4G87A

Crystal structure of glmu from mycobacterium tuberculosis snapshot 1
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g87A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g87A01
5C49A 4DECA 2V0JA 1R7VA 4D0TA 2RIYA 4FRLA 4IHGA 4M4KA 3OTZA 1THJA 1JVGA 1ZJ0A 2Y4KA 5IDSA 2Z87A 1FR9A 4H7OA 4KPXA 3I0IX 3KWEA 4KNXA 4N6AA 5CMGX 3TK8A 4HZDA 3VBJA 3BSSA 2X5ZA 1VGUA 2E3DA 1QWJA 2RJ6A 1MR9A 3FSYA 1LZ7A 3U2UA 2VXLA 1ZJPA 3DJ4A 1ZDGA 2JCLA 2Y4MA 4KPZA 3I0GA 3OH0A 3RMWA 1KGQA 1QREA 3R5BA 3BFPA 2XMHA 1LL0A 4Y7UA 4N6BA 3TV0A 1KGTA 4FRDA 4EEOA 1W57A 5AFUV 5F42A 3CKQA 1V67A 1YROB 3ZF8A 3SX8A 3SXDA 4B2XA 5IDTA 1XZ6A 5AFUU 2Z86A 3U0YA 1KK5A 1I52A 2OI6A 3P1BA 2NPOA 4D11A 3JQYA 4HG6A 4L41C 4AAWA 2OI7A 4AC3A 3U2XA 4AA7A 5EJ1A 1R80A 2E8BA 4FROA 2VSIA 4FRMA 4D0ZA 1G1LA 5AJNA 4EE3A 3PKPA 4R7PA 3R3RA 2AESA 2Y4LA 1FOAA 4HO8A 3E25A 3ST8A 1ZJOA 3CU0A 3DK5A 5E3RA 5C47A 4M98A 1FZWA 3FSXA 1VGTA 2X60A 4FRHA 2QKXA 2QH5A 3TIOA 2RJ4A 1LZ0A 3I0CA 2FYAA 3OH2A 4HO4A 4C2SA 1YP3A 5J49A 4ECMA 3POLA 3VBIA 1V84A 4Y9XA 4D11C 1ZJ3A 1VZXA 4G3PA 5C48A 2FFVA 1FO8A 4P02A 4HO3A 3VBMA 4HUSA 3I0HA 3VBPA 3V4EA 1H7HA 5C4EA 1QRGA 1GQCA 1ZI1A 1O0RA 5DDVA 2RIXA 3NGWA 1OQMB 1LL3A 1H7LA 1PZYB 3CGXA 4NAKA 3I0FA 4ASYA 2RJ9A 2RIZA 2VHEA 2YQSA 2WAWA 2ICXA 2D7RA 3EH0A 5CMIA 2ZU7A 1QRFA 2W0VA 5E3QA 4MNDA 5C4BA 1FWYA 3NZ2A 2FKOA 4M2AA 2WLGA 2IUAA 1VGZA 4HZCA 1H5SC 5C36A 1HM0A 2W0WA 5FV9A 3I3AA 4M2BA 3FOQA 1O7QA 1VZUA 1WVCA 2JCOA 3I0KA 1ON8A 3FTTA 2RJ7A 4M28A 3DHOA 3I0JA 1GA8A 2AM5A 4FRQA 4BMAA 3R1WA 2DPWA 4UEGA 4K6RA 1ZCTA 4Y63A 3TWDA 4FCUA 2QIVX 4EQYA 3TISA 3TDTA 2WLFA 1H5SB 4HURA 3OH4A 4GBPA 4EVWA 1LL2A 1R7UA 5IFYA 3F1YA 2XMEA 1TZFA 4AYJA 4E6TA 2XWLA 2WLDA 4HO5A 2AQ9A 3O3PA 1KWSA 1VICA 2V0HA 1G2VA 4CJ8A 2RJ5A 1QGQA 3Q7UA 4EE4A 1TW5A 2OEFA 1ZI4A 5C4DA 5HS2A 1VM8A 1MP5A 4NAIA 3V0NA 2UX8A 4MYOA 