA 2R4FA 4WFAQ 3HD2A 2E5JA 2GMJA 3R2DJ 2Q4JA 3FEXB 1S0VA 4KQLA 2RKIB 3HT3A 2AQ9A 3DNCA 1S10A 4MIBA 2N4CA 1KTQA 2NPOA 3RB4A 1BHNA 3BQ0A 1K1SA 4L73A 3W8GA 2OEJA 3EH0A 1PC5A 5DEPA 1MROB 5KFWA 1CJTA 1LEOA 2JYYA 5L38A 3FDSA 1PGZA 3J81U 4WZQA 1YTPA 5H9FJ 5U2KA 1SIWB 1U1PA 1JKHB 3ZFVA 5GMDA 4CM0A 2R2SA 2A1BA 4CT8A 5EHHA 3R9LA 3KHHA 4QOTA 2WLDA 4C97A 2Y0MA 3KKFA 1KQAA 1X9SA 2WOMB 2ASLA 2QX0A 3D6FB 1DS3I 2CQIA 2QMUB 3MEGB 1S49A 2V5HG 2JFDA 2HYIB 1U8WA 1YK9A 1FJ7A 2E66A 1VC0A 1HQUA 2WB4A 1DTTA 1M0SA 2E5RA 4DX7A 1ITPA 3OH2A 2RQMA 3QIPB 1NKCA 3BSWA 1U24A 1WC5A 3GJTB 2MKSA 2VC0A 3MM9A 2C28A 3ZTPA 3FSIA 3MPVA 3T41A 1L3VA 1O0PA 4N8OA 4DUYJ 3M8QB 3DLKB 2H65B 4DL0C 4UQGA 4FXVA 3QRQA 4R8UB 3Q8QB 2E1MC 4U9RA 4QWAA 4LF4F 3R2WA 2DGWA 3DRYA 1N32F 4N41A 5F8JA 2W8KA 1S6QA 2UXCF 5J2PA 2C1EB 4HTJA 3DLGA 4EZ6A 4P6QA 2VDIA 2DGQA 4KNRA 5IT4A 1TMMA 4J9MA 2QIAA 5K8OA 4QJVA 2XHCA 3PNIA 3FC9A 4BLGA 1XC9A 4CLTA 1Q78A 2FY8A 2IIHA 3WDOA 2KMOA 5J1NA 2V63A 1UWBA 2NZCA 2FTRA 1JJ2R 4V19X 2LCWA 1RLDA 3CD0A 1IUJA 2NXUA 1TKZA 4CZCA 2VD3A 3NBPB 3Q89A 1VQOS 2JX2A 2QSFA 2GHPA 3JAMU 1HD1A 1H7XA 5DEMA 4DUZF 2VBXA 2N17A 4XTTA 4M5DB 3IXQA 3HVWA 2VASA 1NKEA 1LNQA 3QAEA 3DOLA 4OQJA 3N6MA 4KHPJ 3W60A 1NM2A 2LB7A 3B6BA 3E2EA 1RU1A 4FBUA 4HYKA 1VBYA 1SGEI 4CYUB 5KFMA 4ZMMA 3AXKA 3SCKE 2DIVA 3CCQS 1SPBP 3TZWA 4EMDA 4RX6A 2H48B 1NJIT 1MN7A 4FVCA 3UCUP 1G97A 4E75A 5DG8A 3UDEA 5DETA 2Q43A 1EHWA 4BHQA 3HULA 2W9CB 1RA7A 1K47A 3SSRA 1RGVA 2IM3A 1R43A 3SSSA 4WTOB 2APOA 2ZNYA 1S9EB 4YB5A 3MUMP 3G8TA 3R5JB 2IC3A 3WC0A 3IGVA 5KFZA 4HGUA 3CVKA 2VB6A 4CNYA 2W2OP 4MTPA 3TUIC 2I8EA 2BW7A 1SKRA 1NJXA 1NBEB 1QE1A 5GMEA 2YKAA 2DPIA 3R1LA 1RJJA 1T9UA 4DSJA 2QT7A 2VICA 4U8YA 3GIIA 1APSA 1UETA 3I4PA 1J5EJ 2AF6A 4ZVGA 3X1LB 4J18A 3V6KA 2KDOA 1BC6A 2HFSA 2CJAA 1IKWA 3PX6A 5HO4A 1YTYA 3GQ8A 5HROB 4DSEA 3EXCX 2QL9B 3PJ9A 1U49A 1SIZA 3L4BC 3BDPA 2CQHA 