4G87A

Crystal structure of glmu from mycobacterium tuberculosis snapshot 1
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Bifunctional protein GlmU
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g87A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g87A01
4EEAA 4FCEA 2AM5A 4B3UA 1GQ9A 3NZ2A 4ARWA 4C2SA 4CJ8A 3KWEA 1G8OA 3BCVA 5F42A 3R0SA 1HM0A 3TIOA 4MNDA 3TDTA 4P02A 3DHOA 3V0MA 2RJ0A 4AC3A 2WVKA 2ICYA 1E5KA 2QKXA 3BXYA 1VGWA 2JCOA 4Y64A 3MQHA 1R7UA 1ZDGA 3VBKA 3Q7UA 1Z90A 5E3PA 1QRGA 3I0KA 2WLFA 3I0JA 2BO6A 2Y7AA 2ZU8A 5BXCA 2IU8A 4EA8A 4Y6UA 4XWIA 1FGGA 4E6TA 4HO0A 1O0RA 2O1FA 4FRMA 1MR7A 2AE7A 2IUAA 5C1GA 3FSYA 5FYEA 1K4VA 2IU9A 3P47A 2PX7A 3V91A 1INIA 1S4NA 2O1HA 2X5ZA 2RIXA 2OEGA 3OUPA 4AA7A 2BO7A 1FXOA 1MP3A 2UX8A 4HG6A 1KK5A 1V3WA 1LVWA 1QGSA 3FWWA 1KRUA 1H5SC 4FREA 5IDSA 5AFUV 1S4PA 4J09A 3SX3A 2VS3A 1G93A 3ZGFA 3BSSA 3NGWA 2V0HA 4ECMA 1VGTA 4ZDQA 4NANA 2MZBA 1KGTA 4EGGA 1ZCVA 4G87A 3R8YA 2YESA 3OGZA 1G95A 1NQIB 3POLA 1HJJA 5E3RA 1QQ0A 1ZCUA 3CGXA 4FRQA 5CQPA 2RJ4A 1FGXA 3JTJA 5CMGX 4NAKA 1KHRA 1JV1A 2DPWA 5J49A 1FG5N 4HCQA 5U2KA 1ZJPA 3R1WA 2A8WA 1INJA 4MYBA 4YS8A 5C1LA 5C4FA 3OH3A 3OH2A 4BMAA 3OTZA 3Q80A 3VBPA 2FY7A 2APCA 4EEMA 1NMMB 2XWMA 4ASJA 1KK4A 1ZI5A 2CU2A 5JQQA 1R80A 1LL0A 2RIYA 3VBMA 1QRFA 5ADXU 1VM8A 4B4GA 1WSZA 4FCUA 4G3QA 3I0CA 5FUHA 3TQDA 3V8YA 2VFZA 2AM3A 3F1CA 4M2AA 2VXLA 2NXVA 3R5AA 1MRLA 1H7GA 1S80A 3OW5A 3PMOA 4R37A 3D5NA 1GQCA 2P73A 3N9WA 4EVWA 4NAIA 2P72A 3Q4SA 1MR9A 5FV9A 4CJBA 1PZYB 1MP4A 3I0HA 2FYCB 3OH1A 2YCMA 4KC2A 4DDZA 2XMHA 1ZIZA 2FYDB 4M99A 2RJ8A 1SSMA 5CQMX 3VBIA 3I0GA 1H5SA 2VXMA 3SX8A 1V82A 4J18A 1NF5B 5AFUU 4IHGA 1OMZA 3EE5A 2RJ5A 1WT1A 1WT2A 2AQ9A 5AJNA 4B4BA 1TDTA 3DK5A 1JYKA 1ZJ0A 4IRQA 2WLGA 5IFYA 3PKPA 4DE7A 1JVDA 1FZWA 3U2TA 2AECA 2RIJA 3USRA 3R5BA 1H5TB 1GX0A 1JVGA 1THJA 2WLDA 2AESA 3V8ZA 1QREA 2QGIA 4Y6NA 1FRWA 3TV0A 1SS9A 4GBPA 3R2WA 3I0LA 1VH3A 1R7YA 1FR9A 1OMXA 4FRPA 1H5SD 2ICXA 3EEVA 1JV3A 5CMFX 3FSXA 3T7MA 1NWGB 4AAWA 2ZU9A 4AYLA 2X65A 3D8VA 2YC3A 2AM4A 5C3AA 3GVDA 4Y7UA 1LL2A 4JD0A 1LL3A 1QWJA 2D7RA 4FRDA 1TW1A 3SXAA 2JF3A 3MQGA 4Y7VA 4P00A 5IDTA 1EYRA 1H5TA 4DCLA 5CMHA 3R3IA 1FR8A 4FQWA 4KPXA 4M2BA 3CJ8A 4L41C 1G23A 3ZLKA 1O7OA 3CKJA 4N6BA 1J2ZA 1KWSA 1VGUA 1I52A 4EE4A 4HO6A 5EIYA 1YROB 3U2VA 3P1BA 4D48A 1WT3A 2P2OA 1VZUA 4UEGA 4D11C 1V67A 1R81A 4N69A 1ZDFA 4Y63A 2RJ1A 3FOQA 3I3AA 1G0RA 2E8BA 3V0PA 2YQCA 1H4CA 1VGZA 1SSQA 3KWDA 2Y4MA 3ZLLA 2ZU7A 3E26A 5C49A 5C4EA 5I1FA 3PKQA 3V0OA 2QIVX 1OCXA 4HURA 2JCKA 2VD4A 1V83A 2WVLA 4MFGA 2QH5A 3V0LA 2Y4KA 1LZ7A 3T7OA 1GWVA 4FRBA 3HSQA 3I0DA 5C36A 1HM9A 5C4BA 4Y7GA 3I0FA 4Y7FA 5L6VA 3R3RA 4N27A 5CQLX 2WLCA 2FYAA 4EA7A 3OU9A 4NALA 4R7PA 2YC5A 2VS5A 2Z86A 3I0EA 4AYJA 3V90A 1TVYA 4H7OA 1W77A 2D7IA 1H4DA 2BO4A 3OH4A 4HO2A 4E1KA 1ZI1A 3OH0A 1MP5A 3HL3A 3PNNA 2XWLA 1LXAA 3SX5A 2OI6A 1O7QA 4R36A 2WAWA 1H3MA 3BSWA 2YQHA 3ZF8A 5FTVA 3SXEA 2VS4A 4EE5A 2GGOA 2WEEA 2V0IA 2XATA 1W55A 3SXDA 3O3PA 4N6AA 4D0TA 5AJPA 3IOJA 3OKRA 3R5DA 1LZJA 4HUSA 1R7TA 1O23B 3FSBA 4Y62A 1VICA 1V84A 3U2WA 4MYOA 4Y7TA 1VPAA 2RJ6A 1TZFA 5EJ1A 2YQSA 1IINA 1H7QA 1T3DA 3IOIA 2Y4JA 1H5RA 1VZXA 1ZJ1A 3SX7A 4EQYA 5CQOA 3ST8A 2GGQA 2PGYA 5E3QA 5FTSA 4D11A 3Q1XA 1ON6A 2RIZA 3V0QA 2YQJA 1ZJ2A 4E75A 1MC3A 4KT7A 2VHEA 3CKVA 1GWWA 2D0JA 3SXCA 4EEOA 4LW3A 3KWCA 1YP3A 3TWDA 4FRLA 1ZCYA 1NKHB 3F1XA 3RMWA 2OI7A 3LW6A 2Z87A 1VH1A 1H5SB 2TDTA 1ON8A 3BRKX 3MC4A 1H7EA 2OEFA 4HO8A 1FO9A 4B42A 1KQAA 1EZIA 4HO4A 4B2WA 3U0XA 2FYBA 3RMVA 1SSTA 5FU8A 3V0NA 4HOCA 1ZJ3A 1ZCTA 2I5KA 1JYLA 1OQMB 3R5CA 3TISA 1H7TA 3EG4A 5C48A 1H5RB 1YP4A 3BSYA 4KC1A 1HV9A 1GX4A 3FTTA 2AGDA 3D98A 4FRAA 1S4OA 3GOSA 4JISA 3JQYA 5L6SA 2QIAA 2XWNA 1G1LA 5EJZA 1VZTA 3FS8A 3CKOA 5C4CA 4E79A 4LW6A 1KGQA 1QRLA 4HZCA 1KK6A 2RJ7A 4FRHA 4KC4A 3USQA 4D0ZA 5C38A 4M98A 2AH9A 1QGQA 2BO8A 3HJJA 3U2XA 1G97A 3K8EA 1NHEB 2FKOA 5CMIA 4HO5A 3F1YA 4HO3A 1G3LA 1QG8A 2RITA 5DEPA 1FWYA 2VSIA 4FROA 2Y4LA 5FU0A 2E3DA 3OTMA 3OAMA 3SXBA 3VBJA 4EA9A 2JCLA 4B4MA 1QRMA 3VNPA 1ZI4A 4M9CA 2NPOA 2X60A 3K8DA 4EAAA 2WE9A 2W0VA 1XATA 5HS2A 4K6RA 1H7FA 2Y6PA 4BQHA 1XHBA 2IC7A 1XHDA 1ZJOA 3BFPA 4KNXA 5C1HA 1R7XA 4MZUA 1H7HA 4M4KA 2FFUA 1PZTA 3OC9A 4G3PA 5C8RA 1WT0A 1LZIA 4KRVA 3DJ4A 2I7BA 1H4EA 4IHHA 4IHFA 1G2VA 4HZDA 1R82A 1TW5A 4KQLA 3SRTA 2A8UA 1FOAA 4B5BA 4E6UA 2VSHA 2RJ9A 1G9RA 2Q4JA 3IGJA 3IXCA 3I3XA 2PA4A 2WGZA 1KRVA 3U2UA 5ADXV 5CMJA 3V4EA 3DUVA 4KPZA 2P6WA 1GA8A 2O1GA 3CU0A 5DDVA 4DECA 2FFVA 2X5SA 3E25A 1FXJA 3IOHA 1ZHJA 4B2XA 3GUEA 1XZ6A 2WVMA 3VBNA 2PGVA 5DG3A 2V0KA 1R7VA 4EABA 2OI5A 3TK8A 1YP2A 4CVHA 1LZ0A 4EEGA 1FO8A 3KIAA 4IRPA 3VBLA 1HJLA 1H7LA 2WLEA 2W0WA 4ASYA 4CJCA 3SPTA 5C3DA 1HM8A 3EH0A 4M28A 3C8VA 3FSCA 1WVCA 3T7NA 5DDTA 3RSBA 5DEMA 1IIMA 2JCJA 4Y9XA 3I0IX 4G3SA 5C47A 4EE3A 1W57A 3TZTA 3CKQA 3CKNA 4KXOA 4ISXA 5AJOA 3T57A 3JUJA 3QVBA 2JF2A 3JUKA 3ECTA 1KRRA 3ZGGA 5CQNX 5C4DA 2V0JA 5C3BA 3SXGA 3U0YA 4KNRA 2V0LA 2XMEA 2I5EA 4HO9A 1ZI3A