3EEVA 1GWVA 4G3QA 3QVBA 4Y7VA 2PA4A 3SXGA 1H5SD 1FR8A 3U2VA 1H4EA 3KIAA 1ZCVA 2AH9A 1O23B 2VD4A 1INJA 1SS9A 4FREA 3OGZA 3MQGA 2FYBA 3V91A 3ECTA 3OH3A 4FCEA 2OI5A 5EJZA 3I0LA 4HO0A 5CQMX 5FTSA 1QRMA 1FXJA 1IINA 1VH3A 3IOHA 3IXCA 4CVHA 3VBKA 1TW1A 5CMJA 2AM4A 4Y62A 1NQIB 3OAMA 3ZGGA 2RITA 5FTVA 5C3DA 3OW5A 4CJBA 2CU2A 2IC7A 3SX7A 3R2WA 4KC2A 1XHBA 3TZTA 4MZUA 2FYCB 2P2OA 3U0XA 3F1CA 1G9RA 3TQDA 2VS3A 3Q4SA 4EA9A 2AE7A 2D0JA 1ZJ2A 3V0LA 3V0PA 3CKOA 4HOCA 4ARWA 3OC9A 2ZU9A 3HL3A 1EZIA 1NHEB 3R5DA 4EEGA 3Q80A 2ZU8A 5CQPA 1ZCUA 2A8WA 5C3BA 1SSQA 3D98A 5DEPA 3R0SA 1QRLA 3GVDA 3RMVA 2XATA 2YC3A 3R5CA 3R3IA 5ADXU 4Y6UA 2I7BA 2V0LA 2AECA 1W77A 5L6VA 4B2WA 2YESA 1H7GA 1MR7A 3IOJA 4NALA 1E5KA 1WT1A 1KK6A 2PGYA 4E79A 4HO2A 5C3AA 1H5SA 1R82A 1JV3A 3U2TA 1HM8A 1H7QA 1KK4A 1HV9A 1MRLA 3CJ8A 5E3PA 4DCLA 1H7EA 4FQWA 5C8RA 2WE9A 1R7YA 4B42A 4YS8A 3SX3A 3V0QA 1H5TA 2FY7A 1MP4A 4IRPA 2WVKA 4JD0A 1WT0A 3VBLA 1J2ZA 4KT7A 4M99A 4E1KA 4Y7GA 1TDTA 1T3DA 1S4NA 5CMHA 4B3UA 1VPAA 5I1FA 2FYDB 1GQ9A 1G97A 1WT3A 4KC4A 4EEAA 3R5AA 5DEMA 1LZIA 2Y4JA 3T7NA 2JF2A 3F1XA 4BQHA 4KRVA 1WT2A 2GGOA 1R7TA 2JCKA 4N27A 4B4GA 4EE5A 1JV1A 3I3XA 1HJJA 3USRA 3FS8A 2FFUA 3T7OA 1NWGB 1KQAA 2VFZA 4E6UA 2D7IA 2WEEA 4LW6A 2Y7AA 3ZLLA 1EYRA 3CKJA 2JF3A 3LW6A 1VH1A 4EA7A 5C4FA 2JCJA 1H4CA 4IHFA 1NF5B 1LXAA 4HCQA 3EG4A 1FO9A 3BXYA 5L6SA 4D48A 2V0KA 3PKQA 1H5TB 2OEGA 3FSCA 4MFGA 3V8YA 4M9CA 1V3WA 1FGGA 2V0IA 2WVLA 4XWIA 3KWCA 5U2KA 3VNPA 3HJJA 2Q4JA 3N9WA 5FUHA 2WLEA 1KRRA 1YP4A 1H5RB 1GX0A 5EIYA 1FXOA 1KRUA 2IU9A 3IGJA 2XWNA 4IRQA 1WSZA 1ZDFA 1OCXA 4G87A 4DDZA 1S4OA 1LZJA 1ON6A 1R81A 3I0EA 2P6WA 1K4VA 1FGXA 3V0OA 2YCMA 3BRKX 3GOSA 4KQLA 3E26A 4N69A 4Y7TA 5C1HA 2RJ0A 2WGZA 4ZDQA 1V83A 1W55A 5JQQA 2WVMA 5BXCA 4EAAA 5FYEA 4J09A 3KWDA 3SPTA 2X5SA 2I5EA 5FU8A 4EA8A 5C1GA 2QIAA 4CJCA 1VGWA 4JISA 