4C8OA 3M4XA 3M30A 2DGVA 3M8WA 3DXBA 1D9AA 3PYFA 2B9EA 1RWOB 5HLFB 2J6UA 3MZIA 4KR0B 2FYXA 2Y1RI 2QQCA 1WC1A 2Y3YA 3GCWP 4JI7F 2EBGA 3TI0A 1U1OA 3PHTA 2DNQA 4D3GA 1YRTA 2OEMA 5J2QA 3NRBA 2OUGA 2NXEA 3HSJA 4EWTA 1NJYA 4EA7A 2NZ4A 2N3LA 3ETMA 3PO4A 5F8NA 5CCLA 2AJFE 1IKYB 3R5GA 1R8PA 5IM0B 1S9GB 1ZAVA 2DGUA 1YBAA 2OPSA 2HK2A 4ZVSB 1D0EA 4UUWA 1TL7A 4L3KA 4E98A 3OLAA 2HVIA 2VG7A 1I51B 3KFWX 4ZVTB 4KBIA 4RW8B 4RBVA 1FKPB 1Y10A 1NDLA 4ECWA 3GYNA 4I7FA 4FCEA 1VBXA 3QO9A 2JOQA 2MQMA 4UW2A 4AA7A 2MSSA 3HJFA 1Q8KA 5D15A 4ZLJA 1VLOA 2CPXA 1UJ5A 2KL8A 2WGCA 1QVGR 1VYAA 1NK0A 2W7OA 4X65J 4OX8A 3TA1A 2Z57B 2I2YA 2LXUA 1Z90A 3G6YA 2XATA 1EB0A 1K7VA 2XI2A 5F8LA 2R3VA 5ETLA 2UVRA 4PUOB 2YNHB 4B9SA 3DGVA 3OHBA 3LP0B 3FBEA 1PJ7A 1N5SA 2B4VA 4WIQA 2HNDA 3W1YC 1FFWB 3P6YC 1VLYA 3SCLE 4IKAA 5KFTA 1H2VZ 3MDFA 1EKSA 2H4YB 3U1MA 1HWJA 4DNCA 4CWBA 3B82A 1FRKA 3IFEA 4NLDA 1FXRA 4MMOA 5C42A 1UVJA 2ZE2A 3WIVA 4DV2J 4IHHA 4JV1A 2M52A 4R7PA 1YDLA 2PEBA 2YNFB 3I0SB 1H98A 4JV0A 2ZEJA 1HPTA 1P6TA 1W26A 2OPQB 5KFBA 2KTQA 2HRYA 1N32J 4FYVB 3SEKC 3SQGB 1K73T 1F9HA 2M5YA 1HR0F 1SQGA 3RBEA 4AL7A 2I5JB 3QGHA 4DR2J 1HJAI 4A4JA 4RUHA 5E41A 1SBRA 2OH2A 1B64A 1D8YA 2PQ8A 2RILA 3RAXA 2XZDB 2BEFA 2X3TA 3KNGA 4KV8A 4BC9A 3OSNA 3TAMA 2OI2A 2HFZA 4R0JA 4QW9A 3CCUS 3DMJA 3QJLA 4P2MA 2YUUA 5E3CA 2CNKB 3DLHA 1JLGA 1S59A 4FYYB 1YP4A 5GMKa 4JI4F 3IGJA 4ED0A 3VAHA 1RT3B 1YBTA 1OY9A 2HHXA 4Z2XA 5B7WA 1XERA 1RTIB 1YITS 1GH8A 2P2CB 3M8YA 4P9SA 1T9XA 3BBCA 4P71A 4B3RF 2XI3A 3I31A 1IBLJ 4ZIWA 1TU0B 1TELA 1TUVA 1YJTA 4ES2A 1R7IA 4GVLA 3VGVA 1LR8A 1UWAA 3HX9A 3FK4A 4ZPDA 1HI0P 4BDPA 1HNZJ 1WDTA 3CDUA 4HL9A 3MM6A 1G7CB 4IOBA 2IRYA 1NXIA 4LQ3A 2DHHA 5F3ZA 2W25A 1UFKA 3M2RB 5BYRA 3LTOA 1MR9A 1SQFA 2XYHB 2ZHOA 2IAJB 3RYLA 1ELOA 2XNQA 1HM8A 2ROPA 2VRWB 1S80A 2MJNA 1QRFA 1VRQC 1REVB 4QR2A 1F2HA 3KLGB 2OVOA 2BKNA 4CO3A 3KWCA 2MQOA 3CJ3A 2VONA 