4G87A

Crystal structure of glmu from mycobacterium tuberculosis snapshot 1
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g87A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g87A01
3R1WA 4P02A 4FRQA 5EIYA 4EEAA 3OH3A 2D7RA 1FG5N 1G23A 2JF2A 2V0JA 1NHEB 5BXCA 5J49A 1ZI3A 2ICYA 3OTMA 4M4KA 4DDZA 1O0RA 5C3DA 5E3PA 1ON8A 1S4OA 1T3DA 1ZCYA 5C3BA 1G9RA 3ST8A 4XWIA 3TV0A 1H7LA 5C4FA 1ZI1A 3SXEA 1MRLA 1NMMB 2RJ1A 2D7IA 4Y7TA 1QRFA 4ASJA 1FR9A 3FSCA 2WLFA 4MYBA 1GX4A 3OGZA 1G1LA 4GBPA 2WLDA 5C47A 1H5RA 1QGSA 2TDTA 4HO3A 1TZFA 3V91A 3USQA 4M2AA 1S4NA 1ZCTA 4Y7VA 3SX5A 2VD4A 3T7NA 2A8WA 4FREA 1XATA 5L6VA 1QWJA 1ZI4A 4KRVA 3SXGA 3V90A 1YP4A 5CMJA 3R8YA 4FRHA 1O7QA 2XWLA 3OH1A 1H4CA 4FCUA 4HUSA 4IHFA 5AJNA 2VS3A 5DEPA 1G97A 2YQCA 2BO6A 1LZIA 2I5EA 3HL3A 4HO5A 1W57A 4CVHA 3I0HA 5E3RA 2WEEA 3I0CA 3EG4A 2Y7AA 3I0KA 2WVLA 4HOCA 1H7HA 5C1GA 5U2KA 1YP2A 3PKQA 4KPZA 4EE5A 3R5DA 4YS8A 2NXVA 4IRPA 3RMWA 3DHOA 1KK4A 2DPWA 4AA7A 4EABA 1LL0A 5C38A 3R3IA 1WT2A 1I52A 2RITA 2VSIA 3BFPA 1INIA 2ICXA 2FYAA 4MFGA 3V0NA 1IIMA 3SXBA 1V3WA 2YC5A 4FRDA 1ZI5A 3TK8A 2BO4A 4B4MA 1HJLA 3N9WA 3V4EA 5FUHA 4B4GA 4EEOA 1SS9A 3NZ2A 2PGYA 1ZJOA 2AM4A 4M99A 2FYBA 4MNDA 3SX7A 1QRLA 1Z90A 3BSSA 3P47A 1H5TB 2RJ4A 2ZU8A 1S4PA 3PKPA 3TZTA 1TW1A 1OQMB 2RIJA 3CJ8A 3MC4A 1ZHJA 1G93A 1LL3A 4EGGA 2JCLA 3R5CA 1TVYA 1TW5A 2V0LA 1KGQA 5AFUV 1JVDA 3K8EA 1G3LA 4HO8A 4ASYA 4HZDA 2RIXA 1H7QA 2QH5A 4JISA 4CJCA 4EVWA 1MP4A 5ADXV 2ZU7A 2V0IA 2WE9A 1GWWA 4P00A 2E3DA 3ZLKA 4AC3A 3OKRA 1ZDGA 3IOIA 1H7GA 1R81A 1NF5B 4ISXA 1KGTA 2AGDA 3VBLA 5C48A 5F42A 2X60A 1ON6A 1WT3A 1SSTA 4IHHA 3OAMA 1S80A 2WLEA 3PMOA 3SPTA 1E5KA 1R80A 2FFVA 2UX8A 2YQHA 4MZUA 4NAKA 3T7OA 2AM5A 3ZGGA 1QREA 1INJA 1MP5A 2RJ6A 1V83A 4KC1A 2V0HA 5AJPA 4KNRA 1FO9A 3Q80A 3IOJA 2RIYA 4LW3A 5EJZA 1KK6A 4HO6A 1MP3A 3U0YA 3TDTA 2FKOA 3VNPA 3SX3A 3SRTA 1H5TA 4AAWA 1V84A 1NQIB 1LZJA 2QGIA 3D8VA 1OMXA 3R3RA 1QGQA 2XMHA 2YCMA 5CQMX 2OI7A 3R0SA 5C4DA 1KHRA 2OI6A 4B5BA 1YROB 3I0JA 3VBMA 4G87A 3OU9A 5FU0A 3U2XA 3R5BA 3GOSA 1EYRA 4M28A 1FZWA 1XZ6A 3D98A 3I0DA 4N6AA 1H5SB 4B2XA 2YQJA 4E75A 1G2VA 5C3AA 4IRQA 4R7PA 1G8OA 1GQCA 2MZBA 4FRMA 3IGJA 2WLGA 3O3PA 4CJBA 1JYKA 5C1HA 2V0KA 3ECTA 3CKNA 3BXYA 1WT1A 2Z87A 3D5NA 1NKHB 5EJ1A 3EEVA 3CKJA 4E6UA 3LW6A 5HS2A 2VHEA 5DDVA 4DECA 4ZDQA 2FYDB 1HM0A 4IHGA 4EA9A 1R7TA 2RJ8A 3GVDA 3I0EA 3ZGFA 4KPXA 3QVBA 5FTSA 4BMAA 2CU2A 1ZJ3A 3R5AA 5IFYA 3V0PA 3RSBA 1SSQA 5FTVA 5FYEA 3K8DA 5DG3A 3CGXA 2JCKA 1H4DA 1ZCUA 1LL2A 3FSBA 4BQHA 2JF3A 3FWWA 4B42A 1FGGA 5C49A 2XWNA 4HO2A 5AFUU 3JTJA 5C4CA 4KT7A 2YESA 2A8UA 1VH3A 2XATA 4G3SA 1FGXA 2WVMA 2IC7A 4J18A 4EA8A 1H7TA 5C36A 1H3MA 5ADXU 1H4EA 4B3UA 2AM3A 3V0MA 4C2SA 3OH4A 4FROA 3V0LA 2D0JA 1H5SA 1QG8A 4AYJA 1KWSA 1ZJ1A 5CQNX 2NPOA 3TQDA 3CKVA 2PGVA 2X65A 4EAAA 1HM8A 2FFUA 2JCJA 2Z86A 3KWEA 2OI5A 3MQHA 2AESA 4DCLA 2Y4KA 3ZLLA 3C8VA 5E3QA 3VBIA 1V82A 1VZUA 1EZIA 3BCVA 2IU8A 1R7VA 4E79A 3TWDA 2YQSA 4KC2A 1LVWA 4D0ZA 4KNXA 2P72A 4FQWA 1R7YA 3KWCA 3VBJA 2QKXA 2OEGA 4B2WA 3VBNA 4Y7FA 2WAWA 4KC4A 4D11C 2GGOA 1WSZA 2E8BA 5IDTA 3IOHA 1FWYA 3BSWA 1JVGA 3U2TA 1VGWA 3HJJA 3DJ4A 1W55A 1HV9A 2I5KA 3SXAA 4KQLA 3I0GA 4D11A 3Q7UA 1W77A 2BO7A 1ZJ2A 3JUKA 3EH0A 3EE5A 2VS4A 5DDTA 1ZJ0A 3T57A 4MYOA 4G3PA 3KIAA 1MR9A 3JUJA 4HZCA 4G3QA 1KRUA 4EEGA 3IXCA 3NGWA 3FTTA 2BO8A 1O7OA 1FXOA 3P1BA 4NANA 2ZU9A 4N69A 1ZJPA 2O1GA 3U0XA 4B4BA 4CJ8A 4ECMA 1GA8A 1K4VA 3F1YA 4FRBA 3RMVA 2WGZA 1H7EA 1GX0A 2AE7A 1MR7A 3I0LA 1OCXA 1FOAA 4H7OA 3JQYA 3OTZA 2O1FA 3F1XA 1H7FA 3GUEA 1VICA 3CKQA 4AYLA 2Y4JA 4K6RA 4LW6A 1VGTA 2I7BA 2APCA 4E1KA 3V0QA 1HJJA 2P2OA 4M2BA 3FSXA 5FV9A 4E6TA 2WLCA 1WT0A 4NALA 2VS5A 4M98A 2Y6PA 2AECA 3I0IX 1XHDA 3V0OA 3Q4SA 5CMFX 3I0FA 1G0RA 1GQ9A 4HO4A 2RJ9A 1KRVA 1FXJA 4FCEA 4M9CA 4Y7UA 1IINA 2RJ0A 3SX8A 3U2VA 2XWMA 2AQ9A 4N27A 1JV1A 2X5SA 3CKOA 3E25A 3I3AA 4Y9XA 5C4BA 4FRAA 2QIAA 1J2ZA 5JQQA 1JYLA 1PZTA 4D48A 1VGZA 3KWDA 4EE4A 1ZDFA 3USRA 5C1LA 1GWVA 2RIZA 5CQOA 3TISA 1VM8A 4N6BA 1O23B 2XMEA 4R36A 2RJ7A 3I3XA 2FYCB 2RJ5A 4Y62A 2OEFA 1QQ0A 1WVCA 4Y7GA 4L41C 2Q4JA 5C8RA 4HURA 3Q1XA 1THJA 5CMGX 3VBPA 3MQGA 4D0TA 5AJOA 1V67A 4FRLA 3FOQA 1VZTA 3FS8A 4DE7A 1FRWA 1QRMA 4KXOA 1H5SC 1VH1A 3T7MA 4EE3A 2YC3A 3OH2A 5CQLX 1LZ7A 2FY7A 1SSMA 3U2WA 1G95A 3DUVA 1H5SD 3OW5A 5CQPA 1KK5A 1ZIZA 2W0VA 2QIVX 5FU8A 2PX7A 4FRPA 1KRRA 1MC3A 2VXLA 3ZF8A 2P6WA 4EQYA 4Y64A 3SXCA 1VPAA 4ARWA 1LXAA 2O1HA 2IU9A 3V8ZA 1PZYB 4J09A 3V8YA 4R37A 1ZCVA 5CMIA 3R2WA 3TIOA 1H5RB 4EEMA 3U2UA 4HG6A 3BRKX 2VXMA 3E26A 1R82A 3CU0A 1VZXA 2X5ZA 2GGQA 4UEGA 2Y4LA 4Y6NA 3OH0A 3OC9A 4HO9A 1TDTA 1XHBA 2W0WA 1JV3A 5C4EA 1R7XA 2VSHA 2P73A 2IUAA 2AH9A 4HO0A 4Y63A 2VFZA 1R7UA 3SXDA 5DEMA 4JD0A 1YP3A 4HCQA 3PNNA 3FSYA 1FO8A 4Y6UA 1KQAA 1VGUA 1NWGB 3F1CA 4EA7A 1HM9A 3DK5A 2WVKA 1QRGA 1LZ0A 1OMZA 2JCOA 3VBKA 4NAIA 3POLA 5IDSA 5L6SA 1FR8A 2PA4A 5CMHA 5I1FA 3HSQA 3BSYA 3OUPA 2Y4MA