4ASJA 3V90A 3USQA 3V8ZA 4R37A 3ZLKA 1MP3A 4B4BA 3OU9A 1HJLA 1JVDA 4FRBA 4IHHA 3FSBA 2O1FA 1JYKA 3D5NA 2YQHA 1VZTA 1G8OA 2AM3A 3ZGFA 5ADXV 3JUKA 3OTMA 1G23A 3JUJA 3K8DA 3BSWA 4HO9A 1FG5N 1JYLA 3SXAA 4EEMA 2RJ8A 4EGGA 1QQ0A 4MYBA 5AJOA 2O1HA 5C38A 5DG3A 3IOIA 1SSMA 1H4DA 1G95A 1S80A 2VS4A 3BSYA 2BO6A 2O1GA 3P47A 1OMZA 4KC1A 2VXMA 2ICYA 2P72A 1XATA 1OMXA 3OKRA 3OH1A 1NMMB 1HM9A 4B4MA 1KRVA 3Q1XA 5CQLX 2MZBA 4AYLA 2GGQA 3SX5A 1GWWA 1IIMA 3BCVA 2Y6PA 1ZCYA 5C4CA 1QG8A 4LW3A 5CMFX 3JTJA 2A8UA 4B5BA 3MC4A 3MQHA 2NXVA 1G3LA 5DDTA 3V0MA 3EE5A 4P00A 2VSHA 4R36A 4ISXA 2YC5A 1H5RA 4DE7A 3K8EA 3D8VA 2IU8A 2BO7A 3CKVA 1H7FA 1O7OA 4EABA 3PMOA 1S4PA 3SXEA 2PGVA 4J18A 1KHRA 3PNNA 1H3MA 1H7TA 2BO8A 4Y6NA 3VBNA 5AJPA 1G0RA 4HO6A 5FU0A 4FRAA 2YQJA 3T57A 3T7MA 2TDTA 3I0DA 5CQOA 1ZI5A 3SXCA 1LVWA 5CQNX 2RIJA 2RJ1A 4FRPA 1ZHJA 3RSBA 1Z90A 1TVYA 2WLCA 4E75A 1INIA 3U2WA 3OUPA 4G3SA 1ZIZA 2APCA 3DUVA 1PZTA 2I5KA 3GUEA 1ZJ1A 4Y64A 1XHDA 2XWMA 1MC3A 3CKNA 1FRWA 2PX7A 4NANA 2YQCA 1SSTA 1QGSA 1GX4A 2QGIA 2P73A 3R8YA 4Y7FA 1NKHB 3HSQA 3SXBA 1ZI3A 1YP2A 4KXOA 3FWWA 1V82A 2AGDA 2BO4A 4KNRA 5C1LA 3C8VA 3SRTA 2VS5A 2X65A 1R7XA 1G93A
chains in the Genus database with same CATH superfamily
5C49A 4DECA 2V0JA 1R7VA 4D0TA 2RIYA 4FRLA 4IHGA 4M4KA 3GQ9A 3OTZA 1THJA 1JVGA 1ZJ0A 2Y4KA 5IDSA 2Z87A 1FR9A 4H7OA 4KPXA 3I0IX 3KWEA 4KNXA 4N6AA 5CMGX 3TK8A 4HZDA 3VBJA 3BSSA 2X5ZA 1VGUA 2E3DA 1QWJA 2RJ6A 1MR9A 3FSYA 1LZ7A 3U2UA 2VXLA 1ZJPA 3DJ4A 1ZDGA 2JCLA 2Y4MA 3OH0A 4KPZA 3I0GA 3RMWA 1KGQA 1QREA 3R5BA 3BFPA 2XMHA 1LL0A 4Y7UA 4N6BA 3TV0A 1KGTA 4FRDA 4EEOA 1W57A 5AFUV 5F42A 3CKQA 1V67A 1YROB 3ZF8A 3SX8A 3SXDA 4B2XA 5IDTA 1XZ6A 1N4IA 5AFUU 2Z86A 3U0YA 1KK5A 1I52A 2OI6A 3P1BA 4MIXA 2NPOA 4D11A 3JQYA 4HG6A 5D92A 4L41C 4AAWA 2OI7A 4AC3A 3U2XA 4AA7A 5EJ1A 1R80A 2E8BA 4FROA 2VSIA 4FRMA 4D0ZA 1G1LA 