chains in the Genus database with same CATH superfamily
4EEAA 4FCEA 2AM5A 4B3UA 1GQ9A 3NZ2A 4ARWA 4C2SA 4CJ8A 3KWEA 1G8OA 3BCVA 5F42A 3R0SA 1HM0A 3TIOA 4MNDA 3TDTA 4P02A 3DHOA 3V0MA 2RJ0A 4AC3A 2WVKA 2ICYA 1E5KA 2QKXA 3BXYA 1VGWA 2JCOA 4O6NA 4Y64A 3MQHA 1R7UA 1ZDGA 3VBKA 3Q7UA 1Z90A 5E3PA 1QRGA 3I0KA 2WLFA 3I0JA 2BO6A 2Y7AA 2ZU8A 5BXCA 2IU8A 4EA8A 4Y6UA 4XWIA 1FGGA 4E6TA 4HO0A 1O0RA 2O1FA 4FRMA 1MR7A 2AE7A 2IUAA 5C1GA 3FSYA 5FYEA 1K4VA 2IU9A 3P47A 2PX7A 3V91A 1INIA 1S4NA 2O1HA 2X5ZA 2RIXA 2OEGA 3OUPA 4AA7A 2BO7A 1FXOA 1MP3A 2UX8A 4HG6A 1KK5A 1V3WA 1LVWA 1QGSA 3FWWA 1KRUA 1H5SC 4FREA 5IDSA 5AFUV 1S4PA 4J09A 2J0BA 3SX3A 2VS3A 1G93A 3ZGFA 3BSSA 3NGWA 2V0HA 4ECMA 1VGTA 4ZDQA 4NANA 2MZBA 1KGTA 3OGZA 4EGGA 4G87A 3R8YA 1ZCVA 2YESA 1G95A 1NQIB 3POLA 1HJJA 5E3RA 1QQ0A 1ZCUA 3CGXA 4FRQA 5CQPA 2RJ4A 1FGXA 3JTJA 5CMGX 4NAKA 1KHRA 1JV1A 2DPWA 5J49A 1FG5N 4HCQA 5U2KA 1ZJPA 3R1WA 2A8WA 1INJA 4MYBA 4YS8A 5C1LA 5C4FA 3OH3A 3OH2A 4BMAA 3OTZA 3Q80A 3VBPA 2FY7A 2APCA 4EEMA 1NMMB 2XWMA 4ASJA 1KK4A 1ZI5A 2CU2A 5JQQA 1R80A 1LL0A 2RIYA 3VBMA 1QRFA 5ADXU 1VM8A 4B4GA 1WSZA 4FCUA 4G3QA 3I0CA 5FUHA 3TQDA 3V8YA 2VFZA 2AM3A 3F1CA 3GQAA 4M2AA 2VXLA 2NXVA 3R5AA 1MRLA 1H7GA 1S80A 3OW5A 3PMOA 4R37A 3D5NA 1GQCA 2P73A 3N9WA 4EVWA 4NAIA 2P72A 3Q4SA 1MR9A 5FV9A 4CJBA 1PZYB 1MP4A 3I0HA 2FYCB 3OH1A 2YCMA 5D92A 4KC2A 4DDZA 2XMHA 1ZIZA 2FYDB 4M99A 2RJ8A 1SSMA 5CQMX 3VBIA 3I0GA 1H5SA 2VXMA 3SX8A 1V82A 4J18A 1NF5B 5AFUU 4IHGA 1OMZA 3EE5A 2RJ5A 1WT1A 1WT2A 2AQ9A 5AJNA 4B4BA 1TDTA 3DK5A 1JYKA 1ZJ0A 4IRQA 2WLGA 5IFYA 3PKPA 4DE7A 1JVDA 1FZWA 3U2TA 2AECA 2RIJA 3USRA 3R5BA 1H5TB 1GX0A 1JVGA 1THJA 2WLDA 2AESA 3V8ZA 1QREA 2QGIA 4Y6NA 4DECA 1FRWA 3TV0A 1SS9A 4GBPA 3R2WA 3I0LA 1VH3A 4MIXA 1R7YA 1FR9A 1OMXA 4FRPA 1H5SD 2ICXA 3EEVA 1JV3A 1N4IA 1L0SA 5CMFX 3FSXA 3T7MA 1NWGB 4AAWA 2ZU9A 4AYLA 2X65A 3D8VA 2YC3A 2AM4A 5C3AA 1M8NA 3GVDA 4Y7UA 1LL2A 4JD0A 1LL3A 1QWJA 2D7RA 4FRDA 1TW1A 3SXAA 2JF3A 3MQGA 4Y7VA 4P00A 5IDTA 1EYRA 1H5TA 4DCLA 5CMHA 3R3IA 1FR8A 4FQWA 4KPXA 4M2BA 3CJ8A 4L41C 1G23A 3ZLKA 1O7OA 3CKJA 4N6BA 1J2ZA 1KWSA 1VGUA 1I52A 4EE4A 4HO6A 5EIYA 1YROB 3U2VA 3P1BA 4O6MA 4D48A 1WT3A 2P2OA 1VZUA 4UEGA 4D11C 1V67A 1R81A 4N69A 1ZDFA 4Y63A 2RJ1A 3FOQA 3I3AA 1G0RA 2E8BA 3V0PA 2YQCA 1H4CA 1VGZA 1SSQA 3KWDA 2Y4MA 3ZLLA 2ZU7A 3E26A 5C49A 5C4EA 5I1FA 3PKQA 3V0OA 2QIVX 1OCXA 4HURA 2JCKA 2VD4A 1V83A 2WVLA 4MFGA 2QH5A 3V0LA 2Y4KA 1LZ7A 3T7OA 1GWVA 4FRBA 3HSQA 3I0DA 5C36A 1HM9A 5C4BA 4Y7GA 3I0FA 4Y7FA 2J0AA 5L6VA 3R3RA 4N27A 4FIYA 2WLCA 2FYAA 4EA7A 5CQLX 3OU9A 4NALA 4R7PA 2YC5A 2VS5A 1Z2FA 2Z86A 3I0EA 4AYJA 3V90A 1TVYA 4H7OA 1W77A 3OH4A 1H4DA 2BO4A 2D7IA 4HO2A 4E1KA 3OH0A 1ZI1A 1MP5A 3HL3A 3PNNA 2XWLA 1LXAA 3SX5A 2OI6A 1O7QA 4R36A 2WAWA 1H3MA 3BSWA 2YQHA 3ZF8A 5FTVA 3SXEA 5D91A 2VS4A 4EE5A 2GGOA 2WEEA 2V0IA 2XATA 1W55A 3SXDA 3O3PA 4N6AA 4D0TA 5AJPA 3IOJA 4Q7CA 3OKRA 3R5DA 1LZJA 4HUSA 1R7TA 1O23B 3FSBA 4Y62A 1VICA 1V84A 3U2WA 4MYOA 4Y7TA 1VPAA 2RJ6A 1TZFA 5EJ1A 2YQSA 1IINA 1H7QA 1T3DA 3IOIA 2Y4JA 1H5RA 1VZXA 1ZJ1A 3SX7A 4EQYA 5CQOA 3ST8A 2GGQA 2PGYA 5E3QA 5FTSA 4D11A 3Q1XA 1ON6A 2RIZA 3V0QA 2YQJA 1ZJ2A 4E75A 1MC3A 4KT7A 2VHEA 3CKVA 1GWWA 2D0JA 3SXCA 4EEOA 4LW3A 3KWCA 1YP3A 3TWDA 4FRLA 1ZCYA 1NKHB 3F1XA 3RMWA 2OI7A 3LW6A 2Z87A 1VH1A 1H5SB 2TDTA 1ON8A 3BRKX 3MC4A 1H7EA 2OEFA 4HO8A 1FO9A 4B42A 1KQAA 1EZIA 4HO4A 4B2WA 3U0XA 2FYBA 3RMVA 1SSTA 5FU8A 3V0NA 4HOCA 1ZJ3A 1ZCTA 2I5KA 1JYLA 1OQMB 3R5CA 3TISA 1H7TA 3EG4A 5C48A 1H5RB 1YP4A 3BSYA 4KC1A 1HV9A 1GX4A 3FTTA 2AGDA 3D98A 4FRAA 1S4OA 3GOSA 4JISA 3JQYA 5L6SA 2QIAA 2XWNA 1G1LA 5EJZA 1VZTA 3FS8A 3CKOA 5C4CA 4E79A 4LW6A 1KGQA 1QRLA 4HZCA 1KK6A 2RJ7A 4FRHA 4KC4A 3USQA 4D0ZA 5C38A 4M98A 2AH9A 1QGQA 2BO8A 3HJJA 3U2XA 1G97A 3K8EA 1NHEB 2FKOA 5CMIA 4HO5A 3F1YA 2C0NA 1G3LA 1QG8A 4HO3A 2RITA 5DEPA 1FWYA 2VSIA 4FROA 2Y4LA 5FU0A 2E3DA 3OTMA 3OAMA 3SXBA 3VBJA 4EA9A 2JCLA 4B4MA 1QRMA 3VNPA 1ZI4A 4M9CA 2NPOA 1EWWA 2X60A 3K8DA 3GQ7A 4EAAA 2WE9A 2W0VA 1XATA 5HS2A 4K6RA 1H7FA 2Y6PA 4BQHA 1XHBA 2IC7A 1XHDA 1ZJOA 3BFPA 4KNXA 5C1HA 1R7XA 4MZUA 1H7HA 4M4KA 2FFUA 1PZTA 3OC9A 