chains in the Genus database with same CATH superfamily
3R1WA 4P02A 4FRQA 5EIYA 4EEAA 3OH3A 2D7RA 1FG5N 1G23A 2JF2A 2V0JA 3GQ7A 1NHEB 5BXCA 5J49A 1ZI3A 2ICYA 3OTMA 4M4KA 4DDZA 1O0RA 5C3DA 5E3PA 1ON8A 1S4OA 1T3DA 1ZCYA 5C3BA 1G9RA 3ST8A 4XWIA 3TV0A 1H7LA 5C4FA 1ZI1A 3SXEA 1MRLA 1NMMB 2RJ1A 2D7IA 4Y7TA 1QRFA 4ASJA 1FR9A 3FSCA 2WLFA 4MYBA 3OGZA 1GX4A 4FIXA 1G1LA 4GBPA 2WLDA 5C47A 1H5RA 1QGSA 2TDTA 4HO3A 1TZFA 3V91A 3USQA 4M2AA 1S4NA 1ZCTA 4Y7VA 3SX5A 2VD4A 4FIYA 3T7NA 2A8WA 4FREA 1XATA 5L6VA 1QWJA 1ZI4A 4KRVA 3SXGA 3V90A 1YP4A 5CMJA 3R8YA 4FRHA 1O7QA 2XWLA 3OH1A 1H4CA 4FCUA 4HUSA 4IHFA 5AJNA 2VS3A 5DEPA 1G97A 2YQCA 2BO6A 1LZIA 2I5EA 3HL3A 4HO5A 1W57A 4CVHA 3I0HA 5E3RA 2WEEA 3I0CA 3EG4A 2Y7AA 3I0KA 2WVLA 4HOCA 1H7HA 5C1GA 5U2KA 1YP2A 3PKQA 1L0SA 4KPZA 4EE5A 3R5DA 4YS8A 2NXVA 4IRPA 3RMWA 3DHOA 1KK4A 2DPWA 4AA7A 4EABA 1LL0A 5C38A 3R3IA 1WT2A 1Z2FA 1I52A 2RITA 2VSIA 3BFPA 1INIA 2ICXA 2FYAA 4MFGA 3V0NA 1IIMA 3SXBA 1V3WA 2YC5A 4FRDA 1ZI5A 3TK8A 2BO4A 4B4MA 1HJLA 3N9WA 3V4EA 5FUHA 4B4GA 4EEOA 1SS9A 3NZ2A 2PGYA 1ZJOA 2AM4A 4M99A 2FYBA 4MNDA 3SX7A 1QRLA 1Z90A 3BSSA 3P47A 1H5TB 2RJ4A 2ZU8A 1S4PA 3PKPA 3TZTA 1TW1A 1OQMB 2RIJA 3CJ8A 3MC4A 1ZHJA 1G93A 1LL3A 4EGGA 2JCLA 3R5CA 1TVYA 1TW5A 2V0LA 1KGQA 5AFUV 1JVDA 3K8EA 1G3LA 4HO8A 4ASYA 4HZDA 2RIXA 1H7QA 2J0BA 2QH5A 4JISA 4CJCA 3GQ8A 4EVWA 1MP4A 5ADXV 2ZU7A 2V0IA 2WE9A 1GWWA 4P00A 2E3DA 3ZLKA 4AC3A 3OKRA 1ZDGA 3IOIA 1H7GA 1R81A 1NF5B 4ISXA 1KGTA 2AGDA 3VBLA 5C48A 5F42A 2X60A 1ON6A 1WT3A 1SSTA 4IHHA 3OAMA 1S80A 2WLEA 3PMOA 3SPTA 1E5KA 1R80A 2FFVA 2UX8A 2YQHA 4MZUA 4NAKA 3T7OA 2AM5A 3ZGGA 1QREA 1INJA 1MP5A 2RJ6A 1V83A 4KC1A 2V0HA 5AJPA 5D92A 4KNRA 1FO9A 3Q80A 3IOJA 2RIYA 4LW3A 5EJZA 1KK6A 4HO6A 1MP3A 3U0YA 3TDTA 2FKOA 3VNPA 3SX3A 3SRTA 1H5TA 4AAWA 1V84A 1NQIB 1LZJA 2QGIA 3D8VA 1OMXA 3R3RA 1QGQA 2XMHA 2YCMA 5CQMX 2OI7A 3R0SA 5C4DA 1KHRA 2OI6A 4B5BA 1YROB 3I0JA 3VBMA 4G87A 3OU9A 5FU0A 3U2XA 1N4IA 3R5BA 3GOSA 1EYRA 4M28A 1FZWA 1XZ6A 3D98A 3I0DA 4N6AA 1H5SB 4B2XA 2YQJA 4E75A 1G2VA 5C3AA 4IRQA 4R7PA 1G8OA 1GQCA 2MZBA 4Q7CA 4FRMA 3IGJA 2WLGA 3O3PA 4CJBA 1JYKA 5C1HA 2V0KA 3ECTA 3CKNA 3BXYA 1WT1A 2Z87A 3D5NA 1NKHB 5EJ1A 3EEVA 3CKJA 4E6UA 3LW6A 5HS2A 2VHEA 5DDVA 4DECA 4ZDQA 2FYDB 1HM0A 4IHGA 4EA9A 1R7TA 2RJ8A 3GVDA 3I0EA 3ZGFA 4KPXA 3QVBA 5FTSA 4BMAA 2CU2A 1ZJ3A 3R5AA 5IFYA 3V0PA 3RSBA 1SSQA 5FTVA 5FYEA 3K8DA 5DG3A 3CGXA 2JCKA 1H4DA 1ZCUA 5D91A 1LL2A 3FSBA 4BQHA 2JF3A 3FWWA 4B42A 1FGGA 5C49A 2XWNA 4HO2A 5AFUU 3JTJA 5C4CA 4KT7A 2YESA 2A8UA 4O6NA 1VH3A 2XATA 4G3SA 1FGXA 2WVMA 2IC7A 4J18A 4EA8A 1H7TA 5C36A 1H3MA 5ADXU 1H4EA 4B3UA 2AM3A 3V0MA 4C2SA 3OH4A 4FROA 3V0LA 2D0JA 1H5SA 1QG8A 4AYJA 1KWSA 1ZJ1A 5CQNX 2NPOA 3TQDA 3CKVA 2PGVA 2X65A 4EAAA 1HM8A 2FFUA 2JCJA 2Z86A 3KWEA 2OI5A 3MQHA 2AESA 4DCLA 2Y4KA 3ZLLA 3C8VA 5E3QA 3VBIA 1V82A 1VZUA 1EZIA 3BCVA 2IU8A 1R7VA 4E79A 3TWDA 2YQSA 4KC2A 1LVWA 4D0ZA 4KNXA 2P72A 4FQWA 1R7YA 3KWCA 3VBJA 2QKXA 2OEGA 4B2WA 3VBNA 4Y7FA 2WAWA 4KC4A 4D11C 4MIXA 2GGOA 1WSZA 2E8BA 5IDTA 3IOHA 1FWYA 3BSWA 1JVGA 3U2TA 1VGWA 3HJJA 3DJ4A 1W55A 1HV9A 2I5KA 3SXAA 4KQLA 3I0GA 4D11A 3Q7UA 1W77A 2BO7A 1ZJ2A 3JUKA 3EH0A 3EE5A 2VS4A 5DDTA 1ZJ0A 3T57A 4MYOA 4G3PA 3KIAA 1MR9A 3JUJA 4HZCA 4G3QA 1KRUA 4EEGA 3IXCA 3NGWA 3FTTA 1EWWA 2BO8A 1O7OA 1FXOA 3P1BA 4NANA 2ZU9A 4N69A 1ZJPA 2O1GA 3U0XA 4B4BA 4CJ8A 4ECMA 1GA8A 1K4VA 3F1YA 4FRBA 3SUCA 3RMVA 2WGZA 1H7EA 1GX0A 2AE7A 1MR7A 3I0LA 1OCXA 1FOAA 4H7OA 3JQYA 3OTZA 4O6MA 2O1FA 3GQAA 2VK9A 3F1XA 1H7FA 3GUEA 1VICA 3CKQA 4AYLA 2Y4JA 4K6RA 4LW6A 1VGTA 2I7BA 2APCA 4E1KA 3V0QA 1HJJA 2P2OA 4M2BA 3FSXA 5FV9A 4E6TA 2WLCA 1WT0A 4NALA 2VS5A 4M98A 2Y6PA 2AECA 3I0IX 1XHDA 3V0OA 3Q4SA 5CMFX 3I0FA 2J0AA 1G0RA 1GQ9A 4HO4A 2RJ9A 1KRVA 1FXJA 4FCEA 4M9CA 4Y7UA 1IINA 3GQ9A 2RJ0A 3SX8A 3U2VA 2XWMA 2AQ9A 4N27A 1JV1A 2X5SA 3CKOA 3E25A 3I3AA 4Y9XA 5C4BA 4FRAA 2QIAA 1J2ZA 5JQQA 1JYLA 1PZTA 4D48A 1VGZA 3KWDA 4EE4A 1ZDFA 3USRA 5C1LA 1GWVA 2RIZA 5CQOA 3TISA 1VM8A 4N6BA 1O23B 2XMEA 4R36A 2RJ7A 3I3XA 2FYCB 1M8NA 2RJ5A 4Y62A 2OEFA 1QQ0A 1WVCA 4Y7GA 4L41C 2Q4JA 5C8RA 4HURA 3Q1XA 1THJA 5CMGX 3VBPA 3MQGA 4D0TA 5AJOA 1V67A 4FRLA 3FOQA 1VZTA 3FS8A 4DE7A 1FRWA 