5AJNA 4EE3A 3PKPA 4R7PA 3R3RA 2AESA 2Y4LA 1FOAA 4HO8A 3E25A 3GQAA 3ST8A 1ZJOA 3DK5A 5E3RA 3CU0A 5C47A 4M98A 1FZWA 3FSXA 1VGTA 2X60A 4FRHA 2QKXA 2QH5A 3TIOA 2RJ4A 1LZ0A 3I0CA 3OH2A 2FYAA 4HO4A 4C2SA 1YP3A 5J49A 4ECMA 3POLA 3VBIA 1V84A 3GQ8A 4Y9XA 4D11C 1ZJ3A 1VZXA 4G3PA 5C48A 2FFVA 1FO8A 4P02A 4HO3A 3VBMA 4HUSA 3I0HA 3VBPA 3V4EA 1H7HA 5C4EA 1QRGA 1GQCA 1ZI1A 1O0RA 5DDVA 2RIXA 3NGWA 1OQMB 1LL3A 1H7LA 1PZYB 3CGXA 4NAKA 3I0FA 4ASYA 4O6NA 2RJ9A 2RIZA 2VHEA 2YQSA 1EWWA 2WAWA 2ICXA 2D7RA 3EH0A 5CMIA 2ZU7A 1QRFA 2W0VA 5E3QA 4MNDA 5C4BA 1FWYA 3NZ2A 2FKOA 4M2AA 2WLGA 2IUAA 1VGZA 4HZCA 1H5SC 5C36A 1HM0A 2W0WA 5FV9A 3I3AA 4M2BA 3FOQA 1O7QA 1VZUA 1WVCA 1Z2FA 2JCOA 3I0KA 4Q7CA 1ON8A 3FTTA 2RJ7A 4M28A 3DHOA 3I0JA 1GA8A 2AM5A 4FRQA 4BMAA 3R1WA 2DPWA 4UEGA 4K6RA 1ZCTA 4Y63A 3TWDA 4FCUA 2QIVX 4EQYA 3TISA 3TDTA 2WLFA 1H5SB 3OH4A 4HURA 4GBPA 4EVWA 1LL2A 1R7UA 5IFYA 3F1YA 2XMEA 1TZFA 4AYJA 4E6TA 2XWLA 2WLDA 4HO5A 2AQ9A 3O3PA 1KWSA 1VICA 2V0HA 1G2VA 4CJ8A 2RJ5A 1QGQA 3Q7UA 4EE4A 1TW5A 2OEFA 1ZI4A 5C4DA 5HS2A 1VM8A 1MP5A 4NAIA 3V0NA 2UX8A 4MYOA 3EEVA 1GWVA 4G3QA 3QVBA 4Y7VA 2PA4A 3SXGA 1H5SD 1FR8A 3U2VA 1M8NA 1H4EA 3KIAA 1ZCVA 2AH9A 1O23B 2VD4A 1INJA 1SS9A 4FREA 3OGZA 3MQGA 2FYBA 3V91A 3ECTA 3OH3A 4FCEA 2OI5A 5EJZA 3I0LA 4HO0A 5CQMX 5FTSA 1QRMA 1FXJA 1IINA 1VH3A 3IOHA 3IXCA 4CVHA 3VBKA 1TW1A 5CMJA 2AM4A 4Y62A 1NQIB 3OAMA 3ZGGA 2RITA 5FTVA 5C3DA 3OW5A 3GQ7A 4CJBA 2CU2A 2IC7A 3SX7A 1L0SA 3R2WA 4KC2A 1XHBA 3TZTA 4MZUA 2FYCB 2P2OA 3U0XA 3F1CA 1G9RA 3TQDA 2VS3A 3Q4SA 4EA9A 2AE7A 2D0JA 1ZJ2A 3V0LA 3V0PA 3CKOA 4HOCA 4ARWA 3OC9A 2ZU9A 4FIYA 3HL3A 1EZIA 1NHEB 3R5DA 4EEGA 3Q80A 2ZU8A 5CQPA 1ZCUA 2A8WA 5C3BA 1SSQA 3D98A 5DEPA 3R0SA 1QRLA 3GVDA 3RMVA 2XATA 2YC3A 3R5CA 3R3IA 5ADXU 4Y6UA 2I7BA 2V0LA 2AECA 1W77A 5L6VA 4B2WA 2YESA 1H7GA 1MR7A 3IOJA 4NALA 1E5KA 1WT1A 1KK6A 2PGYA 