4G3PA 5C8RA 1WT0A 1LZIA 4KRVA 3DJ4A 2I7BA 1H4EA 4IHHA 4IHFA 1G2VA 4HZDA 1R82A 1TW5A 4KQLA 2VK9A 3SRTA 2A8UA 1FOAA 4B5BA 4E6UA 2VSHA 2RJ9A 1G9RA 2Q4JA 3IGJA 3IXCA 3I3XA 2PA4A 2WGZA 1KRVA 3U2UA 5ADXV 5CMJA 3V4EA 3DUVA 4KPZA 2P6WA 1GA8A 2O1GA 3CU0A 5DDVA 3GQ9A 2FFVA 2X5SA 3E25A 1FXJA 3IOHA 1ZHJA 4B2XA 3GUEA 1XZ6A 2WVMA 3VBNA 2PGVA 5DG3A 2V0KA 1R7VA 4EABA 2OI5A 3TK8A 1YP2A 4CVHA 1LZ0A 4EEGA 1FO8A 3KIAA 4IRPA 3SUCA 3VBLA 1HJLA 1H7LA 2WLEA 2W0WA 4ASYA 4CJCA 3SPTA 5C3DA 1HM8A 3GQ8A 3EH0A 4M28A 3C8VA 3FSCA 1WVCA 3T7NA 4FIXA 5DDTA 3RSBA 5DEMA 1IIMA 2JCJA 4Y9XA 3I0IX 4G3SA 5C47A 4EE3A 1W57A 3TZTA 3CKQA 3CKNA 4KXOA 4ISXA 5AJOA 3T57A 3JUJA 3QVBA 2JF2A 3JUKA 3ECTA 1KRRA 3ZGGA 5CQNX 5C4DA 2V0JA 5C3BA 3SXGA 3U0YA 4KNRA 2V0LA 2XMEA 2I5EA 4HO9A 1ZI3A
chains in the Genus database with same CATH topology
4EEAA 4FCEA 2AM5A 4B3UA 1GQ9A 3NZ2A 4ARWA 4C2SA 4CJ8A 3KWEA 1G8OA 3BCVA 5F42A 3R0SA 1HM0A 3TIOA 4MNDA 3TDTA 4P02A 3DHOA 3V0MA 2RJ0A 4AC3A 2WVKA 2ICYA 1E5KA 2QKXA 3BXYA 1VGWA 2JCOA 4O6NA 4Y64A 3MQHA 1R7UA 1ZDGA 3VBKA 3Q7UA 1Z90A 5E3PA 1QRGA 3I0KA 2WLFA 3I0JA 2BO6A 2Y7AA 2ZU8A 5BXCA 2IU8A 4EA8A 4Y6UA 4XWIA 1FGGA 4E6TA 4HO0A 1O0RA 2O1FA 4FRMA 1MR7A 2AE7A 2IUAA 5C1GA 3FSYA 5FYEA 1K4VA 2IU9A 3P47A 2PX7A 3V91A 1INIA 1S4NA 2O1HA 2X5ZA 2RIXA 2OEGA 3OUPA 4AA7A 2BO7A 1FXOA 1MP3A 2UX8A 4HG6A 1KK5A 1V3WA 1LVWA 1QGSA 3FWWA 1KRUA 1H5SC 4FREA 5IDSA 5AFUV 1S4PA 4J09A 2J0BA 3SX3A 2VS3A 1G93A 3ZGFA 3BSSA 3NGWA 2V0HA 4ECMA 1VGTA 4ZDQA 4NANA 2MZBA 1KGTA 4EGGA 1ZCVA 4G87A 3R8YA 2YESA 3OGZA 1G95A 1NQIB 3POLA 1HJJA 5E3RA 1QQ0A 1ZCUA 3CGXA 4FRQA 5CQPA 2RJ4A 1FGXA 3JTJA 5CMGX 4NAKA 1KHRA 1JV1A 2DPWA 5J49A 1FG5N 4HCQA 5U2KA 1ZJPA 3R1WA 2A8WA 1INJA 4MYBA 4YS8A 5C1LA 5C4FA 3OH3A 3OH2A 4BMAA 3OTZA 3Q80A 3VBPA 2FY7A 2APCA 4EEMA 1NMMB 2XWMA 4ASJA 1KK4A 1ZI5A 2CU2A 5JQQA 1R80A 1LL0A 2RIYA 3VBMA 1QRFA 5ADXU 1VM8A 4B4GA 1WSZA 4FCUA 4G3QA 3I0CA 5FUHA 3TQDA 3V8YA 2VFZA 2AM3A 3F1CA 4M2AA 2VXLA 2NXVA 3R5AA 1MRLA 1H7GA 1S80A 3OW5A 3PMOA 4R37A 3D5NA 1GQCA 2P73A 3N9WA 4EVWA 4NAIA 2P72A 3Q4SA 1MR9A 5FV9A 4CJBA 1PZYB 1MP4A 3I0HA 2FYCB 3OH1A 2YCMA 5D92A 4KC2A 4DDZA 2XMHA 1ZIZA 2FYDB 4M99A 2RJ8A 1SSMA 5CQMX 3VBIA 3I0GA 1H5SA 2VXMA 3SX8A 1V82A 4J18A 1NF5B 5AFUU 4IHGA 1OMZA 3EE5A 2RJ5A 1WT1A 1WT2A 2AQ9A 5AJNA 4B4BA 1TDTA 3DK5A 1JYKA 1ZJ0A 4IRQA 2WLGA 5IFYA 3PKPA 4DE7A 1JVDA 1FZWA 3U2TA 2AECA 2RIJA 3USRA 3R5BA 1H5TB 1GX0A 1JVGA 1THJA 2WLDA 2AESA 3V8ZA 1QREA 2QGIA 4Y6NA 1FRWA 3TV0A 1SS9A 4GBPA 3R2WA 3I0LA 1VH3A 4MIXA 1R7YA 1FR9A 1OMXA 4FRPA 1H5SD 2ICXA 3EEVA 1JV3A 5CMFX 3FSXA 3T7MA 1NWGB 4AAWA 2ZU9A 4AYLA 2X65A 3D8VA 2YC3A 2AM4A 5C3AA 3GVDA 4Y7UA 1LL2A 4JD0A 1LL3A 1QWJA 2D7RA 4FRDA 1TW1A 3SXAA 2JF3A 3MQGA 4Y7VA 4P00A 5IDTA 1EYRA 1H5TA 4DCLA 5CMHA 3R3IA 1FR8A 4FQWA 4KPXA 4M2BA 3CJ8A 4L41C 1G23A 3ZLKA 1O7OA 3CKJA 4N6BA 1J2ZA 1KWSA 1VGUA 1I52A 4EE4A 4HO6A 5EIYA 1YROB 3U2VA 3P1BA 4O6MA 4D48A 1WT3A 2P2OA 1VZUA 4UEGA 4D11C 1V67A 1R81A 4N69A 1ZDFA 4Y63A 2RJ1A 3FOQA 3I3AA 1G0RA 2E8BA 3V0PA 2YQCA 1H4CA 1VGZA 1SSQA 3KWDA 2Y4MA 3ZLLA 2ZU7A 3E26A 5C49A 5C4EA 5I1FA 3PKQA 3V0OA 2QIVX 1OCXA 4HURA 2JCKA 2VD4A 1V83A 2WVLA 4MFGA 2QH5A 3V0LA 2Y4KA 1LZ7A 3T7OA 1GWVA 4FRBA 3HSQA 3I0DA 5C36A 1HM9A 5C4BA 4Y7GA 3I0FA 4Y7FA 2J0AA 5L6VA 3R3RA 4N27A 4FIYA 2WLCA 2FYAA 4EA7A 5CQLX 3OU9A 4NALA 4R7PA 2YC5A 2VS5A 2Z86A 3I0EA 4AYJA 3V90A 1TVYA 4H7OA 1W77A 2D7IA 1H4DA 2BO4A 3OH4A 4HO2A 4E1KA 1ZI1A 3OH0A 1MP5A 3HL3A 3PNNA 2XWLA 1LXAA 3SX5A 2OI6A 1O7QA 4R36A 2WAWA 1H3MA 3BSWA 2YQHA 3ZF8A 5FTVA 3SXEA 5D91A 2VS4A 4EE5A 2GGOA 2WEEA 2V0IA 2XATA 1W55A 3SXDA 3O3PA 4N6AA 4D0TA 5AJPA 3IOJA 4Q7CA 3OKRA 3R5DA 1LZJA 4HUSA 1R7TA 1O23B 3FSBA 4Y62A 1VICA 1V84A 3U2WA 4MYOA 4Y7TA 1VPAA 2RJ6A 1TZFA 5EJ1A 2YQSA 1IINA 1H7QA 1T3DA 3IOIA 2Y4JA 1H5RA 1VZXA 1ZJ1A 3SX7A 4EQYA 5CQOA 3ST8A 2GGQA 2PGYA 5E3QA 5FTSA 4D11A 3Q1XA 1ON6A 2RIZA 3V0QA 2YQJA 1ZJ2A 4E75A 1MC3A 4KT7A 2VHEA 3CKVA 1GWWA 2D0JA 3SXCA 4EEOA 4LW3A 3KWCA 1YP3A 3TWDA 4FRLA 1ZCYA 1NKHB 3F1XA 3RMWA 2OI7A 3LW6A 2Z87A 1VH1A 1H5SB 2TDTA 1ON8A 3BRKX 3MC4A 1H7EA 2OEFA 4HO8A 1FO9A 4B42A 1KQAA 1EZIA 4HO4A 4B2WA 3U0XA 2FYBA 3RMVA 1SSTA 5FU8A 3V0NA 4HOCA 1ZJ3A 1ZCTA 2I5KA 1JYLA 1OQMB 3R5CA 3TISA 1H7TA 3EG4A 5C48A 1H5RB 1YP4A 3BSYA 4KC1A 1HV9A 1GX4A 3FTTA 2AGDA 3D98A 4FRAA 1S4OA 3GOSA 4JISA 3JQYA 5L6SA 2QIAA 2XWNA 1G1LA 5EJZA 1VZTA 3FS8A 3CKOA 5C4CA 4E79A 4LW6A 1KGQA 1QRLA 4HZCA 1KK6A 2RJ7A 4FRHA 4KC4A 3USQA 4D0ZA 5C38A 4M98A 2AH9A 1QGQA 2BO8A 3HJJA 3U2XA 1G97A 3K8EA 1NHEB 2FKOA 5CMIA 4HO5A 3F1YA 2C0NA 1G3LA 1QG8A 