1QRMA 4KXOA 1H5SC 1VH1A 3T7MA 4EE3A 2C0NA 2YC3A 3OH2A 5CQLX 1LZ7A 2FY7A 1SSMA 3U2WA 1G95A 3DUVA 1H5SD 3OW5A 5CQPA 1KK5A 1ZIZA 2W0VA 2QIVX 5FU8A 2PX7A 4FRPA 1KRRA 1MC3A 2VXLA 3ZF8A 2P6WA 4EQYA 4Y64A 3SXCA 1VPAA 4ARWA 1LXAA 2O1HA 2IU9A 3V8ZA 1PZYB 4J09A 3V8YA 4R37A 1ZCVA 5CMIA 3R2WA 3TIOA 1H5RB 4EEMA 3U2UA 4HG6A 3BRKX 2VXMA 3E26A 1R82A 3CU0A 1VZXA 2X5ZA 2GGQA 4UEGA 2Y4LA 4Y6NA 3OH0A 3OC9A 4HO9A 1TDTA 1XHBA 2W0WA 1JV3A 5C4EA 1R7XA 2VSHA 2P73A 2IUAA 2AH9A 4HO0A 4Y63A 2VFZA 1R7UA 3SXDA 5DEMA 4JD0A 1YP3A 4HCQA 3PNNA 3FSYA 1FO8A 4Y6UA 1KQAA 1VGUA 1NWGB 3F1CA 4EA7A 1HM9A 3DK5A 2WVKA 1QRGA 1LZ0A 1OMZA 2JCOA 3VBKA 4NAIA 3POLA 5IDSA 5L6SA 1FR8A 2PA4A 5CMHA 5I1FA 3HSQA 3BSYA 3OUPA 2Y4MA
chains in the Genus database with same CATH topology
3R1WA 4P02A 4FRQA 5EIYA 4EEAA 3OH3A 2D7RA 1FG5N 1G23A 2JF2A 2V0JA 1NHEB 5BXCA 5J49A 1ZI3A 2ICYA 3OTMA 4M4KA 4DDZA 1O0RA 5C3DA 5E3PA 1ON8A 1S4OA 1T3DA 1ZCYA 5C3BA 1G9RA 3ST8A 4XWIA 3TV0A 1H7LA 5C4FA 1ZI1A 3SXEA 1MRLA 1NMMB 2RJ1A 2D7IA 4Y7TA 1QRFA 4ASJA 1FR9A 3FSCA 2WLFA 4MYBA 1GX4A 3OGZA 4FIXA 1G1LA 4GBPA 2WLDA 5C47A 1H5RA 1QGSA 2TDTA 4HO3A 1TZFA 3V91A 3USQA 4M2AA 1S4NA 1ZCTA 4Y7VA 3SX5A 2VD4A 4FIYA 3T7NA 2A8WA 4FREA 1XATA 5L6VA 1QWJA 1ZI4A 4KRVA 3SXGA 3V90A 1YP4A 5CMJA 3R8YA 4FRHA 1O7QA 2XWLA 3OH1A 1H4CA 4FCUA 4HUSA 4IHFA 5AJNA 2VS3A 5DEPA 1G97A 2YQCA 2BO6A 1LZIA 2I5EA 3HL3A 4HO5A 1W57A 4CVHA 3I0HA 5E3RA 2WEEA 3I0CA 3EG4A 2Y7AA 3I0KA 2WVLA 4HOCA 1H7HA 5C1GA 5U2KA 1YP2A 3PKQA 4KPZA 4EE5A 3R5DA 4YS8A 2NXVA 4IRPA 3RMWA 3DHOA 1KK4A 2DPWA 4AA7A 4EABA 1LL0A 5C38A 3R3IA 1WT2A 1I52A 2RITA 2VSIA 3BFPA 1INIA 2ICXA 2FYAA 4MFGA 3V0NA 1IIMA 3SXBA 1V3WA 2YC5A 4FRDA 1ZI5A 3TK8A 2BO4A 4B4MA 1HJLA 3N9WA 3V4EA 5FUHA 4B4GA 4EEOA 1SS9A 3NZ2A 2PGYA 1ZJOA 2AM4A 4M99A 2FYBA 4MNDA 3SX7A 1QRLA 1Z90A 3BSSA 3P47A 1H5TB 2RJ4A 2ZU8A 1S4PA 3PKPA 3TZTA 1TW1A 1OQMB 2RIJA 3CJ8A 3MC4A 1ZHJA 1G93A 1LL3A 4EGGA 2JCLA 3R5CA 1TVYA 1TW5A 2V0LA 1KGQA 5AFUV 1JVDA 3K8EA 1G3LA 4HO8A 4ASYA 4HZDA 2RIXA 1H7QA 2J0BA 2QH5A 4JISA 4CJCA 4EVWA 1MP4A 5ADXV 2ZU7A 2V0IA 2WE9A 1GWWA 4P00A 2E3DA 3ZLKA 4AC3A 3OKRA 1ZDGA 3IOIA 1H7GA 1R81A 1NF5B 4ISXA 1KGTA 2AGDA 3VBLA 5C48A 5F42A 2X60A 1ON6A 1WT3A 1SSTA 4IHHA 3OAMA 1S80A 2WLEA 3PMOA 3SPTA 1E5KA 1R80A 2FFVA 2UX8A 2YQHA 4MZUA 4NAKA 3T7OA 2AM5A 3ZGGA 1QREA 1INJA 1MP5A 2RJ6A 1V83A 4KC1A 2V0HA 5AJPA 5D92A 4KNRA 1FO9A 3Q80A 3IOJA 2RIYA 4LW3A 5EJZA 1KK6A 4HO6A 1MP3A 3U0YA 3TDTA 2FKOA 3VNPA 3SX3A 3SRTA 1H5TA 4AAWA 1V84A 1NQIB 1LZJA 2QGIA 3D8VA 1OMXA 3R3RA 1QGQA 2XMHA 2YCMA 5CQMX 2OI7A 3R0SA 5C4DA 1KHRA 2OI6A 4B5BA 1YROB 3I0JA 3VBMA 4G87A 3OU9A 5FU0A 3U2XA 3R5BA 3GOSA 1EYRA 4M28A 1FZWA 1XZ6A 3D98A 3I0DA 4N6AA 1H5SB 4B2XA 2YQJA 4E75A 1G2VA 5C3AA 4IRQA 4R7PA 1G8OA 1GQCA 2MZBA 4Q7CA 4FRMA 3IGJA 2WLGA 3O3PA 4CJBA 1JYKA 5C1HA 2V0KA 3ECTA 3CKNA 3BXYA 1WT1A 2Z87A 3D5NA 1NKHB 5EJ1A 3EEVA 3CKJA 4E6UA 3LW6A 5HS2A 2VHEA 5DDVA 4DECA 4ZDQA 2FYDB 1HM0A 4IHGA 4EA9A 1R7TA 2RJ8A 3GVDA 3I0EA 3ZGFA 4KPXA 3QVBA 5FTSA 4BMAA 2CU2A 1ZJ3A 3R5AA 5IFYA 3V0PA 3RSBA 1SSQA 5FTVA 5FYEA 3K8DA 5DG3A 3CGXA 2JCKA 1H4DA 1ZCUA 5D91A 1LL2A 3FSBA 4BQHA 2JF3A 3FWWA 4B42A 1FGGA 5C49A 2XWNA 4HO2A 5AFUU 3JTJA 5C4CA 4KT7A 2YESA 2A8UA 4O6NA 1VH3A 2XATA 4G3SA 1FGXA 2WVMA 2IC7A 4J18A 4EA8A 1H7TA 5C36A 1H3MA 5ADXU 1H4EA 4B3UA 2AM3A 3V0MA 4C2SA 3OH4A 4FROA 3V0LA 2D0JA 1H5SA 1QG8A 4AYJA 1KWSA 1ZJ1A 5CQNX 2NPOA 3TQDA 3CKVA 2PGVA 2X65A 4EAAA 1HM8A 2FFUA 2JCJA 2Z86A 3KWEA 2OI5A 3MQHA 2AESA 4DCLA 2Y4KA 3ZLLA 3C8VA 5E3QA 3VBIA 1V82A 1VZUA 1EZIA 3BCVA 2IU8A 1R7VA 4E79A 3TWDA 2YQSA 4KC2A 1LVWA 4D0ZA 4KNXA 2P72A 4FQWA 1R7YA 3KWCA 3VBJA 2QKXA 2OEGA 4B2WA 3VBNA 4Y7FA 2WAWA 4KC4A 4D11C 4MIXA 2GGOA 1WSZA 2E8BA 5IDTA 3IOHA 1FWYA 3BSWA 1JVGA 3U2TA 1VGWA 3HJJA 3DJ4A 1W55A 1HV9A 2I5KA 3SXAA 4KQLA 3I0GA 4D11A 3Q7UA 1W77A 2BO7A 1ZJ2A 3JUKA 3EH0A 3EE5A 2VS4A 5DDTA 1ZJ0A 3T57A 4MYOA 4G3PA 3KIAA 1MR9A 3JUJA 4HZCA 4G3QA 1KRUA 4EEGA 3IXCA 3NGWA 3FTTA 2BO8A 1O7OA 1FXOA 3P1BA 4NANA 2ZU9A 4N69A 1ZJPA 2O1GA 3U0XA 4B4BA 4CJ8A 4ECMA 1GA8A 1K4VA 3F1YA 4FRBA 3RMVA 2WGZA 1H7EA 1GX0A 2AE7A 1MR7A 3I0LA 1OCXA 1FOAA 4H7OA 3JQYA 3OTZA 4O6MA 2O1FA 2VK9A 3F1XA 1H7FA 3GUEA 1VICA 3CKQA 4AYLA 2Y4JA 4K6RA 4LW6A 1VGTA 2I7BA 2APCA 4E1KA 3V0QA 1HJJA 2P2OA 4M2BA 3FSXA 5FV9A 4E6TA 2WLCA 1WT0A 4NALA 2VS5A 4M98A 2Y6PA 2AECA 3I0IX 1XHDA 3V0OA 3Q4SA 5CMFX 3I0FA 2J0AA 1G0RA 1GQ9A 4HO4A 2RJ9A 1KRVA 1FXJA 4FCEA 4M9CA 4Y7UA 1IINA 2RJ0A 3SX8A 3U2VA 2XWMA 2AQ9A 4N27A 1JV1A 2X5SA 3CKOA 3E25A 3I3AA 4Y9XA 5C4BA 4FRAA 2QIAA 1J2ZA 