4E79A 4HO2A 5C3AA 1H5SA 1R82A 1JV3A 3U2TA 1HM8A 1H7QA 1KK4A 1HV9A 1MRLA 3CJ8A 5E3PA 4DCLA 1H7EA 4FQWA 5C8RA 2WE9A 1R7YA 5D91A 4B42A 4YS8A 3SX3A 3V0QA 1H5TA 2FY7A 1MP4A 4IRPA 2WVKA 4JD0A 1WT0A 3VBLA 1J2ZA 4KT7A 4M99A 4E1KA 4Y7GA 1TDTA 1T3DA 1S4NA 5CMHA 4B3UA 1VPAA 2C0NA 2FYDB 5I1FA 1GQ9A 1G97A 1WT3A 4KC4A 4EEAA 3R5AA 5DEMA 1LZIA 2Y4JA 3T7NA 2JF2A 3F1XA 4BQHA 4KRVA 1WT2A 2GGOA 1R7TA 2JCKA 4N27A 4B4GA 4EE5A 1JV1A 3I3XA 1HJJA 3USRA 3FS8A 2FFUA 3T7OA 1NWGB 1KQAA 2VFZA 4O6MA 4E6UA 2D7IA 2WEEA 4LW6A 2Y7AA 3ZLLA 1EYRA 3CKJA 2JF3A 3LW6A 1VH1A 4EA7A 5C4FA 2JCJA 1H4CA 4IHFA 1NF5B 1LXAA 4HCQA 3EG4A 1FO9A 3BXYA 5L6SA 4D48A 2V0KA 3PKQA 1H5TB 2OEGA 3FSCA 4MFGA 3V8YA 4M9CA 1V3WA 1FGGA 2V0IA 2WVLA 4XWIA 3KWCA 5U2KA 3VNPA 3HJJA 2Q4JA 3N9WA 5FUHA 2WLEA 1KRRA 1YP4A 1H5RB 1GX0A 5EIYA 1FXOA 1KRUA 2IU9A 3IGJA 2J0AA 2XWNA 4IRQA 1WSZA 1ZDFA 1OCXA 4G87A 4DDZA 1S4OA 1LZJA 1ON6A 1R81A 3I0EA 2P6WA 1K4VA 1FGXA 3V0OA 2YCMA 3BRKX 3GOSA 4KQLA 3E26A 4N69A 4Y7TA 5C1HA 2RJ0A 2WGZA 4ZDQA 1V83A 1W55A 5JQQA 2WVMA 5BXCA 4EAAA 5FYEA 4J09A 3KWDA 3SPTA 2X5SA 2I5EA 5FU8A 4EA8A 5C1GA 2QIAA 4CJCA 1VGWA 4JISA 4ASJA 3V90A 3USQA 3V8ZA 4R37A 3ZLKA 1MP3A 4B4BA 3OU9A 1HJLA 1JVDA 4FRBA 4IHHA 3FSBA 2O1FA 1JYKA 3D5NA 2YQHA 1VZTA 1G8OA 2AM3A 3ZGFA 5ADXV 3JUKA 3OTMA 1G23A 3JUJA 3K8DA 3BSWA 4HO9A 1FG5N 1JYLA 3SXAA 4EEMA 2RJ8A 4EGGA 1QQ0A 4MYBA 5AJOA 2O1HA 5C38A 5DG3A 3IOIA 1SSMA 1H4DA 1G95A 1S80A 2VS4A 3BSYA 2BO6A 2O1GA 3P47A 1OMZA 4KC1A 2VXMA 2ICYA 2P72A 1XATA 1OMXA 3OKRA 3OH1A 1NMMB 1HM9A 4B4MA 1KRVA 3Q1XA 5CQLX 2MZBA 4AYLA 2GGQA 3SX5A 1GWWA 1IIMA 3BCVA 2Y6PA 1ZCYA 5C4CA 1QG8A 4LW3A 5CMFX 3JTJA 2A8UA 4B5BA 3MC4A 3MQHA 2NXVA 1G3LA 5DDTA 3V0MA 3EE5A 4P00A 2VSHA 4R36A 4ISXA 2YC5A 1H5RA 4DE7A 3K8EA 3D8VA 2IU8A 2BO7A 3CKVA 1H7FA 1O7OA 4EABA 3PMOA 1S4PA 3SXEA 2PGVA 4J18A 1KHRA 3PNNA 1H3MA 2J0BA 