3ZNUA 4J9LA 3KK2B 3G9CA 2WRMA 3J7ZT 1C0UA 3GCXP 2R7WA 1TL3A 3EEVA 3MI7X 5HMZA 4AL6A 2JLEA 1ZAWA 4KC5A 3R3TA 5F8GA 1YLXA 1U6ZA 2D1CA 2FPHX 1Q5VA 2D3UA 1RKJA 2BZ2A 2ZNZA 3QSIA 3E51A 2OJ3A 2R8JA 1LWEA 4NLPA 2ILZA 1GFWB 1Q4RA 2HHWA 3LWMA 4DR3J 3TZZA 4DV3J 3Q22A 4CIOA 1FJCA 4DR4J 3MC4A 3MEEA 4CT9A 3EGWB 4OZ0A 3CTRA 4CM2A 2EC0A 4DR7F 1S6PB 4DFPA 2D3OR 2DGOA 4FKDA 3VAFA 3Q2SC 1SJ1A 1N5TA 2H51B 3T5LA 1JXEA 2RS2A 1S4EA 2AZ3A 3RTVA 4ES3A 5KFJA 3BJYA 4Q0BB 3N6LA 4PCQA 2IU9A 2DJWA 1FKOA 2MB0B 2BUSA 2PN6A 4NA2A 1EETA 2XNRA 3EUNA 3SQOP 2N7YA 4OV1A 2ERRA 4ZPWR 1MW7A 2FZGB 2R8IA 1N36J 3GONA 1X4AA 3T5HA 1NDPA 2AGQA 1U6FA 2EFPA 2N1AB 1N88A 3P96A 1R8AA 2DCLA 5LJ3Y 4RBTA 1FAQA 4A8XA 1UFWA 3BPSP 5KG6A 1N5QA 1FCAA 1N56A 1RLCL 3CCLS 3DOMB 3C14B 4I0WA 2QSWA 4RU9A 4DPOA 1X4GA 4JYAF 4ANCA 3KLFA 4CTAB 2QRRA 4FPIA 5GADI 1YJWS 1G1XA 3MPYA 2Q79A 4WZMA 4RW7A 1CLFA 2IM2A 4UY85 4PG8A 2EG1A 2NYIA 4IDKB 1T3NA 4JV5J 1OJ4A 2RQKA 2PFDA 5K9FA 2EWHA 1WHXA 3I5CA 3OJSA 5HP1B 4PYDA 2PGCA 1BGXT 2CFXA 3GV7B 1IQTA 2W2MP 2XRCA 1NUEA 2E5GA 3TO6A 1XR6A 4XPEA 2K9HA 2SGQI 3D5MA 3R6GB 4M9CA 5RUBA 2H9ZA 3P8BB 2VH7A 3C8VA 4WXOA 3EWGA 2WVJA 3GQ9A 3TJ9A 3L95X 2W0TA 3M8PA 1ZZNA 3PW2A 4PXCA 4TLQA 2JL9A 2YWWA 2ZZTA 1UVNA 3R97A 4O4GA 2RHQB 2C3UA 1QAJA 3KY9A 4UT4A 3OL0A 3QZ7A 1ZM2A 3KUEA 3LUYA 5HQ8A 1IKVA 2V53A 4EO6A 2GVIA 5AE3A 1HNXF 3CJ4A 4ED1A 3H25A 2ZVSA 3GIRA 3GILA 2Q3PA 4RLEA 5GAGI 2GC8A 3M2VB 1YHQS 1QD1A 1XA6A 2TDTA 4DXLA 1RISA 1WEXA 3RJMB 5JJBA 5IZHA 3MHYA 3VBMA 4DJBA 3CJSA 3NWRA 2YKPA 4ZCIA 4ITSA 3DDIA 3NG8A 4DV7F 4IFVA 2UV8A 3MM7A 3TUJC 3VZIA 1FJGJ 2YKMA 2HW3A 1EP4A 2NSCA 4QR0A 2LDIA 1UA1A 2IYGA
chains in the Genus database with same CATH topology