4HO3A 2RITA 5DEPA 1FWYA 2VSIA 4FROA 2Y4LA 5FU0A 2E3DA 3OTMA 3OAMA 3SXBA 3VBJA 4EA9A 2JCLA 4B4MA 1QRMA 3VNPA 1ZI4A 4M9CA 2NPOA 2X60A 3K8DA 4EAAA 2WE9A 2W0VA 1XATA 5HS2A 4K6RA 1H7FA 2Y6PA 4BQHA 1XHBA 2IC7A 1XHDA 1ZJOA 3BFPA 4KNXA 5C1HA 1R7XA 4MZUA 1H7HA 4M4KA 2FFUA 1PZTA 3OC9A 4G3PA 5C8RA 1WT0A 1LZIA 4KRVA 3DJ4A 2I7BA 1H4EA 4IHHA 4IHFA 1G2VA 4HZDA 1R82A 1TW5A 4KQLA 2VK9A 3SRTA 2A8UA 1FOAA 4B5BA 4E6UA 2VSHA 2RJ9A 1G9RA 2Q4JA 3IGJA 3IXCA 3I3XA 2PA4A 2WGZA 1KRVA 3U2UA 5ADXV 5CMJA 3V4EA 3DUVA 4KPZA 2P6WA 1GA8A 2O1GA 3CU0A 5DDVA 4DECA 2FFVA 2X5SA 3E25A 1FXJA 3IOHA 1ZHJA 4B2XA 3GUEA 1XZ6A 2WVMA 3VBNA 2PGVA 5DG3A 2V0KA 1R7VA 4EABA 2OI5A 3TK8A 1YP2A 4CVHA 1LZ0A 4EEGA 1FO8A 3KIAA 4IRPA 3VBLA 1HJLA 1H7LA 2WLEA 2W0WA 4ASYA 4CJCA 3SPTA 5C3DA 1HM8A 3EH0A 4M28A 3C8VA 3FSCA 1WVCA 3T7NA 4FIXA 5DDTA 3RSBA 5DEMA 1IIMA 2JCJA 4Y9XA 3I0IX 4G3SA 5C47A 4EE3A 1W57A 3TZTA 3CKQA 3CKNA 4KXOA 4ISXA 5AJOA 3T57A 3JUJA 3QVBA 2JF2A 3JUKA 3ECTA 1KRRA 3ZGGA 5CQNX 5C4DA 2V0JA 5C3BA 3SXGA 3U0YA 4KNRA 2V0LA 2XMEA 2I5EA 4HO9A 1ZI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEA A;  4FCE A;  2AM5 A;  4B3U A;  1GQ9 A;  3NZ2 A;  4ARW A;  4C2S A;  4CJ8 A;  3KWE A;  1G8O A;  3BCV A;  5F42 A;  3R0S A;  1HM0 A;  3TIO A;  4MND A;  3TDT A;  4P02 A;  3DHO A;  3V0M A;  2RJ0 A;  4AC3 A;  2WVK A;  2ICY A;  1E5K A;  2QKX A;  3BXY A;  1VGW A;  2JCO A;  4Y64 A;  3MQH A;  1R7U A;  1ZDG A;  3VBK A;  3Q7U A;  1Z90 A;  5E3P A;  1QRG A;  3I0K A;  2WLF A;  3I0J A;  2BO6 A;  2Y7A A;  2ZU8 A;  5BXC A;  2IU8 A;  4EA8 A;  4Y6U A;  4XWI A;  1FGG A;  4E6T A;  4HO0 A;  1O0R A;  2O1F A;  4FRM A;  1MR7 A;  2AE7 A;  2IUA A;  5C1G A;  3FSY A;  5FYE A;  1K4V A;  2IU9 A;  3P47 A;  2PX7 A;  3V91 A;  1INI A;  1S4N A;  2O1H A;  2X5Z A;  2RIX A;  2OEG A;  3OUP A;  4AA7 A;  2BO7 A;  1FXO A;  1MP3 A;  2UX8 A;  4HG6 A;  1KK5 A;  1V3W A;  1LVW A;  1QGS A;  3FWW A;  1KRU A;  1H5S C;  4FRE A;  5IDS A;  5AFU V;  1S4P A;  4J09 A;  3SX3 A;  2VS3 A;  1G93 A;  3ZGF A;  3BSS A;  3NGW A;  2V0H A;  4ECM A;  1VGT A;  4ZDQ A;  4NAN A;  2MZB A;  1KGT A;  4EGG A;  1ZCV A;  4G87 A;  3R8Y A;  2YES A;  3OGZ A;  1G95 A;  1NQI B;  3POL A;  1HJJ A;  5E3R A;  1QQ0 A;  1ZCU A;  3CGX A;  4FRQ A;  5CQP A;  2RJ4 A;  1FGX A;  3JTJ A;  5CMG X;  4NAK A;  1KHR A;  1JV1 A;  2DPW A;  5J49 A;  1FG5 N;  4HCQ A;  5U2K A;  1ZJP A;  3R1W A;  2A8W A;  1INJ A;  4MYB A;  4YS8 A;  5C1L A;  5C4F A;  3OH3 A;  3OH2 A;  4BMA A;  3OTZ A;  3Q80 A;  3VBP A;  2FY7 A;  2APC A;  4EEM A;  1NMM B;  2XWM A;  4ASJ A;  1KK4 A;  1ZI5 A;  2CU2 A;  5JQQ A;  1R80 A;  1LL0 A;  2RIY A;  3VBM A;  1QRF A;  5ADX U;  1VM8 A;  4B4G A;  1WSZ A;  4FCU A;  4G3Q A;  3I0C A;  5FUH A;  3TQD A;  3V8Y A;  2VFZ A;  2AM3 A;  3F1C A;  4M2A A;  2VXL A;  2NXV A;  3R5A A;  1MRL A;  1H7G A;  1S80 A;  3OW5 A;  3PMO A;  4R37 A;  3D5N A;  1GQC A;  2P73 A;  3N9W A;  4EVW A;  4NAI A;  2P72 A;  3Q4S A;  1MR9 A;  5FV9 A;  4CJB A;  1PZY B;  1MP4 A;  3I0H A;  2FYC B;  3OH1 A;  2YCM A;  4KC2 A;  4DDZ A;  2XMH A;  1ZIZ A;  2FYD B;  4M99 A;  2RJ8 A;  1SSM A;  5CQM X;  3VBI A;  3I0G A;  1H5S A;  2VXM A;  3SX8 A;  1V82 A;  4J18 A;  1NF5 B;  5AFU U;  4IHG A;  1OMZ A;  3EE5 A;  2RJ5 A;  1WT1 A;  1WT2 A;  2AQ9 A;  5AJN A;  4B4B A;  1TDT A;  3DK5 A;  1JYK A;  1ZJ0 A;  4IRQ A;  2WLG A;  5IFY A;  3PKP A;  4DE7 A;  1JVD A;  1FZW A;  3U2T A;  2AEC A;  2RIJ A;  3USR A;  3R5B A;  1H5T B;  1GX0 A;  1JVG A;  1THJ A;  2WLD A;  2AES A;  3V8Z A;  1QRE A;  2QGI A;  4Y6N A;  1FRW A;  3TV0 A;  1SS9 A;  4GBP A;  3R2W A;  3I0L A;  1VH3 A;  1R7Y A;  1FR9 A;  1OMX A;  4FRP A;  1H5S D;  2ICX A;  3EEV A;  1JV3 A;  5CMF X;  3FSX A;  3T7M A;  1NWG B;  4AAW A;  2ZU9 A;  4AYL A;  2X65 A;  3D8V A;  2YC3 A;  2AM4 A;  5C3A A;  3GVD A;  4Y7U A;  1LL2 A;  4JD0 A;  1LL3 A;  1QWJ A;  2D7R A;  4FRD A;  1TW1 A;  3SXA A;  2JF3 A;  3MQG A;  4Y7V A;  4P00 A;  5IDT A;  1EYR A;  1H5T A;  4DCL A;  5CMH A;  3R3I A;  1FR8 A;  4FQW A;  4KPX A;  4M2B A;  3CJ8 A;  4L41 C;  1G23 A;  3ZLK A;  1O7O A;  3CKJ A;  4N6B A;  1J2Z A;  1KWS A;  1VGU A;  1I52 A;  4EE4 A;  4HO6 A;  5EIY A;  1YRO B;  3U2V A;  3P1B A;  4D48 A;  1WT3 A;  2P2O A;  1VZU A;  4UEG A;  4D11 C;  1V67 A;  1R81 A;  4N69 A;  1ZDF A;  4Y63 A;  2RJ1 A;  3FOQ A;  3I3A A;  1G0R A;  2E8B A;  3V0P A;  2YQC A;  1H4C A;  1VGZ A;  1SSQ A;  3KWD A;  2Y4M A;  3ZLL A;  2ZU7 A;  3E26 A;  5C49 A;  5C4E A;  5I1F A;  3PKQ A;  3V0O A;  2QIV X;  1OCX A;  4HUR A;  2JCK A;  2VD4 A;  1V83 A;  2WVL A;  4MFG A;  