1H7TA 2BO8A 2VK9A 3VBNA 4Y6NA 1G0RA 4HO6A 5AJPA 5FU0A 4FRAA 2YQJA 3T57A 3T7MA 2TDTA 3I0DA 3SUCA 5CQOA 1ZI5A 3SXCA 1LVWA 5CQNX 2RIJA 2RJ1A 4FRPA 1ZHJA 3RSBA 1Z90A 1TVYA 2WLCA 4E75A 1INIA 3U2WA 3OUPA 4G3SA 1ZIZA 2APCA 3DUVA 1PZTA 2I5KA 3GUEA 1ZJ1A 4Y64A 1XHDA 2XWMA 1MC3A 3CKNA 1FRWA 2PX7A 4NANA 2YQCA 1SSTA 1QGSA 1GX4A 2QGIA 2P73A 3R8YA 4Y7FA 1NKHB 3HSQA 3SXBA 1ZI3A 1YP2A 4FIXA 3FWWA 4KXOA 1V82A 2AGDA 2BO4A 4KNRA 5C1LA 3C8VA 3SRTA 2VS5A 2X65A 1R7XA 1G93A
chains in the Genus database with same CATH topology
5C49A 4DECA 2V0JA 1R7VA 4D0TA 2RIYA 4FRLA 4IHGA 4M4KA 3OTZA 1THJA 1JVGA 1ZJ0A 2Y4KA 5IDSA 2Z87A 1FR9A 4H7OA 4KPXA 3I0IX 3KWEA 4KNXA 4N6AA 5CMGX 3TK8A 4HZDA 3VBJA 3BSSA 2X5ZA 1VGUA 2E3DA 1QWJA 2RJ6A 1MR9A 3FSYA 1LZ7A 3U2UA 2VXLA 1ZJPA 3DJ4A 1ZDGA 2JCLA 2Y4MA 4KPZA 3I0GA 3OH0A 3RMWA 1KGQA 1QREA 3R5BA 3BFPA 2XMHA 1LL0A 4Y7UA 4N6BA 3TV0A 1KGTA 4FRDA 4EEOA 1W57A 5AFUV 5F42A 3CKQA 1V67A 1YROB 3ZF8A 3SX8A 3SXDA 4B2XA 5IDTA 1XZ6A 5AFUU 2Z86A 3U0YA 1KK5A 1I52A 2OI6A 3P1BA 4MIXA 2NPOA 4D11A 3JQYA 4HG6A 5D92A 4L41C 4AAWA 2OI7A 4AC3A 3U2XA 4AA7A 5EJ1A 1R80A 2E8BA 4FROA 2VSIA 4FRMA 4D0ZA 1G1LA 5AJNA 4EE3A 3PKPA 4R7PA 3R3RA 2AESA 2Y4LA 1FOAA 4HO8A 3E25A 3ST8A 1ZJOA 3CU0A 3DK5A 5E3RA 5C47A 4M98A 1FZWA 3FSXA 1VGTA 2X60A 4FRHA 2QKXA 2QH5A 3TIOA 2RJ4A 1LZ0A 3I0CA 2FYAA 3OH2A 4HO4A 4C2SA 1YP3A 5J49A 4ECMA 3POLA 3VBIA 1V84A 4Y9XA 4D11C 1ZJ3A 1VZXA 4G3PA 5C48A 2FFVA 1FO8A 4P02A 4HO3A 3VBMA 4HUSA 3I0HA 3VBPA 3V4EA 1H7HA 5C4EA 1QRGA 1GQCA 1ZI1A 1O0RA 5DDVA 2RIXA 3NGWA 1OQMB 1LL3A 1H7LA 1PZYB 3CGXA 4NAKA 3I0FA 4ASYA 4O6NA 2RJ9A 2RIZA 2VHEA 2YQSA 2WAWA 2ICXA 2D7RA 3EH0A 5CMIA 2ZU7A 1QRFA 2W0VA 5E3QA 4MNDA 5C4BA 1FWYA 3NZ2A 2FKOA 4M2AA 2WLGA 2IUAA 1VGZA 4HZCA 1H5SC 5C36A 1HM0A 2W0WA 5FV9A 3I3AA 4M2BA 3FOQA 1O7QA 1VZUA 1WVCA 2JCOA 3I0KA 4Q7CA 1ON8A 3FTTA 2RJ7A 4M28A 