5JQQA 1JYLA 1PZTA 4D48A 1VGZA 3KWDA 4EE4A 1ZDFA 3USRA 5C1LA 1GWVA 2RIZA 5CQOA 3TISA 1VM8A 4N6BA 1O23B 2XMEA 4R36A 2RJ7A 3I3XA 2FYCB 2RJ5A 4Y62A 2OEFA 1QQ0A 1WVCA 4Y7GA 4L41C 2Q4JA 5C8RA 4HURA 3Q1XA 1THJA 5CMGX 3VBPA 3MQGA 4D0TA 5AJOA 1V67A 4FRLA 3FOQA 1VZTA 3FS8A 4DE7A 1FRWA 1QRMA 4KXOA 1H5SC 1VH1A 3T7MA 4EE3A 2C0NA 2YC3A 3OH2A 5CQLX 1LZ7A 2FY7A 1SSMA 3U2WA 1G95A 3DUVA 1H5SD 3OW5A 5CQPA 1KK5A 1ZIZA 2W0VA 2QIVX 5FU8A 2PX7A 4FRPA 1KRRA 1MC3A 2VXLA 3ZF8A 2P6WA 4EQYA 4Y64A 3SXCA 1VPAA 4ARWA 1LXAA 2O1HA 2IU9A 3V8ZA 1PZYB 4J09A 3V8YA 4R37A 1ZCVA 5CMIA 3R2WA 3TIOA 1H5RB 4EEMA 3U2UA 4HG6A 3BRKX 2VXMA 3E26A 1R82A 3CU0A 1VZXA 2X5ZA 2GGQA 4UEGA 2Y4LA 4Y6NA 3OH0A 3OC9A 4HO9A 1TDTA 1XHBA 2W0WA 1JV3A 5C4EA 1R7XA 2VSHA 2P73A 2IUAA 2AH9A 4HO0A 4Y63A 2VFZA 1R7UA 3SXDA 5DEMA 4JD0A 1YP3A 4HCQA 3PNNA 3FSYA 1FO8A 4Y6UA 1KQAA 1VGUA 1NWGB 3F1CA 4EA7A 1HM9A 3DK5A 2WVKA 1QRGA 1LZ0A 1OMZA 2JCOA 3VBKA 4NAIA 3POLA 5IDSA 5L6SA 1FR8A 2PA4A 5CMHA 5I1FA 3HSQA 3BSYA 3OUPA 2Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1W A;  4P02 A;  4FRQ A;  5EIY A;  4EEA A;  3OH3 A;  2D7R A;  1FG5 N;  1G23 A;  2JF2 A;  2V0J A;  1NHE B;  5BXC A;  5J49 A;  1ZI3 A;  2ICY A;  3OTM A;  4M4K A;  4DDZ A;  1O0R A;  5C3D A;  5E3P A;  1ON8 A;  1S4O A;  1T3D A;  1ZCY A;  5C3B A;  1G9R A;  3ST8 A;  4XWI A;  3TV0 A;  1H7L A;  5C4F A;  1ZI1 A;  3SXE A;  1MRL A;  1NMM B;  2RJ1 A;  2D7I A;  4Y7T A;  1QRF A;  4ASJ A;  1FR9 A;  3FSC A;  2WLF A;  4MYB A;  1GX4 A;  3OGZ A;  1G1L A;  4GBP A;  2WLD A;  5C47 A;  1H5R A;  1QGS A;  2TDT A;  4HO3 A;  1TZF A;  3V91 A;  3USQ A;  4M2A A;  1S4N A;  1ZCT A;  4Y7V A;  3SX5 A;  2VD4 A;  3T7N A;  2A8W A;  4FRE A;  1XAT A;  5L6V A;  1QWJ A;  1ZI4 A;  4KRV A;  3SXG A;  3V90 A;  1YP4 A;  5CMJ A;  3R8Y A;  4FRH A;  1O7Q A;  2XWL A;  3OH1 A;  1H4C A;  4FCU A;  4HUS A;  4IHF A;  5AJN A;  2VS3 A;  5DEP A;  1G97 A;  2YQC A;  2BO6 A;  1LZI A;  2I5E A;  3HL3 A;  4HO5 A;  1W57 A;  4CVH A;  3I0H A;  5E3R A;  2WEE A;  3I0C A;  3EG4 A;  2Y7A A;  3I0K A;  2WVL A;  4HOC A;  1H7H A;  5C1G A;  5U2K A;  1YP2 A;  3PKQ A;  4KPZ A;  4EE5 A;  3R5D A;  4YS8 A;  2NXV A;  4IRP A;  3RMW A;  3DHO A;  1KK4 A;  2DPW A;  4AA7 A;  4EAB A;  1LL0 A;  5C38 A;  3R3I A;  1WT2 A;  1I52 A;  2RIT A;  2VSI A;  3BFP A;  1INI A;  2ICX A;  2FYA A;  4MFG A;  3V0N A;  1IIM A;  3SXB A;  1V3W A;  2YC5 A;  4FRD A;  1ZI5 A;  3TK8 A;  2BO4 A;  4B4M A;  1HJL A;  3N9W A;  3V4E A;  5FUH A;  4B4G A;  4EEO A;  1SS9 A;  3NZ2 A;  2PGY A;  1ZJO A;  2AM4 A;  4M99 A;  2FYB A;  4MND A;  3SX7 A;  1QRL A;  1Z90 A;  3BSS A;  3P47 A;  1H5T B;  2RJ4 A;  2ZU8 A;  1S4P A;  3PKP A;  3TZT A;  1TW1 A;  1OQM B;  2RIJ A;  3CJ8 A;  3MC4 A;  1ZHJ A;  1G93 A;  1LL3 A;  4EGG A;  2JCL A;  3R5C A;  1TVY A;  1TW5 A;  2V0L A;  1KGQ A;  5AFU V;  1JVD A;  3K8E A;  1G3L A;  4HO8 A;  4ASY A;  4HZD A;  2RIX A;  1H7Q A;  2QH5 A;  4JIS A;  4CJC A;  4EVW A;  1MP4 A;  5ADX V;  2ZU7 A;  2V0I A;  2WE9 A;  1GWW A;  4P00 A;  2E3D A;  3ZLK A;  4AC3 A;  3OKR A;  1ZDG A;  3IOI A;  1H7G A;  1R81 A;  1NF5 B;  4ISX A;  1KGT A;  2AGD A;  3VBL A;  5C48 A;  5F42 A;  2X60 A;  1ON6 A;  1WT3 A;  1SST A;  4IHH A;  3OAM A;  1S80 A;  2WLE A;  3PMO A;  3SPT A;  1E5K A;  1R80 A;  2FFV A;  2UX8 A;  2YQH A;  4MZU A;  4NAK A;  3T7O A;  2AM5 A;  3ZGG A;  1QRE A;  1INJ A;  1MP5 A;  2RJ6 A;  1V83 A;  4KC1 A;  2V0H A;  5AJP A;  4KNR A;  1FO9 A;  3Q80 A;  3IOJ A;  2RIY A;  4LW3 A;  5EJZ A;  1KK6 A;  4HO6 A;  1MP3 A;  3U0Y A;  3TDT A;  2FKO A;  3VNP A;  3SX3 A;  3SRT A;  1H5T A;  4AAW A;  1V84 A;  1NQI B;  1LZJ A;  2QGI A;  3D8V A;  1OMX A;  3R3R A;  1QGQ A;  2XMH A;  2YCM A;  5CQM X;  2OI7 A;  3R0S A;  5C4D A;  1KHR A;  2OI6 A;  4B5B A;  1YRO B;  3I0J A;  3VBM A;  4G87 A;  3OU9 A;  5FU0 A;  3U2X A;  3R5B A;  3GOS A;  1EYR A;  4M28 A;  1FZW A;  1XZ6 A;  3D98 A;  3I0D A;  4N6A A;  1H5S B;  4B2X A;  2YQJ A;  4E75 A;  1G2V A;  5C3A A;  4IRQ A;  4R7P A;  1G8O A;  1GQC A;  2MZB A;  4FRM A;  3IGJ A;  2WLG A;  3O3P A;  4CJB A;  1JYK A;  5C1H A;  2V0K A;  3ECT A;  3CKN A;  3BXY A;  1WT1 A;  2Z87 A;  3D5N A;  1NKH B;  5EJ1 A;  3EEV A;  3CKJ A;  4E6U A;  3LW6 A;  5HS2 A;  2VHE A;  5DDV A;  4DEC A;  4ZDQ A;  2FYD B;  1HM0 A;  4IHG A;  4EA9 A;  1R7T A;  2RJ8 A;  3GVD A;  3I0E A;  3ZGF A;  4KPX A;  3QVB A;  5FTS A;  4BMA A;  2CU2 A;  1ZJ3 A;  3R5A A;  5IFY A;  3V0P A;  3RSB A;  1SSQ A;  5FTV A;  5FYE A;  3K8D A;  5DG3 A;  3CGX A;  2JCK A;  1H4D A;  1ZCU A;  1LL2 A;  3FSB A;  4BQH