2QH5 A;  3V0L A;  2Y4K A;  1LZ7 A;  3T7O A;  1GWV A;  4FRB A;  3HSQ A;  3I0D A;  5C36 A;  1HM9 A;  5C4B A;  4Y7G A;  3I0F A;  4Y7F A;  5L6V A;  3R3R A;  4N27 A;  5CQL X;  2WLC A;  2FYA A;  4EA7 A;  3OU9 A;  4NAL A;  4R7P A;  2YC5 A;  2VS5 A;  2Z86 A;  3I0E A;  4AYJ A;  3V90 A;  1TVY A;  4H7O A;  1W77 A;  2D7I A;  1H4D A;  2BO4 A;  3OH4 A;  4HO2 A;  4E1K A;  1ZI1 A;  3OH0 A;  1MP5 A;  3HL3 A;  3PNN A;  2XWL A;  1LXA A;  3SX5 A;  2OI6 A;  1O7Q A;  4R36 A;  2WAW A;  1H3M A;  3BSW A;  2YQH A;  3ZF8 A;  5FTV A;  3SXE A;  2VS4 A;  4EE5 A;  2GGO A;  2WEE A;  2V0I A;  2XAT A;  1W55 A;  3SXD A;  3O3P A;  4N6A A;  4D0T A;  5AJP A;  3IOJ A;  3OKR A;  3R5D A;  1LZJ A;  4HUS A;  1R7T A;  1O23 B;  3FSB A;  4Y62 A;  1VIC A;  1V84 A;  3U2W A;  4MYO A;  4Y7T A;  1VPA A;  2RJ6 A;  1TZF A;  5EJ1 A;  2YQS A;  1IIN A;  1H7Q A;  1T3D A;  3IOI A;  2Y4J A;  1H5R A;  1VZX A;  1ZJ1 A;  3SX7 A;  4EQY A;  5CQO A;  3ST8 A;  2GGQ A;  2PGY A;  5E3Q A;  5FTS A;  4D11 A;  3Q1X A;  1ON6 A;  2RIZ A;  3V0Q A;  2YQJ A;  1ZJ2 A;  4E75 A;  1MC3 A;  4KT7 A;  2VHE A;  3CKV A;  1GWW A;  2D0J A;  3SXC A;  4EEO A;  4LW3 A;  3KWC A;  1YP3 A;  3TWD A;  4FRL A;  1ZCY A;  1NKH B;  3F1X A;  3RMW A;  2OI7 A;  3LW6 A;  2Z87 A;  1VH1 A;  1H5S B;  2TDT A;  1ON8 A;  3BRK X;  3MC4 A;  1H7E A;  2OEF A;  4HO8 A;  1FO9 A;  4B42 A;  1KQA A;  1EZI A;  4HO4 A;  4B2W A;  3U0X A;  2FYB A;  3RMV A;  1SST A;  5FU8 A;  3V0N A;  4HOC A;  1ZJ3 A;  1ZCT A;  2I5K A;  1JYL A;  1OQM B;  3R5C A;  3TIS A;  1H7T A;  3EG4 A;  5C48 A;  1H5R B;  1YP4 A;  3BSY A;  4KC1 A;  1HV9 A;  1GX4 A;  3FTT A;  2AGD A;  3D98 A;  4FRA A;  1S4O A;  3GOS A;  4JIS A;  3JQY A;  5L6S A;  2QIA A;  2XWN A;  1G1L A;  5EJZ A;  1VZT A;  3FS8 A;  3CKO A;  5C4C A;  4E79 A;  4LW6 A;  1KGQ A;  1QRL A;  4HZC A;  1KK6 A;  2RJ7 A;  4FRH A;  4KC4 A;  3USQ A;  4D0Z A;  5C38 A;  4M98 A;  2AH9 A;  1QGQ A;  2BO8 A;  3HJJ A;  3U2X A;  1G97 A;  3K8E A;  1NHE B;  2FKO A;  5CMI A;  4HO5 A;  3F1Y A;  4HO3 A;  1G3L A;  1QG8 A;  2RIT A;  5DEP A;  1FWY A;  2VSI A;  4FRO A;  2Y4L A;  5FU0 A;  2E3D A;  3OTM A;  3OAM A;  3SXB A;  3VBJ A;  4EA9 A;  2JCL A;  4B4M A;  1QRM A;  3VNP A;  1ZI4 A;  4M9C A;  2NPO A;  2X60 A;  3K8D A;  4EAA A;  2WE9 A;  2W0V A;  1XAT A;  5HS2 A;  4K6R A;  1H7F A;  2Y6P A;  4BQH A;  1XHB A;  2IC7 A;  1XHD A;  1ZJO A;  3BFP A;  4KNX A;  5C1H A;  1R7X A;  4MZU A;  1H7H A;  4M4K A;  2FFU A;  1PZT A;  3OC9 A;  4G3P A;  5C8R A;  1WT0 A;  1LZI A;  4KRV A;  3DJ4 A;  2I7B A;  1H4E A;  4IHH A;  4IHF A;  1G2V A;  4HZD A;  1R82 A;  1TW5 A;  4KQL A;  3SRT A;  2A8U A;  1FOA A;  4B5B A;  4E6U A;  2VSH A;  2RJ9 A;  1G9R A;  2Q4J A;  3IGJ A;  3IXC A;  3I3X A;  2PA4 A;  2WGZ A;  1KRV A;  3U2U A;  5ADX V;  5CMJ A;  3V4E A;  3DUV A;  4KPZ A;  2P6W A;  1GA8 A;  2O1G A;  3CU0 A;  5DDV A;  4DEC A;  2FFV A;  2X5S A;  3E25 A;  1FXJ A;  3IOH A;  1ZHJ A;  4B2X A;  3GUE A;  1XZ6 A;  2WVM A;  3VBN A;  2PGV A;  5DG3 A;  2V0K A;  1R7V A;  4EAB A;  2OI5 A;  3TK8 A;  1YP2 A;  4CVH A;  1LZ0 A;  4EEG A;  1FO8 A;  3KIA A;  4IRP A;  3VBL A;  1HJL A;  1H7L A;  2WLE A;  2W0W A;  4ASY A;  4CJC A;  3SPT A;  5C3D A;  1HM8 A;  3EH0 A;  4M28 A;  3C8V A;  3FSC A;  1WVC A;  3T7N A;  5DDT A;  3RSB A;  5DEM A;  1IIM A;  2JCJ A;  4Y9X A;  3I0I X;  4G3S A;  5C47 A;  4EE3 A;  1W57 A;  3TZT A;  3CKQ A;  3CKN A;  4KXO A;  4ISX A;  5AJO A;  3T57 A;  3JUJ A;  3QVB A;  2JF2 A;  3JUK A;  3ECT A;  1KRR A;  3ZGG A;  5CQN X;  5C4D A;  2V0J A;  5C3B A;  3SXG A;  3U0Y A;  4KNR A;  2V0L A;  2XME A;  2I5E A;  4HO9 A;  1ZI3 A; 
#chains in the Genus database with same CATH topology
 4EEA A;  4FCE A;  2AM5 A;  4B3U A;  1GQ9 A;  3NZ2 A;  4ARW A;  4C2S A;  4CJ8 A;  3KWE A;  1G8O A;  3BCV A;  5F42 A;  3R0S A;  1HM0 A;  3TIO A;  4MND A;  3TDT A;  4P02 A;  3DHO A;  3V0M A;  2RJ0 A;  4AC3 A;  2WVK A;  2ICY A;  1E5K A;  2QKX A;  3BXY A;  1VGW A;  2JCO A;  4O6N A;  4Y64 A;  3MQH A;  1R7U A;  1ZDG A;  3VBK A;  3Q7U A;  1Z90 A;  5E3P A;  1QRG A;  3I0K A;  2WLF A;  3I0J A;  2BO6 A;  2Y7A A;  2ZU8 A;  5BXC A;  2IU8 A;  4EA8 A;  4Y6U A;  4XWI A;  1FGG A;  4E6T A;  4HO0 A;  1O0R A;  2O1F A;  4FRM A;  1MR7 A;  2AE7 A;  2IUA A;  5C1G A;  3FSY A;  5FYE A;  1K4V A;  2IU9 A;  3P47 A;  2PX7 A;  3V91 A;  1INI A;  1S4N A;  2O1H A;  2X5Z A;  2RIX A;  2OEG A;  3OUP A;  4AA7 A;  2BO7 A;  1FXO A;  1MP3 A;  2UX8 A;  4HG6 A;  1KK5 A;  1V3W A;  1LVW A;  1QGS A;  3FWW A;  1KRU A;  1H5S C;  4FRE A;  5IDS A;  5AFU V;  1S4P A;  4J09 