4UY8T 1KLMB 4FPRA 4DF4A 1NJWA 4K4UA 3RZAA 4C3MA 4OLOA 4RW4A 2FC8A 3N6NA 1J5EF 1XR7A 1SL2A 3T1AA 4F4YA 2ZH2A 1Y00A 1GTEA 3SSQA 1NEEA 3KG0A 1N48A 4O3QA 4QPXA 2P6SA 1RTJB 2JJ4D 2D3ZA 1QREA 3PV8A 3BGRA 4O23A 3HK2A 2EFGA 2OLWA 3HI9A 1IBKF 3VBNA 4Q2LA 4NLSA 1V3SA 1P27B 3FSXA 1QUPA 4ETXA 4TYBA 3OL6A 1QTMA 1M5HA 1APSA 2DGXA 2IVFB 3K5MA 1T03A 4LFAF 2MKJA 2J7WA 3LGMA 4E8UA 5DLGA 3SDEA 4NRUA 2QYCA 1VRTB 4Y2AA 1J5OB 1LK5A 3NBPA 2DNOA 1G95A 3DDNA 3VBKA 4N56A 3BQ1A 3DLEA 1IR0A 4FNHA 2K8GA 3CJ0A 1C1BA 3DYAB 4I56A 1U25A 2VOPA 4IFYB 1YGYA 2IC3B 3GVDA 1JB0C 1CPZA 5GAEU 4LF7F 1D1UA 3I4HX 4L3NA 1VHFA 3M9OB 4A8QA 4A8YA 4NYZA 1HYSB 3MMAA 1HW8A 1N0UA 3LOUA 3O1LA 4LIRA 5KFGA 1HV9A 3TW0A 1T94A 1N5YB 1J2ZA 4MFBA 1ZM9A 4KNXA 4DQSA 1X5PA 2EG2A 4DMZA 3C46A 3MMBB 4MK7A 4LF5F 2CPYA 4N27A 2JDJA 1S6PA 3CE8A 3LW5C 4NYOA 5IQQA 2EK6A 3J7YU 3O44A 4OJ1A 3CCES 4DV6F 3R0SA 2P9EA 1U26A 4IH6A 2Q66A 3IR6B 4LSLA 2GQ2A 2MKCA 4PR6A 5CYQA 3B4DA 3N5BA 4WF9Q 1QE1B 2FDNA 2LXIA 2YX4A 3GUEA 1DJ0A 1AFIA 2CQCA 6FD1A 2ASYA 3KLEA 3GR0A 1HNIA 3UD4P 1F9FA 5J2MA 4TY9A 3W2WB 3PKYA 2V0JA 1FXJA 1VQSA 3A1YG 4ZPAA 4MKYA 1L3UA 3PKMA 1MNEA 1RTHA 1NJZA 3VAMA 3AHPA 2DHSA 3O2IA 4Y65A 5KG2A 4A8KA 4FF1A 3EPIA 2OTJS 2MZJA 2IVYA 4OI2A 2AGOA 2B43A 1GXLA 1HWIA 3MMJA 4X4RA 1L3KA 4KFBA 2PA8D 4M1KA 2KRRA 2LDYA 4K4XA 5HBMA 1SL1A 2ROGA 1R8BA 1L5UA 1R27B 4PQAA 5EWEA 4Q0BA 3OBIA 1XR5A 5FD1A 4X62F 2HHSA 3RB6A 2XMKA 1IKWB 1TFYA 2PA3A 2OFGX 3D2WA 2BE2B 4C98A 3MM5B 1VQ5S 3MURP 2Q6BA 3K5NA 4F25A 5L1LA 3ONQA 1JWWA 2R7TA 4URSA 5DLFA 4LVNP 4NLXA 3KJVB 4WFZA 4BWMA 2V9WA 4QQBA 2WLFA 3H4DA 3B78A 2F9DA 4Q8FA 2CJQA 3D98A 4DS4A 4DG1A 3CPWR 4Y3CA 4ECXA 3M30B 1RKIA 2OPRA 3RW7A 1U48A 2W9BA 4CQ1A 2AGPA 3SEOA 3M2UB 5DDQC 5EDWA 1SQEA 2MHNA 3M8RA 3MTJA 4DN0A 2HHUA 3SRTA 1R0AB 2DNGA 2KJVA 5AXNA 2ZJQQ 3VF0B 1UVKA 1S9EA 3PZPA 3SV3A 1U2RA 2ZFHA 1S1WA 4F4KA 4I64A 1QSLA 1KRPA 2N82B 1Z1ZA 4F4WA 4ED5A 4PG7A 3MEDA 3VAGA 2OO4A 5KFOA 3GE9A 5E3QA 2RD5C 4KT0C 3BSYA 3R3RA 1T3OA 1S0MA 3FNNA 3OQ2A 3US5A 3VWSA 2DD8S 3DRRB 4DSIA 2N4DA 4OI1A 5KG1A 4X65F 4X4VA 1A7GE 1TKTA 