A;  2JF3 A;  3FWW A;  4B42 A;  1FGG A;  5C49 A;  2XWN A;  4HO2 A;  5AFU U;  3JTJ A;  5C4C A;  4KT7 A;  2YES A;  2A8U A;  1VH3 A;  2XAT A;  4G3S A;  1FGX A;  2WVM A;  2IC7 A;  4J18 A;  4EA8 A;  1H7T A;  5C36 A;  1H3M A;  5ADX U;  1H4E A;  4B3U A;  2AM3 A;  3V0M A;  4C2S A;  3OH4 A;  4FRO A;  3V0L A;  2D0J A;  1H5S A;  1QG8 A;  4AYJ A;  1KWS A;  1ZJ1 A;  5CQN X;  2NPO A;  3TQD A;  3CKV A;  2PGV A;  2X65 A;  4EAA A;  1HM8 A;  2FFU A;  2JCJ A;  2Z86 A;  3KWE A;  2OI5 A;  3MQH A;  2AES A;  4DCL A;  2Y4K A;  3ZLL A;  3C8V A;  5E3Q A;  3VBI A;  1V82 A;  1VZU A;  1EZI A;  3BCV A;  2IU8 A;  1R7V A;  4E79 A;  3TWD A;  2YQS A;  4KC2 A;  1LVW A;  4D0Z A;  4KNX A;  2P72 A;  4FQW A;  1R7Y A;  3KWC A;  3VBJ A;  2QKX A;  2OEG A;  4B2W A;  3VBN A;  4Y7F A;  2WAW A;  4KC4 A;  4D11 C;  2GGO A;  1WSZ A;  2E8B A;  5IDT A;  3IOH A;  1FWY A;  3BSW A;  1JVG A;  3U2T A;  1VGW A;  3HJJ A;  3DJ4 A;  1W55 A;  1HV9 A;  2I5K A;  3SXA A;  4KQL A;  3I0G A;  4D11 A;  3Q7U A;  1W77 A;  2BO7 A;  1ZJ2 A;  3JUK A;  3EH0 A;  3EE5 A;  2VS4 A;  5DDT A;  1ZJ0 A;  3T57 A;  4MYO A;  4G3P A;  3KIA A;  1MR9 A;  3JUJ A;  4HZC A;  4G3Q A;  1KRU A;  4EEG A;  3IXC A;  3NGW A;  3FTT A;  2BO8 A;  1O7O A;  1FXO A;  3P1B A;  4NAN A;  2ZU9 A;  4N69 A;  1ZJP A;  2O1G A;  3U0X A;  4B4B A;  4CJ8 A;  4ECM A;  1GA8 A;  1K4V A;  3F1Y A;  4FRB A;  3RMV A;  2WGZ A;  1H7E A;  1GX0 A;  2AE7 A;  1MR7 A;  3I0L A;  1OCX A;  1FOA A;  4H7O A;  3JQY A;  3OTZ A;  2O1F A;  3F1X A;  1H7F A;  3GUE A;  1VIC A;  3CKQ A;  4AYL A;  2Y4J A;  4K6R A;  4LW6 A;  1VGT A;  2I7B A;  2APC A;  4E1K A;  3V0Q A;  1HJJ A;  2P2O A;  4M2B A;  3FSX A;  5FV9 A;  4E6T A;  2WLC A;  1WT0 A;  4NAL A;  2VS5 A;  4M98 A;  2Y6P A;  2AEC A;  3I0I X;  1XHD A;  3V0O A;  3Q4S A;  5CMF X;  3I0F A;  1G0R A;  1GQ9 A;  4HO4 A;  2RJ9 A;  1KRV A;  1FXJ A;  4FCE A;  4M9C A;  4Y7U A;  1IIN A;  2RJ0 A;  3SX8 A;  3U2V A;  2XWM A;  2AQ9 A;  4N27 A;  1JV1 A;  2X5S A;  3CKO A;  3E25 A;  3I3A A;  4Y9X A;  5C4B A;  4FRA A;  2QIA A;  1J2Z A;  5JQQ A;  1JYL A;  1PZT A;  4D48 A;  1VGZ A;  3KWD A;  4EE4 A;  1ZDF A;  3USR A;  5C1L A;  1GWV A;  2RIZ A;  5CQO A;  3TIS A;  1VM8 A;  4N6B A;  1O23 B;  2XME A;  4R36 A;  2RJ7 A;  3I3X A;  2FYC B;  2RJ5 A;  4Y62 A;  2OEF A;  1QQ0 A;  1WVC A;  4Y7G A;  4L41 C;  2Q4J A;  5C8R A;  4HUR A;  3Q1X A;  1THJ A;  5CMG X;  3VBP A;  3MQG A;  4D0T A;  5AJO A;  1V67 A;  4FRL A;  3FOQ A;  1VZT A;  3FS8 A;  4DE7 A;  1FRW A;  1QRM A;  4KXO A;  1H5S C;  1VH1 A;  3T7M A;  4EE3 A;  2YC3 A;  3OH2 A;  5CQL X;  1LZ7 A;  2FY7 A;  1SSM A;  3U2W A;  1G95 A;  3DUV A;  1H5S D;  3OW5 A;  5CQP A;  1KK5 A;  1ZIZ A;  2W0V A;  2QIV X;  5FU8 A;  2PX7 A;  4FRP A;  1KRR A;  1MC3 A;  2VXL A;  3ZF8 A;  2P6W A;  4EQY A;  4Y64 A;  3SXC A;  1VPA A;  4ARW A;  1LXA A;  2O1H A;  2IU9 A;  3V8Z A;  1PZY B;  4J09 A;  3V8Y A;  4R37 A;  1ZCV A;  5CMI A;  3R2W A;  3TIO A;  1H5R B;  4EEM A;  3U2U A;  4HG6 A;  3BRK X;  2VXM A;  3E26 A;  1R82 A;  3CU0 A;  1VZX A;  2X5Z A;  2GGQ A;  4UEG A;  2Y4L A;  4Y6N A;  3OH0 A;  3OC9 A;  4HO9 A;  1TDT A;  1XHB A;  2W0W A;  1JV3 A;  5C4E A;  1R7X A;  2VSH A;  2P73 A;  2IUA A;  2AH9 A;  4HO0 A;  4Y63 A;  2VFZ A;  1R7U A;  3SXD A;  5DEM A;  4JD0 A;  1YP3 A;  4HCQ A;  3PNN A;  3FSY A;  1FO8 A;  4Y6U A;  1KQA A;  1VGU A;  1NWG B;  3F1C A;  4EA7 A;  1HM9 A;  3DK5 A;  2WVK A;  1QRG A;  1LZ0 A;  1OMZ A;  2JCO A;  3VBK A;  4NAI A;  3POL A;  5IDS A;  5L6S A;  1FR8 A;  2PA4 A;  5CMH A;  5I1F A;  3HSQ A;  3BSY A;  3OUP A;  2Y4M A; 
#chains in the Genus database with same CATH topology
 3R1W A;  4P02 A;  4FRQ A;  5EIY A;  4EEA A;  3OH3 A;  2D7R A;  1FG5 N;  1G23 A;  2JF2 A;  2V0J A;  3GQ7 A;  1NHE B;  5BXC A;  5J49 A;  1ZI3 A;  2ICY A;  3OTM A;  4M4K A;  4DDZ A;  1O0R A;  5C3D A;  5E3P A;  1ON8 A;  1S4O A;  1T3D A;  1ZCY A;  5C3B A;  1G9R A;  3ST8 A;  4XWI A;  3TV0 A;  1H7L A;  5C4F A;  1ZI1 A;  3SXE A;  1MRL A;  1NMM B;  2RJ1 A;  2D7I A;  4Y7T A;  1QRF A;  4ASJ A;  1FR9 A;  3FSC A;  2WLF A;  4MYB A;  3OGZ A;  1GX4 A;  4FIX A;  1G1L A;  4GBP A;  2WLD A;  5C47 A;  1H5R A;  1QGS A;  2TDT A;  4HO3 A;  1TZF A;  3V91 A;  3USQ A;  4M2A A;  1S4N A;  1ZCT A;  4Y7V A;  3SX5 A;  2VD4 A;  4FIY A;  3T7N A;  2A8W A;  4FRE A;  1XAT A;  5L6V A;  1QWJ A;  1ZI4 A;  4KRV A;  3SXG A;  3V90 A;  1YP4 A;  5CMJ A;  3R8Y A;  4FRH A;  1O7Q A;  2XWL A;  3OH1 A;  1H4C A;  4FCU A;  4HUS A;  4IHF A;  5AJN A;  2VS3 A;  5DEP A;  1G97 A;  2YQC A;  2BO6 A;  1LZI A;  