A;  2J0B A;  3SX3 A;  2VS3 A;  1G93 A;  3ZGF A;  3BSS A;  3NGW A;  2V0H A;  4ECM A;  1VGT A;  4ZDQ A;  4NAN A;  2MZB A;  1KGT A;  3OGZ A;  4EGG A;  4G87 A;  3R8Y A;  1ZCV A;  2YES A;  1G95 A;  1NQI B;  3POL A;  1HJJ A;  5E3R A;  1QQ0 A;  1ZCU A;  3CGX A;  4FRQ A;  5CQP A;  2RJ4 A;  1FGX A;  3JTJ A;  5CMG X;  4NAK A;  1KHR A;  1JV1 A;  2DPW A;  5J49 A;  1FG5 N;  4HCQ A;  5U2K A;  1ZJP A;  3R1W A;  2A8W A;  1INJ A;  4MYB A;  4YS8 A;  5C1L A;  5C4F A;  3OH3 A;  3OH2 A;  4BMA A;  3OTZ A;  3Q80 A;  3VBP A;  2FY7 A;  2APC A;  4EEM A;  1NMM B;  2XWM A;  4ASJ A;  1KK4 A;  1ZI5 A;  2CU2 A;  5JQQ A;  1R80 A;  1LL0 A;  2RIY A;  3VBM A;  1QRF A;  5ADX U;  1VM8 A;  4B4G A;  1WSZ A;  4FCU A;  4G3Q A;  3I0C A;  5FUH A;  3TQD A;  3V8Y A;  2VFZ A;  2AM3 A;  3F1C A;  3GQA A;  4M2A A;  2VXL A;  2NXV A;  3R5A A;  1MRL A;  1H7G A;  1S80 A;  3OW5 A;  3PMO A;  4R37 A;  3D5N A;  1GQC A;  2P73 A;  3N9W A;  4EVW A;  4NAI A;  2P72 A;  3Q4S A;  1MR9 A;  5FV9 A;  4CJB A;  1PZY B;  1MP4 A;  3I0H A;  2FYC B;  3OH1 A;  2YCM A;  5D92 A;  4KC2 A;  4DDZ A;  2XMH A;  1ZIZ A;  2FYD B;  4M99 A;  2RJ8 A;  1SSM A;  5CQM X;  3VBI A;  3I0G A;  1H5S A;  2VXM A;  3SX8 A;  1V82 A;  4J18 A;  1NF5 B;  5AFU U;  4IHG A;  1OMZ A;  3EE5 A;  2RJ5 A;  1WT1 A;  1WT2 A;  2AQ9 A;  5AJN A;  4B4B A;  1TDT A;  3DK5 A;  1JYK A;  1ZJ0 A;  4IRQ A;  2WLG A;  5IFY A;  3PKP A;  4DE7 A;  1JVD A;  1FZW A;  3U2T A;  2AEC A;  2RIJ A;  3USR A;  3R5B A;  1H5T B;  1GX0 A;  1JVG A;  1THJ A;  2WLD A;  2AES A;  3V8Z A;  1QRE A;  2QGI A;  4Y6N A;  4DEC A;  1FRW A;  3TV0 A;  1SS9 A;  4GBP A;  3R2W A;  3I0L A;  1VH3 A;  4MIX A;  1R7Y A;  1FR9 A;  1OMX A;  4FRP A;  1H5S D;  2ICX A;  3EEV A;  1JV3 A;  1N4I A;  1L0S A;  5CMF X;  3FSX A;  3T7M A;  1NWG B;  4AAW A;  2ZU9 A;  4AYL A;  2X65 A;  3D8V A;  2YC3 A;  2AM4 A;  5C3A A;  1M8N A;  3GVD A;  4Y7U A;  1LL2 A;  4JD0 A;  1LL3 A;  1QWJ A;  2D7R A;  4FRD A;  1TW1 A;  3SXA A;  2JF3 A;  3MQG A;  4Y7V A;  4P00 A;  5IDT A;  1EYR A;  1H5T A;  4DCL A;  5CMH A;  3R3I A;  1FR8 A;  4FQW A;  4KPX A;  4M2B A;  3CJ8 A;  4L41 C;  1G23 A;  3ZLK A;  1O7O A;  3CKJ A;  4N6B A;  1J2Z A;  1KWS A;  1VGU A;  1I52 A;  4EE4 A;  4HO6 A;  5EIY A;  1YRO B;  3U2V A;  3P1B A;  4O6M A;  4D48 A;  1WT3 A;  2P2O A;  1VZU A;  4UEG A;  4D11 C;  1V67 A;  1R81 A;  4N69 A;  1ZDF A;  4Y63 A;  2RJ1 A;  3FOQ A;  3I3A A;  1G0R A;  2E8B A;  3V0P A;  2YQC A;  1H4C A;  1VGZ A;  1SSQ A;  3KWD A;  2Y4M A;  3ZLL A;  2ZU7 A;  3E26 A;  5C49 A;  5C4E A;  5I1F A;  3PKQ A;  3V0O A;  2QIV X;  1OCX A;  4HUR A;  2JCK A;  2VD4 A;  1V83 A;  2WVL A;  4MFG A;  2QH5 A;  3V0L A;  2Y4K A;  1LZ7 A;  3T7O A;  1GWV A;  4FRB A;  3HSQ A;  3I0D A;  5C36 A;  1HM9 A;  5C4B A;  4Y7G A;  3I0F A;  4Y7F A;  2J0A A;  5L6V A;  3R3R A;  4N27 A;  4FIY A;  2WLC A;  2FYA A;  4EA7 A;  5CQL X;  3OU9 A;  4NAL A;  4R7P A;  2YC5 A;  2VS5 A;  1Z2F A;  2Z86 A;  3I0E A;  4AYJ A;  3V90 A;  1TVY A;  4H7O A;  1W77 A;  3OH4 A;  1H4D A;  2BO4 A;  2D7I A;  4HO2 A;  4E1K A;  3OH0 A;  1ZI1 A;  1MP5 A;  3HL3 A;  3PNN A;  2XWL A;  1LXA A;  3SX5 A;  2OI6 A;  1O7Q A;  4R36 A;  2WAW A;  1H3M A;  3BSW A;  2YQH A;  3ZF8 A;  5FTV A;  3SXE A;  5D91 A;  2VS4 A;  4EE5 A;  2GGO A;  2WEE A;  2V0I A;  2XAT A;  1W55 A;  3SXD A;  3O3P A;  4N6A A;  4D0T A;  5AJP A;  3IOJ A;  4Q7C A;  3OKR A;  3R5D A;  1LZJ A;  4HUS A;  1R7T A;  1O23 B;  3FSB A;  4Y62 A;  1VIC A;  1V84 A;  3U2W A;  4MYO A;  4Y7T A;  1VPA A;  2RJ6 A;  1TZF A;  5EJ1 A;  2YQS A;  1IIN A;  1H7Q A;  1T3D A;  3IOI A;  2Y4J A;  1H5R A;  1VZX A;  1ZJ1 A;  3SX7 A;  4EQY A;  5CQO A;  3ST8 A;  2GGQ A;  2PGY A;  5E3Q A;  5FTS A;  4D11 A;  3Q1X A;  1ON6 A;  2RIZ A;  3V0Q A;  2YQJ A;  1ZJ2 A;  4E75 A;  1MC3 A;  4KT7 A;  2VHE A;  3CKV A;  1GWW A;  2D0J A;  3SXC A;  4EEO A;  4LW3 A;  3KWC A;  1YP3 A;  3TWD A;  4FRL A;  1ZCY A;  1NKH B;  3F1X A;  3RMW A;  2OI7 A;  3LW6 A;  2Z87 A;  1VH1 A;  1H5S B;  2TDT A;  1ON8 A;  3BRK X;  3MC4 A;  1H7E A;  2OEF A;  4HO8 A;  1FO9 A;  4B42 A;  1KQA A;  1EZI A;  4HO4 A;  4B2W A;  3U0X A;  2FYB A;  3RMV A;  1SST A;  5FU8 A;  3V0N A;  4HOC A;  1ZJ3 A;  1ZCT A;  2I5K A;  1JYL A;  1OQM B;  3R5C A;  3TIS A;  1H7T A;  3EG4 A;  5C48 A;  1H5R B;  1YP4 A;  3BSY A;  4KC1 A;  1HV9 A;  1GX4 A;  3FTT A;  2AGD A;  3D98 A;  4FRA A;  1S4O A;  3GOS A;  4JIS A;  3JQY A;  5L6S A;  2QIA A;  2XWN A;  1G1L A;  5EJZ A;  1VZT A;  3FS8 A;  3CKO A;  5C4C A;  4E79 A;  4LW6 A;  1KGQ A;  1QRL A;  4HZC A;  1KK6 A;  2RJ7 A;  4FRH