2O66A 3NLCA 2RDJA 4LIWA 1G6BA 3Q8PB 2UXDF 2LECA 3MUTP 3NMRA 3M1VB 1XHDA 2XHWA 4ZK7M 2MKHA 2R2RA 3DRSA 3TVYA 2CG4A 3OU9A 4IO1A 4PPZA 2V8VA 3DM2B 2JEJA 1KHRA 2LEAA 1HI1A 1O5JA 4ED8A 5KFHA 4LSNA 4IG3B 1LXNA 4WE1B 3T6BA 1TDTA 1RT1A 1DQ9A 1CQMA 3CCRS 3UNGC 4K4VA 2K7KA 2KHCA 2XLKA 4PG6A 2QA4S 2UVWA 2JH3A 2V4JA 1JJHA 4AE5A 3FRZA 4B02A 3CCSS 2OPSB 1FXLA 2A3JA 2K3IA 3UW1A 3ZZYA 4BCAA 2FHMA 2PSZA 2WBRA 2CPHA 3K8WA 1WACA 3AB4B 3T1HF 1PC4A 4N77A 2Y0SD 3QLHB 4K0KF 3N0VA 2HRUA 3CDWA 4YR0A 2VFUA 3VAIA 5E7OB 2GV1A 1R8HA 2J0WA 4AUKA 4MK8A 2XLIA 3OXGA 3HKWA 2VG7B 5KG3A 3W3SA 4JI2F 4IDKA 4ECYA 3M6WA 2OFHX 1LXAA 2VFTA 4B3MF 3JSMB 1LW2B 1Z2ZA 3LO3A 4MYOA 3MOZA 3BN4A 3V6JA 5HROA 2ZD1B 4I2PB 3MEKA 1UP1A 3NAHA 3DI6B 3QYYA 3GQCA 3PW5A 3TP2A 2NREA 3UCZP 5L9NA 2WTFA 3W2VB 5ADXU 5EWGA 2FVCA 5HP1A 2DRAA 2ZOFA 4G1QB 1MMLA 5K8NA 1RT2A 4I2QB 3V4MA 3NMAA 3K59A 1O8BA 4H4MA 1KEKA 2E29A 4DV2F 1S0NA 2W4PA 3P1BA 3KLVA 1FEEA 4MIAA 3ZZPA 1N34F 4FF2A 3NL0A 1FRHA 4DQRA 3CCWA 1GAOA 3VQSA 4UUXA 2FY1A 4QCLA 1GNKA 1BD6A 4J9KA 1S0OA 1TK8A 2RJZA 3C6UA 5J2NB 5HLFA 1L3SA 2GJIA 4OHZA 4KQZA 5A8WB 3HPOA 5T14A 1T7PA 1X9WA 2X1AA 2OSRA 4PQUA 3SMZA 2BVZA 3HHLB 1FE4A 3OL8A 5D3GA 1FO1A 5E2QA 4R37A 4O3SA 3ISND 2F9JA 3C66A 1M5KC 2LLZA 4DR2F 5DS7A 5C25A 5B0DA 2VUGA 1ZPVA 1B0PA 4Q44A 2HHQA 1UEUA 5KG4A 3DU5A 1SUQA 3DLBA 3UE2A 3CCTA 5E0OA 3FQKA 4PWDB 3QGPA 4PWUA 4KO0B 3MR3A 3V81A 3GB0A 2KT2A 1HBNB 3PRDA 1TR0A 2X51A 2AYBA 4Y2KA 1FRMA 5A6PA 3CXCR 2HGLA 2J6SA 2COLA 1T05B 2X1BA 3QGGA 2FLOA 2B9YA 3T57A 3R1WA 2CVEA 3BSAA 3CD5A 4QZVB 4NLVA 4M98A 3RRGA 2PI5A 5AE2A 1YJNS 4XK8C 3TNVA 5IM0A 3BS9A 1X4DA 3KTQA 3O5TB 2BM1A 2I1RA 4ZCLA 2UUWA 2K7JA 3BSOA 3TANA 1ZM3A 3IA0A 4NA1A 3EX7B 2HNDB 1WTBA 4RNOA 1WG4A 3D1QA 4TU9A 2ZJRQ 3THPA 4DL2A 1Z2LA 2E5HA 1NZAA 2B6AB 2GHVC 1FNXH 3OTZA 3OVAA 4QYZJ 1MWZA 4XPCA 1YJVA 1M90T 3BR8A 3EXYA 4PXEA 1S72S 2Z2MA 3M2VA 2C2EA