2I5E A;  3HL3 A;  4HO5 A;  1W57 A;  4CVH A;  3I0H A;  5E3R A;  2WEE A;  3I0C A;  3EG4 A;  2Y7A A;  3I0K A;  2WVL A;  4HOC A;  1H7H A;  5C1G A;  5U2K A;  1YP2 A;  3PKQ A;  1L0S A;  4KPZ A;  4EE5 A;  3R5D A;  4YS8 A;  2NXV A;  4IRP A;  3RMW A;  3DHO A;  1KK4 A;  2DPW A;  4AA7 A;  4EAB A;  1LL0 A;  5C38 A;  3R3I A;  1WT2 A;  1Z2F A;  1I52 A;  2RIT A;  2VSI A;  3BFP A;  1INI A;  2ICX A;  2FYA A;  4MFG A;  3V0N A;  1IIM A;  3SXB A;  1V3W A;  2YC5 A;  4FRD A;  1ZI5 A;  3TK8 A;  2BO4 A;  4B4M A;  1HJL A;  3N9W A;  3V4E A;  5FUH A;  4B4G A;  4EEO A;  1SS9 A;  3NZ2 A;  2PGY A;  1ZJO A;  2AM4 A;  4M99 A;  2FYB A;  4MND A;  3SX7 A;  1QRL A;  1Z90 A;  3BSS A;  3P47 A;  1H5T B;  2RJ4 A;  2ZU8 A;  1S4P A;  3PKP A;  3TZT A;  1TW1 A;  1OQM B;  2RIJ A;  3CJ8 A;  3MC4 A;  1ZHJ A;  1G93 A;  1LL3 A;  4EGG A;  2JCL A;  3R5C A;  1TVY A;  1TW5 A;  2V0L A;  1KGQ A;  5AFU V;  1JVD A;  3K8E A;  1G3L A;  4HO8 A;  4ASY A;  4HZD A;  2RIX A;  1H7Q A;  2J0B A;  2QH5 A;  4JIS A;  4CJC A;  3GQ8 A;  4EVW A;  1MP4 A;  5ADX V;  2ZU7 A;  2V0I A;  2WE9 A;  1GWW A;  4P00 A;  2E3D A;  3ZLK A;  4AC3 A;  3OKR A;  1ZDG A;  3IOI A;  1H7G A;  1R81 A;  1NF5 B;  4ISX A;  1KGT A;  2AGD A;  3VBL A;  5C48 A;  5F42 A;  2X60 A;  1ON6 A;  1WT3 A;  1SST A;  4IHH A;  3OAM A;  1S80 A;  2WLE A;  3PMO A;  3SPT A;  1E5K A;  1R80 A;  2FFV A;  2UX8 A;  2YQH A;  4MZU A;  4NAK A;  3T7O A;  2AM5 A;  3ZGG A;  1QRE A;  1INJ A;  1MP5 A;  2RJ6 A;  1V83 A;  4KC1 A;  2V0H A;  5AJP A;  5D92 A;  4KNR A;  1FO9 A;  3Q80 A;  3IOJ A;  2RIY A;  4LW3 A;  5EJZ A;  1KK6 A;  4HO6 A;  1MP3 A;  3U0Y A;  3TDT A;  2FKO A;  3VNP A;  3SX3 A;  3SRT A;  1H5T A;  4AAW A;  1V84 A;  1NQI B;  1LZJ A;  2QGI A;  3D8V A;  1OMX A;  3R3R A;  1QGQ A;  2XMH A;  2YCM A;  5CQM X;  2OI7 A;  3R0S A;  5C4D A;  1KHR A;  2OI6 A;  4B5B A;  1YRO B;  3I0J A;  3VBM A;  4G87 A;  3OU9 A;  5FU0 A;  3U2X A;  1N4I A;  3R5B A;  3GOS A;  1EYR A;  4M28 A;  1FZW A;  1XZ6 A;  3D98 A;  3I0D A;  4N6A A;  1H5S B;  4B2X A;  2YQJ A;  4E75 A;  1G2V A;  5C3A A;  4IRQ A;  4R7P A;  1G8O A;  1GQC A;  2MZB A;  4Q7C A;  4FRM A;  3IGJ A;  2WLG A;  3O3P A;  4CJB A;  1JYK A;  5C1H A;  2V0K A;  3ECT A;  3CKN A;  3BXY A;  1WT1 A;  2Z87 A;  3D5N A;  1NKH B;  5EJ1 A;  3EEV A;  3CKJ A;  4E6U A;  3LW6 A;  5HS2 A;  2VHE A;  5DDV A;  4DEC A;  4ZDQ A;  2FYD B;  1HM0 A;  4IHG A;  4EA9 A;  1R7T A;  2RJ8 A;  3GVD A;  3I0E A;  3ZGF A;  4KPX A;  3QVB A;  5FTS A;  4BMA A;  2CU2 A;  1ZJ3 A;  3R5A A;  5IFY A;  3V0P A;  3RSB A;  1SSQ A;  5FTV A;  5FYE A;  3K8D A;  5DG3 A;  3CGX A;  2JCK A;  1H4D A;  1ZCU A;  5D91 A;  1LL2 A;  3FSB A;  4BQH A;  2JF3 A;  3FWW A;  4B42 A;  1FGG A;  5C49 A;  2XWN A;  4HO2 A;  5AFU U;  3JTJ A;  5C4C A;  4KT7 A;  2YES A;  2A8U A;  4O6N A;  1VH3 A;  2XAT A;  4G3S A;  1FGX A;  2WVM A;  2IC7 A;  4J18 A;  4EA8 A;  1H7T A;  5C36 A;  1H3M A;  5ADX U;  1H4E A;  4B3U A;  2AM3 A;  3V0M A;  4C2S A;  3OH4 A;  4FRO A;  3V0L A;  2D0J A;  1H5S A;  1QG8 A;  4AYJ A;  1KWS A;  1ZJ1 A;  5CQN X;  2NPO A;  3TQD A;  3CKV A;  2PGV A;  2X65 A;  4EAA A;  1HM8 A;  2FFU A;  2JCJ A;  2Z86 A;  3KWE A;  2OI5 A;  3MQH A;  2AES A;  4DCL A;  2Y4K A;  3ZLL A;  3C8V A;  5E3Q A;  3VBI A;  1V82 A;  1VZU A;  1EZI A;  3BCV A;  2IU8 A;  1R7V A;  4E79 A;  3TWD A;  2YQS A;  4KC2 A;  1LVW A;  4D0Z A;  4KNX A;  2P72 A;  4FQW A;  1R7Y A;  3KWC A;  3VBJ A;  2QKX A;  2OEG A;  4B2W A;  3VBN A;  4Y7F A;  2WAW A;  4KC4 A;  4D11 C;  4MIX A;  2GGO A;  1WSZ A;  2E8B A;  5IDT A;  3IOH A;  1FWY A;  3BSW A;  1JVG A;  3U2T A;  1VGW A;  3HJJ A;  3DJ4 A;  1W55 A;  1HV9 A;  2I5K A;  3SXA A;  4KQL A;  3I0G A;  4D11 A;  3Q7U A;  1W77 A;  2BO7 A;  1ZJ2 A;  3JUK A;  3EH0 A;  3EE5 A;  2VS4 A;  5DDT A;  1ZJ0 A;  3T57 A;  4MYO A;  4G3P A;  3KIA A;  1MR9 A;  3JUJ A;  4HZC A;  4G3Q A;  1KRU A;  4EEG A;  3IXC A;  3NGW A;  3FTT A;  1EWW A;  2BO8 A;  1O7O A;  1FXO A;  3P1B A;  4NAN A;  2ZU9 A;  4N69 A;  1ZJP A;  2O1G A;  3U0X A;  4B4B A;  4CJ8 A;  4ECM A;  1GA8 A;  1K4V A;  3F1Y A;  4FRB A;  3SUC A;  3RMV A;  2WGZ A;  1H7E A;  1GX0 A;  2AE7 A;  1MR7 A;  3I0L A;  1OCX A;  1FOA A;  4H7O A;  3JQY A;  3OTZ A;  4O6M A;  2O1F A;  3GQA A;  2VK9 A;  3F1X A;  1H7F A;  3GUE A;  1VIC A;  3CKQ A;  4AYL A;  2Y4J A;  4K6R A;  4LW6 A;  1VGT A;  2I7B A;  2APC A;  4E1K A;  3V0Q A;  1HJJ A;  2P2O A;  4M2B A;  3FSX A;  5FV9 A;  4E6T A;  2WLC A;  1WT0 A;  4NAL A;  2VS5 A;  4M98 A;  2Y6P A;  2AEC A;  3I0I X;  1XHD A;  3V0O A;  3Q4S A;  5CMF