A;  4KC4 A;  3USQ A;  4D0Z A;  5C38 A;  4M98 A;  2AH9 A;  1QGQ A;  2BO8 A;  3HJJ A;  3U2X A;  1G97 A;  3K8E A;  1NHE B;  2FKO A;  5CMI A;  4HO5 A;  3F1Y A;  2C0N A;  1G3L A;  1QG8 A;  4HO3 A;  2RIT A;  5DEP A;  1FWY A;  2VSI A;  4FRO A;  2Y4L A;  5FU0 A;  2E3D A;  3OTM A;  3OAM A;  3SXB A;  3VBJ A;  4EA9 A;  2JCL A;  4B4M A;  1QRM A;  3VNP A;  1ZI4 A;  4M9C A;  2NPO A;  1EWW A;  2X60 A;  3K8D A;  3GQ7 A;  4EAA A;  2WE9 A;  2W0V A;  1XAT A;  5HS2 A;  4K6R A;  1H7F A;  2Y6P A;  4BQH A;  1XHB A;  2IC7 A;  1XHD A;  1ZJO A;  3BFP A;  4KNX A;  5C1H A;  1R7X A;  4MZU A;  1H7H A;  4M4K A;  2FFU A;  1PZT A;  3OC9 A;  4G3P A;  5C8R A;  1WT0 A;  1LZI A;  4KRV A;  3DJ4 A;  2I7B A;  1H4E A;  4IHH A;  4IHF A;  1G2V A;  4HZD A;  1R82 A;  1TW5 A;  4KQL A;  2VK9 A;  3SRT A;  2A8U A;  1FOA A;  4B5B A;  4E6U A;  2VSH A;  2RJ9 A;  1G9R A;  2Q4J A;  3IGJ A;  3IXC A;  3I3X A;  2PA4 A;  2WGZ A;  1KRV A;  3U2U A;  5ADX V;  5CMJ A;  3V4E A;  3DUV A;  4KPZ A;  2P6W A;  1GA8 A;  2O1G A;  3CU0 A;  5DDV A;  3GQ9 A;  2FFV A;  2X5S A;  3E25 A;  1FXJ A;  3IOH A;  1ZHJ A;  4B2X A;  3GUE A;  1XZ6 A;  2WVM A;  3VBN A;  2PGV A;  5DG3 A;  2V0K A;  1R7V A;  4EAB A;  2OI5 A;  3TK8 A;  1YP2 A;  4CVH A;  1LZ0 A;  4EEG A;  1FO8 A;  3KIA A;  4IRP A;  3SUC A;  3VBL A;  1HJL A;  1H7L A;  2WLE A;  2W0W A;  4ASY A;  4CJC A;  3SPT A;  5C3D A;  1HM8 A;  3GQ8 A;  3EH0 A;  4M28 A;  3C8V A;  3FSC A;  1WVC A;  3T7N A;  4FIX A;  5DDT A;  3RSB A;  5DEM A;  1IIM A;  2JCJ A;  4Y9X A;  3I0I X;  4G3S A;  5C47 A;  4EE3 A;  1W57 A;  3TZT A;  3CKQ A;  3CKN A;  4KXO A;  4ISX A;  5AJO A;  3T57 A;  3JUJ A;  3QVB A;  2JF2 A;  3JUK A;  3ECT A;  1KRR A;  3ZGG A;  5CQN X;  5C4D A;  2V0J A;  5C3B A;  3SXG A;  3U0Y A;  4KNR A;  2V0L A;  2XME A;  2I5E A;  4HO9 A;  1ZI3 A; 
#chains in the Genus database with same CATH homology
 4EEA A;  4FCE A;  2AM5 A;  4B3U A;  1GQ9 A;  3NZ2 A;  4ARW A;  4C2S A;  4CJ8 A;  3KWE A;  1G8O A;  3BCV A;  5F42 A;  3R0S A;  1HM0 A;  3TIO A;  4MND A;  3TDT A;  4P02 A;  3DHO A;  3V0M A;  2RJ0 A;  4AC3 A;  2WVK A;  2ICY A;  1E5K A;  2QKX A;  3BXY A;  1VGW A;  2JCO A;  4O6N A;  4Y64 A;  3MQH A;  1R7U A;  1ZDG A;  3VBK A;  3Q7U A;  1Z90 A;  5E3P A;  1QRG A;  3I0K A;  2WLF A;  3I0J A;  2BO6 A;  2Y7A A;  2ZU8 A;  5BXC A;  2IU8 A;  4EA8 A;  4Y6U A;  4XWI A;  1FGG A;  4E6T A;  4HO0 A;  1O0R A;  2O1F A;  4FRM A;  1MR7 A;  2AE7 A;  2IUA A;  5C1G A;  3FSY A;  5FYE A;  1K4V A;  2IU9 A;  3P47 A;  2PX7 A;  3V91 A;  1INI A;  1S4N A;  2O1H A;  2X5Z A;  2RIX A;  2OEG A;  3OUP A;  4AA7 A;  2BO7 A;  1FXO A;  1MP3 A;  2UX8 A;  4HG6 A;  1KK5 A;  1V3W A;  1LVW A;  1QGS A;  3FWW A;  1KRU A;  1H5S C;  4FRE A;  5IDS A;  5AFU V;  1S4P A;  4J09 A;  2J0B A;  3SX3 A;  2VS3 A;  1G93 A;  3ZGF A;  3BSS A;  3NGW A;  2V0H A;  4ECM A;  1VGT A;  4ZDQ A;  4NAN A;  2MZB A;  1KGT A;  4EGG A;  1ZCV A;  4G87 A;  3R8Y A;  2YES A;  3OGZ A;  1G95 A;  1NQI B;  3POL A;  1HJJ A;  5E3R A;  1QQ0 A;  1ZCU A;  3CGX A;  4FRQ A;  5CQP A;  2RJ4 A;  1FGX A;  3JTJ A;  5CMG X;  4NAK A;  1KHR A;  1JV1 A;  2DPW A;  5J49 A;  1FG5 N;  4HCQ A;  5U2K A;  1ZJP A;  3R1W A;  2A8W A;  1INJ A;  4MYB A;  4YS8 A;  5C1L A;  5C4F A;  3OH3 A;  3OH2 A;  4BMA A;  3OTZ A;  3Q80 A;  3VBP A;  2FY7 A;  2APC A;  4EEM A;  1NMM B;  2XWM A;  4ASJ A;  1KK4 A;  1ZI5 A;  2CU2 A;  5JQQ A;  1R80 A;  1LL0 A;  2RIY A;  3VBM A;  1QRF A;  5ADX U;  1VM8 A;  4B4G A;  1WSZ A;  4FCU A;  4G3Q A;  3I0C A;  5FUH A;  3TQD A;  3V8Y A;  2VFZ A;  2AM3 A;  3F1C A;  4M2A A;  2VXL A;  2NXV A;  3R5A A;  1MRL A;  1H7G A;  1S80 A;  3OW5 A;  3PMO A;  4R37 A;  3D5N A;  1GQC A;  2P73 A;  3N9W A;  4EVW A;  4NAI A;  2P72 A;  3Q4S A;  1MR9 A;  5FV9 A;  4CJB A;  1PZY B;  1MP4 A;  3I0H A;  2FYC B;  3OH1 A;  2YCM A;  5D92 A;  4KC2 A;  4DDZ A;  2XMH A;  1ZIZ A;  2FYD B;  4M99 A;  2RJ8 A;  1SSM A;  5CQM X;  3VBI A;  3I0G A;  1H5S A;  2VXM A;  3SX8 A;  1V82 A;  4J18 A;  1NF5 B;  5AFU U;  4IHG A;  1OMZ A;  3EE5 A;  2RJ5 A;  1WT1 A;  1WT2 A;  2AQ9 A;  5AJN A;  4B4B A;  1TDT A;  3DK5 A;  1JYK A;  1ZJ0 A;  4IRQ A;  2WLG A;  5IFY A;  3PKP A;  4DE7 A;  1JVD A;  1FZW A;  3U2T A;  2AEC A;  2RIJ A;  3USR A;  3R5B A;  1H5T B;  1GX0 A;  1JVG A;  1THJ A;  2WLD A;  2AES A;  3V8Z A;  1QRE A;  2QGI A;  4Y6N A;  1FRW A;  3TV0 A;  1SS9 A;  4GBP A;  3R2W A;  3I0L A;  1VH3 A;  4MIX A;  1R7Y A;  1FR9 A;  1OMX A;  4FRP A;  1H5S D;  2ICX A;  3EEV A;  1JV3 A;  5CMF X;  3FSX A;  3T7M A;  1NWG B;  4AAW A;  2ZU9 A;  4AYL A;  