X;  3I0F A;  2J0A A;  1G0R A;  1GQ9 A;  4HO4 A;  2RJ9 A;  1KRV A;  1FXJ A;  4FCE A;  4M9C A;  4Y7U A;  1IIN A;  3GQ9 A;  2RJ0 A;  3SX8 A;  3U2V A;  2XWM A;  2AQ9 A;  4N27 A;  1JV1 A;  2X5S A;  3CKO A;  3E25 A;  3I3A A;  4Y9X A;  5C4B A;  4FRA A;  2QIA A;  1J2Z A;  5JQQ A;  1JYL A;  1PZT A;  4D48 A;  1VGZ A;  3KWD A;  4EE4 A;  1ZDF A;  3USR A;  5C1L A;  1GWV A;  2RIZ A;  5CQO A;  3TIS A;  1VM8 A;  4N6B A;  1O23 B;  2XME A;  4R36 A;  2RJ7 A;  3I3X A;  2FYC B;  1M8N A;  2RJ5 A;  4Y62 A;  2OEF A;  1QQ0 A;  1WVC A;  4Y7G A;  4L41 C;  2Q4J A;  5C8R A;  4HUR A;  3Q1X A;  1THJ A;  5CMG X;  3VBP A;  3MQG A;  4D0T A;  5AJO A;  1V67 A;  4FRL A;  3FOQ A;  1VZT A;  3FS8 A;  4DE7 A;  1FRW A;  1QRM A;  4KXO A;  1H5S C;  1VH1 A;  3T7M A;  4EE3 A;  2C0N A;  2YC3 A;  3OH2 A;  5CQL X;  1LZ7 A;  2FY7 A;  1SSM A;  3U2W A;  1G95 A;  3DUV A;  1H5S D;  3OW5 A;  5CQP A;  1KK5 A;  1ZIZ A;  2W0V A;  2QIV X;  5FU8 A;  2PX7 A;  4FRP A;  1KRR A;  1MC3 A;  2VXL A;  3ZF8 A;  2P6W A;  4EQY A;  4Y64 A;  3SXC A;  1VPA A;  4ARW A;  1LXA A;  2O1H A;  2IU9 A;  3V8Z A;  1PZY B;  4J09 A;  3V8Y A;  4R37 A;  1ZCV A;  5CMI A;  3R2W A;  3TIO A;  1H5R B;  4EEM A;  3U2U A;  4HG6 A;  3BRK X;  2VXM A;  3E26 A;  1R82 A;  3CU0 A;  1VZX A;  2X5Z A;  2GGQ A;  4UEG A;  2Y4L A;  4Y6N A;  3OH0 A;  3OC9 A;  4HO9 A;  1TDT A;  1XHB A;  2W0W A;  1JV3 A;  5C4E A;  1R7X A;  2VSH A;  2P73 A;  2IUA A;  2AH9 A;  4HO0 A;  4Y63 A;  2VFZ A;  1R7U A;  3SXD A;  5DEM A;  4JD0 A;  1YP3 A;  4HCQ A;  3PNN A;  3FSY A;  1FO8 A;  4Y6U A;  1KQA A;  1VGU A;  1NWG B;  3F1C A;  4EA7 A;  1HM9 A;  3DK5 A;  2WVK A;  1QRG A;  1LZ0 A;  1OMZ A;  2JCO A;  3VBK A;  4NAI A;  3POL A;  5IDS A;  5L6S A;  1FR8 A;  2PA4 A;  5CMH A;  5I1F A;  3HSQ A;  3BSY A;  3OUP A;  2Y4M A; 
#chains in the Genus database with same CATH homology
 3R1W A;  4P02 A;  4FRQ A;  5EIY A;  4EEA A;  3OH3 A;  2D7R A;  1FG5 N;  1G23 A;  2JF2 A;  2V0J A;  1NHE B;  5BXC A;  5J49 A;  1ZI3 A;  2ICY A;  3OTM A;  4M4K A;  4DDZ A;  1O0R A;  5C3D A;  5E3P A;  1ON8 A;  1S4O A;  1T3D A;  1ZCY A;  5C3B A;  1G9R A;  3ST8 A;  4XWI A;  3TV0 A;  1H7L A;  5C4F A;  1ZI1 A;  3SXE A;  1MRL A;  1NMM B;  2RJ1 A;  2D7I A;  4Y7T A;  1QRF A;  4ASJ A;  1FR9 A;  3FSC A;  2WLF A;  4MYB A;  1GX4 A;  3OGZ A;  4FIX A;  1G1L A;  4GBP A;  2WLD A;  5C47 A;  1H5R A;  1QGS A;  2TDT A;  4HO3 A;  1TZF A;  3V91 A;  3USQ A;  4M2A A;  1S4N A;  1ZCT A;  4Y7V A;  3SX5 A;  2VD4 A;  4FIY A;  3T7N A;  2A8W A;  4FRE A;  1XAT A;  5L6V A;  1QWJ A;  1ZI4 A;  4KRV A;  3SXG A;  3V90 A;  1YP4 A;  5CMJ A;  3R8Y A;  4FRH A;  1O7Q A;  2XWL A;  3OH1 A;  1H4C A;  4FCU A;  4HUS A;  4IHF A;  5AJN A;  2VS3 A;  5DEP A;  1G97 A;  2YQC A;  2BO6 A;  1LZI A;  2I5E A;  3HL3 A;  4HO5 A;  1W57 A;  4CVH A;  3I0H A;  5E3R A;  2WEE A;  3I0C A;  3EG4 A;  2Y7A A;  3I0K A;  2WVL A;  4HOC A;  1H7H A;  5C1G A;  5U2K A;  1YP2 A;  3PKQ A;  4KPZ A;  4EE5 A;  3R5D A;  4YS8 A;  2NXV A;  4IRP A;  3RMW A;  3DHO A;  1KK4 A;  2DPW A;  4AA7 A;  4EAB A;  1LL0 A;  5C38 A;  3R3I A;  1WT2 A;  1I52 A;  2RIT A;  2VSI A;  3BFP A;  1INI A;  2ICX A;  2FYA A;  4MFG A;  3V0N A;  1IIM A;  3SXB A;  1V3W A;  2YC5 A;  4FRD A;  1ZI5 A;  3TK8 A;  2BO4 A;  4B4M A;  1HJL A;  3N9W A;  3V4E A;  5FUH A;  4B4G A;  4EEO A;  1SS9 A;  3NZ2 A;  2PGY A;  1ZJO A;  2AM4 A;  4M99 A;  2FYB A;  4MND A;  3SX7 A;  1QRL A;  1Z90 A;  3BSS A;  3P47 A;  1H5T B;  2RJ4 A;  2ZU8 A;  1S4P A;  3PKP A;  3TZT A;  1TW1 A;  1OQM B;  2RIJ A;  3CJ8 A;  3MC4 A;  1ZHJ A;  1G93 A;  1LL3 A;  4EGG A;  2JCL A;  3R5C A;  1TVY A;  1TW5 A;  2V0L A;  1KGQ A;  5AFU V;  1JVD A;  3K8E A;  1G3L A;  4HO8 A;  4ASY A;  4HZD A;  2RIX A;  1H7Q A;  2J0B A;  2QH5 A;  4JIS A;  4CJC A;  4EVW A;  1MP4 A;  5ADX V;  2ZU7 A;  2V0I A;  2WE9 A;  1GWW A;  4P00 A;  2E3D A;  3ZLK A;  4AC3 A;  3OKR A;  1ZDG A;  3IOI A;  1H7G A;  1R81 A;  1NF5 B;  4ISX A;  1KGT A;  2AGD A;  3VBL A;  5C48 A;  5F42 A;  2X60 A;  1ON6 A;  1WT3 A;  1SST A;  4IHH A;  3OAM A;  1S80 A;  2WLE A;  3PMO A;  3SPT A;  1E5K A;  1R80 A;  2FFV A;  2UX8 A;  2YQH A;  4MZU A;  4NAK A;  3T7O A;  2AM5 A;  3ZGG A;  1QRE A;  1INJ A;  1MP5 A;  2RJ6 A;  1V83 A;  4KC1 A;  2V0H A;  5AJP A;  5D92 A;  4KNR A;  1FO9 A;  3Q80 A;  3IOJ A;  2RIY A;  4LW3 A;  5EJZ A;  1KK6 A;  4HO6 A;  1MP3 A;  3U0Y A;  3TDT A;  2FKO A;  3VNP A;  3SX3 A;  3SRT A;  1H5T A;  4AAW A;  1V84 A;  1NQI B;  1LZJ A;  2QGI A;  3D8V A;  1OMX A;  3R3R A;  1QGQ A;  2XMH A;  2YCM A;  5CQM X;  