2X65 A;  3D8V A;  2YC3 A;  2AM4 A;  5C3A A;  3GVD A;  4Y7U A;  1LL2 A;  4JD0 A;  1LL3 A;  1QWJ A;  2D7R A;  4FRD A;  1TW1 A;  3SXA A;  2JF3 A;  3MQG A;  4Y7V A;  4P00 A;  5IDT A;  1EYR A;  1H5T A;  4DCL A;  5CMH A;  3R3I A;  1FR8 A;  4FQW A;  4KPX A;  4M2B A;  3CJ8 A;  4L41 C;  1G23 A;  3ZLK A;  1O7O A;  3CKJ A;  4N6B A;  1J2Z A;  1KWS A;  1VGU A;  1I52 A;  4EE4 A;  4HO6 A;  5EIY A;  1YRO B;  3U2V A;  3P1B A;  4O6M A;  4D48 A;  1WT3 A;  2P2O A;  1VZU A;  4UEG A;  4D11 C;  1V67 A;  1R81 A;  4N69 A;  1ZDF A;  4Y63 A;  2RJ1 A;  3FOQ A;  3I3A A;  1G0R A;  2E8B A;  3V0P A;  2YQC A;  1H4C A;  1VGZ A;  1SSQ A;  3KWD A;  2Y4M A;  3ZLL A;  2ZU7 A;  3E26 A;  5C49 A;  5C4E A;  5I1F A;  3PKQ A;  3V0O A;  2QIV X;  1OCX A;  4HUR A;  2JCK A;  2VD4 A;  1V83 A;  2WVL A;  4MFG A;  2QH5 A;  3V0L A;  2Y4K A;  1LZ7 A;  3T7O A;  1GWV A;  4FRB A;  3HSQ A;  3I0D A;  5C36 A;  1HM9 A;  5C4B A;  4Y7G A;  3I0F A;  4Y7F A;  2J0A A;  5L6V A;  3R3R A;  4N27 A;  4FIY A;  2WLC A;  2FYA A;  4EA7 A;  5CQL X;  3OU9 A;  4NAL A;  4R7P A;  2YC5 A;  2VS5 A;  2Z86 A;  3I0E A;  4AYJ A;  3V90 A;  1TVY A;  4H7O A;  1W77 A;  2D7I A;  1H4D A;  2BO4 A;  3OH4 A;  4HO2 A;  4E1K A;  1ZI1 A;  3OH0 A;  1MP5 A;  3HL3 A;  3PNN A;  2XWL A;  1LXA A;  3SX5 A;  2OI6 A;  1O7Q A;  4R36 A;  2WAW A;  1H3M A;  3BSW A;  2YQH A;  3ZF8 A;  5FTV A;  3SXE A;  5D91 A;  2VS4 A;  4EE5 A;  2GGO A;  2WEE A;  2V0I A;  2XAT A;  1W55 A;  3SXD A;  3O3P A;  4N6A A;  4D0T A;  5AJP A;  3IOJ A;  4Q7C A;  3OKR A;  3R5D A;  1LZJ A;  4HUS A;  1R7T A;  1O23 B;  3FSB A;  4Y62 A;  1VIC A;  1V84 A;  3U2W A;  4MYO A;  4Y7T A;  1VPA A;  2RJ6 A;  1TZF A;  5EJ1 A;  2YQS A;  1IIN A;  1H7Q A;  1T3D A;  3IOI A;  2Y4J A;  1H5R A;  1VZX A;  1ZJ1 A;  3SX7 A;  4EQY A;  5CQO A;  3ST8 A;  2GGQ A;  2PGY A;  5E3Q A;  5FTS A;  4D11 A;  3Q1X A;  1ON6 A;  2RIZ A;  3V0Q A;  2YQJ A;  1ZJ2 A;  4E75 A;  1MC3 A;  4KT7 A;  2VHE A;  3CKV A;  1GWW A;  2D0J A;  3SXC A;  4EEO A;  4LW3 A;  3KWC A;  1YP3 A;  3TWD A;  4FRL A;  1ZCY A;  1NKH B;  3F1X A;  3RMW A;  2OI7 A;  3LW6 A;  2Z87 A;  1VH1 A;  1H5S B;  2TDT A;  1ON8 A;  3BRK X;  3MC4 A;  1H7E A;  2OEF A;  4HO8 A;  1FO9 A;  4B42 A;  1KQA A;  1EZI A;  4HO4 A;  4B2W A;  3U0X A;  2FYB A;  3RMV A;  1SST A;  5FU8 A;  3V0N A;  4HOC A;  1ZJ3 A;  1ZCT A;  2I5K A;  1JYL A;  1OQM B;  3R5C A;  3TIS A;  1H7T A;  3EG4 A;  5C48 A;  1H5R B;  1YP4 A;  3BSY A;  4KC1 A;  1HV9 A;  1GX4 A;  3FTT A;  2AGD A;  3D98 A;  4FRA A;  1S4O A;  3GOS A;  4JIS A;  3JQY A;  5L6S A;  2QIA A;  2XWN A;  1G1L A;  5EJZ A;  1VZT A;  3FS8 A;  3CKO A;  5C4C A;  4E79 A;  4LW6 A;  1KGQ A;  1QRL A;  4HZC A;  1KK6 A;  2RJ7 A;  4FRH A;  4KC4 A;  3USQ A;  4D0Z A;  5C38 A;  4M98 A;  2AH9 A;  1QGQ A;  2BO8 A;  3HJJ A;  3U2X A;  1G97 A;  3K8E A;  1NHE B;  2FKO A;  5CMI A;  4HO5 A;  3F1Y A;  2C0N A;  1G3L A;  1QG8 A;  4HO3 A;  2RIT A;  5DEP A;  1FWY A;  2VSI A;  4FRO A;  2Y4L A;  5FU0 A;  2E3D A;  3OTM A;  3OAM A;  3SXB A;  3VBJ A;  4EA9 A;  2JCL A;  4B4M A;  1QRM A;  3VNP A;  1ZI4 A;  4M9C A;  2NPO A;  2X60 A;  3K8D A;  4EAA A;  2WE9 A;  2W0V A;  1XAT A;  5HS2 A;  4K6R A;  1H7F A;  2Y6P A;  4BQH A;  1XHB A;  2IC7 A;  1XHD A;  1ZJO A;  3BFP A;  4KNX A;  5C1H A;  1R7X A;  4MZU A;  1H7H A;  4M4K A;  2FFU A;  1PZT A;  3OC9 A;  4G3P A;  5C8R A;  1WT0 A;  1LZI A;  4KRV A;  3DJ4 A;  2I7B A;  1H4E A;  4IHH A;  4IHF A;  1G2V A;  4HZD A;  1R82 A;  1TW5 A;  4KQL A;  2VK9 A;  3SRT A;  2A8U A;  1FOA A;  4B5B A;  4E6U A;  2VSH A;  2RJ9 A;  1G9R A;  2Q4J A;  3IGJ A;  3IXC A;  3I3X A;  2PA4 A;  2WGZ A;  1KRV A;  3U2U A;  5ADX V;  5CMJ A;  3V4E A;  3DUV A;  4KPZ A;  2P6W A;  1GA8 A;  2O1G A;  3CU0 A;  5DDV A;  4DEC A;  2FFV A;  2X5S A;  3E25 A;  1FXJ A;  3IOH A;  1ZHJ A;  4B2X A;  3GUE A;  1XZ6 A;  2WVM A;  3VBN A;  2PGV A;  5DG3 A;  2V0K A;  1R7V A;  4EAB A;  2OI5 A;  3TK8 A;  1YP2 A;  4CVH A;  1LZ0 A;  4EEG A;  1FO8 A;  3KIA A;  4IRP A;  3VBL A;  1HJL A;  1H7L A;  2WLE A;  2W0W A;  4ASY A;  4CJC A;  3SPT A;  5C3D A;  1HM8 A;  3EH0 A;  4M28 A;  3C8V A;  3FSC A;  1WVC A;  3T7N A;  4FIX A;  5DDT A;  3RSB A;  5DEM A;  1IIM A;  2JCJ A;  4Y9X A;  3I0I X;  4G3S A;  5C47 A;  4EE3 A;  1W57 A;  3TZT A;  3CKQ A;  3CKN A;  4KXO A;  4ISX A;  5AJO A;  3T57 A;  3JUJ A;  3QVB A;  2JF2 A;  3JUK A;  3ECT A;  1KRR A;  3ZGG A;  5CQN X;  5C4D A;  2V0J A;  5C3B A;  3SXG A;  3U0Y A;  4KNR A;  2V0L A;  2XME A;  2I5E A;  4HO9 A;  1ZI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...