2OI7 A;  3R0S A;  5C4D A;  1KHR A;  2OI6 A;  4B5B A;  1YRO B;  3I0J A;  3VBM A;  4G87 A;  3OU9 A;  5FU0 A;  3U2X A;  3R5B A;  3GOS A;  1EYR A;  4M28 A;  1FZW A;  1XZ6 A;  3D98 A;  3I0D A;  4N6A A;  1H5S B;  4B2X A;  2YQJ A;  4E75 A;  1G2V A;  5C3A A;  4IRQ A;  4R7P A;  1G8O A;  1GQC A;  2MZB A;  4Q7C A;  4FRM A;  3IGJ A;  2WLG A;  3O3P A;  4CJB A;  1JYK A;  5C1H A;  2V0K A;  3ECT A;  3CKN A;  3BXY A;  1WT1 A;  2Z87 A;  3D5N A;  1NKH B;  5EJ1 A;  3EEV A;  3CKJ A;  4E6U A;  3LW6 A;  5HS2 A;  2VHE A;  5DDV A;  4DEC A;  4ZDQ A;  2FYD B;  1HM0 A;  4IHG A;  4EA9 A;  1R7T A;  2RJ8 A;  3GVD A;  3I0E A;  3ZGF A;  4KPX A;  3QVB A;  5FTS A;  4BMA A;  2CU2 A;  1ZJ3 A;  3R5A A;  5IFY A;  3V0P A;  3RSB A;  1SSQ A;  5FTV A;  5FYE A;  3K8D A;  5DG3 A;  3CGX A;  2JCK A;  1H4D A;  1ZCU A;  5D91 A;  1LL2 A;  3FSB A;  4BQH A;  2JF3 A;  3FWW A;  4B42 A;  1FGG A;  5C49 A;  2XWN A;  4HO2 A;  5AFU U;  3JTJ A;  5C4C A;  4KT7 A;  2YES A;  2A8U A;  4O6N A;  1VH3 A;  2XAT A;  4G3S A;  1FGX A;  2WVM A;  2IC7 A;  4J18 A;  4EA8 A;  1H7T A;  5C36 A;  1H3M A;  5ADX U;  1H4E A;  4B3U A;  2AM3 A;  3V0M A;  4C2S A;  3OH4 A;  4FRO A;  3V0L A;  2D0J A;  1H5S A;  1QG8 A;  4AYJ A;  1KWS A;  1ZJ1 A;  5CQN X;  2NPO A;  3TQD A;  3CKV A;  2PGV A;  2X65 A;  4EAA A;  1HM8 A;  2FFU A;  2JCJ A;  2Z86 A;  3KWE A;  2OI5 A;  3MQH A;  2AES A;  4DCL A;  2Y4K A;  3ZLL A;  3C8V A;  5E3Q A;  3VBI A;  1V82 A;  1VZU A;  1EZI A;  3BCV A;  2IU8 A;  1R7V A;  4E79 A;  3TWD A;  2YQS A;  4KC2 A;  1LVW A;  4D0Z A;  4KNX A;  2P72 A;  4FQW A;  1R7Y A;  3KWC A;  3VBJ A;  2QKX A;  2OEG A;  4B2W A;  3VBN A;  4Y7F A;  2WAW A;  4KC4 A;  4D11 C;  4MIX A;  2GGO A;  1WSZ A;  2E8B A;  5IDT A;  3IOH A;  1FWY A;  3BSW A;  1JVG A;  3U2T A;  1VGW A;  3HJJ A;  3DJ4 A;  1W55 A;  1HV9 A;  2I5K A;  3SXA A;  4KQL A;  3I0G A;  4D11 A;  3Q7U A;  1W77 A;  2BO7 A;  1ZJ2 A;  3JUK A;  3EH0 A;  3EE5 A;  2VS4 A;  5DDT A;  1ZJ0 A;  3T57 A;  4MYO A;  4G3P A;  3KIA A;  1MR9 A;  3JUJ A;  4HZC A;  4G3Q A;  1KRU A;  4EEG A;  3IXC A;  3NGW A;  3FTT A;  2BO8 A;  1O7O A;  1FXO A;  3P1B A;  4NAN A;  2ZU9 A;  4N69 A;  1ZJP A;  2O1G A;  3U0X A;  4B4B A;  4CJ8 A;  4ECM A;  1GA8 A;  1K4V A;  3F1Y A;  4FRB A;  3RMV A;  2WGZ A;  1H7E A;  1GX0 A;  2AE7 A;  1MR7 A;  3I0L A;  1OCX A;  1FOA A;  4H7O A;  3JQY A;  3OTZ A;  4O6M A;  2O1F A;  2VK9 A;  3F1X A;  1H7F A;  3GUE A;  1VIC A;  3CKQ A;  4AYL A;  2Y4J A;  4K6R A;  4LW6 A;  1VGT A;  2I7B A;  2APC A;  4E1K A;  3V0Q A;  1HJJ A;  2P2O A;  4M2B A;  3FSX A;  5FV9 A;  4E6T A;  2WLC A;  1WT0 A;  4NAL A;  2VS5 A;  4M98 A;  2Y6P A;  2AEC A;  3I0I X;  1XHD A;  3V0O A;  3Q4S A;  5CMF X;  3I0F A;  2J0A A;  1G0R A;  1GQ9 A;  4HO4 A;  2RJ9 A;  1KRV A;  1FXJ A;  4FCE A;  4M9C A;  4Y7U A;  1IIN A;  2RJ0 A;  3SX8 A;  3U2V A;  2XWM A;  2AQ9 A;  4N27 A;  1JV1 A;  2X5S A;  3CKO A;  3E25 A;  3I3A A;  4Y9X A;  5C4B A;  4FRA A;  2QIA A;  1J2Z A;  5JQQ A;  1JYL A;  1PZT A;  4D48 A;  1VGZ A;  3KWD A;  4EE4 A;  1ZDF A;  3USR A;  5C1L A;  1GWV A;  2RIZ A;  5CQO A;  3TIS A;  1VM8 A;  4N6B A;  1O23 B;  2XME A;  4R36 A;  2RJ7 A;  3I3X A;  2FYC B;  2RJ5 A;  4Y62 A;  2OEF A;  1QQ0 A;  1WVC A;  4Y7G A;  4L41 C;  2Q4J A;  5C8R A;  4HUR A;  3Q1X A;  1THJ A;  5CMG X;  3VBP A;  3MQG A;  4D0T A;  5AJO A;  1V67 A;  4FRL A;  3FOQ A;  1VZT A;  3FS8 A;  4DE7 A;  1FRW A;  1QRM A;  4KXO A;  1H5S C;  1VH1 A;  3T7M A;  4EE3 A;  2C0N A;  2YC3 A;  3OH2 A;  5CQL X;  1LZ7 A;  2FY7 A;  1SSM A;  3U2W A;  1G95 A;  3DUV A;  1H5S D;  3OW5 A;  5CQP A;  1KK5 A;  1ZIZ A;  2W0V A;  2QIV X;  5FU8 A;  2PX7 A;  4FRP A;  1KRR A;  1MC3 A;  2VXL A;  3ZF8 A;  2P6W A;  4EQY A;  4Y64 A;  3SXC A;  1VPA A;  4ARW A;  1LXA A;  2O1H A;  2IU9 A;  3V8Z A;  1PZY B;  4J09 A;  3V8Y A;  4R37 A;  1ZCV A;  5CMI A;  3R2W A;  3TIO A;  1H5R B;  4EEM A;  3U2U A;  4HG6 A;  3BRK X;  2VXM A;  3E26 A;  1R82 A;  3CU0 A;  1VZX A;  2X5Z A;  2GGQ A;  4UEG A;  2Y4L A;  4Y6N A;  3OH0 A;  3OC9 A;  4HO9 A;  1TDT A;  1XHB A;  2W0W A;  1JV3 A;  5C4E A;  1R7X A;  2VSH A;  2P73 A;  2IUA A;  2AH9 A;  4HO0 A;  4Y63 A;  2VFZ A;  1R7U A;  3SXD A;  5DEM A;  4JD0 A;  1YP3 A;  4HCQ A;  3PNN A;  3FSY A;  1FO8 A;  4Y6U A;  1KQA A;  1VGU A;  1NWG B;  3F1C A;  4EA7 A;  1HM9 A;  3DK5 A;  2WVK A;  1QRG A;  1LZ0 A;  1OMZ A;  2JCO A;  3VBK A;  4NAI A;  3POL A;  5IDS A;  5L6S A;  1FR8 A;  2PA4 A;  5CMH A;  5I1F A;  3HSQ A;  3BSY A;  3OUP A;  2Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...