3DHOA 3I0JA 1GA8A 2AM5A 4FRQA 4BMAA 3R1WA 2DPWA 4UEGA 4K6RA 1ZCTA 4Y63A 3TWDA 4FCUA 2QIVX 4EQYA 3TISA 3TDTA 2WLFA 1H5SB 4HURA 3OH4A 4GBPA 4EVWA 1LL2A 1R7UA 5IFYA 3F1YA 2XMEA 1TZFA 4AYJA 4E6TA 2XWLA 2WLDA 4HO5A 2AQ9A 3O3PA 1KWSA 1VICA 2V0HA 1G2VA 4CJ8A 2RJ5A 1QGQA 3Q7UA 4EE4A 1TW5A 2OEFA 1ZI4A 5C4DA 5HS2A 1VM8A 1MP5A 4NAIA 3V0NA 2UX8A 4MYOA 3EEVA 1GWVA 4G3QA 3QVBA 4Y7VA 2PA4A 3SXGA 1H5SD 1FR8A 3U2VA 1H4EA 3KIAA 1ZCVA 2AH9A 1O23B 2VD4A 1INJA 1SS9A 4FREA 3OGZA 3MQGA 2FYBA 3V91A 3ECTA 3OH3A 4FCEA 2OI5A 5EJZA 3I0LA 4HO0A 5CQMX 5FTSA 1QRMA 1FXJA 1IINA 1VH3A 3IOHA 3IXCA 4CVHA 3VBKA 1TW1A 5CMJA 2AM4A 4Y62A 1NQIB 3OAMA 3ZGGA 2RITA 5FTVA 5C3DA 3OW5A 4CJBA 2CU2A 2IC7A 3SX7A 3R2WA 4KC2A 1XHBA 3TZTA 4MZUA 2FYCB 2P2OA 3U0XA 3F1CA 1G9RA 3TQDA 2VS3A 3Q4SA 4EA9A 2AE7A 2D0JA 1ZJ2A 3V0LA 3V0PA 3CKOA 4HOCA 4ARWA 3OC9A 2ZU9A 4FIYA 3HL3A 1EZIA 1NHEB 3R5DA 4EEGA 3Q80A 2ZU8A 5CQPA 1ZCUA 2A8WA 5C3BA 1SSQA 3D98A 5DEPA 3R0SA 1QRLA 3GVDA 3RMVA 2XATA 2YC3A 3R5CA 3R3IA 5ADXU 4Y6UA 2I7BA 2V0LA 2AECA 1W77A 5L6VA 4B2WA 2YESA 1H7GA 1MR7A 3IOJA 4NALA 1E5KA 1WT1A 1KK6A 2PGYA 4E79A 4HO2A 5C3AA 1H5SA 1R82A 1JV3A 3U2TA 1HM8A 1H7QA 1KK4A 1HV9A 1MRLA 3CJ8A 5E3PA 4DCLA 1H7EA 4FQWA 5C8RA 2WE9A 1R7YA 5D91A 4B42A 4YS8A 3SX3A 3V0QA 1H5TA 2FY7A 1MP4A 4IRPA 2WVKA 4JD0A 1WT0A 3VBLA 1J2ZA 4KT7A 4M99A 4E1KA 4Y7GA 1TDTA 1T3DA 1S4NA 5CMHA 4B3UA 1VPAA 2C0NA 2FYDB 5I1FA 1GQ9A 1G97A 1WT3A 4KC4A 4EEAA 3R5AA 5DEMA 1LZIA 2Y4JA 3T7NA 2JF2A 3F1XA 4BQHA 4KRVA 1WT2A 2GGOA 1R7TA 2JCKA 4N27A 4B4GA 4EE5A 1JV1A 3I3XA 1HJJA 3USRA 3FS8A 2FFUA 3T7OA 1NWGB 1KQAA 2VFZA 4O6MA 4E6UA 2D7IA 2WEEA 4LW6A 2Y7AA 3ZLLA 1EYRA 3CKJA 2JF3A 3LW6A 1VH1A 4EA7A 5C4FA 2JCJA 1H4CA 4IHFA 1NF5B 1LXAA 4HCQA 3EG4A 1FO9A 3BXYA 5L6SA 4D48A 2V0KA 3PKQA 1H5TB 2OEGA 3FSCA 4MFGA 3V8YA 4M9CA 1V3WA 1FGGA 2V0IA 2WVLA 4XWIA 3KWCA 5U2KA 3VNPA 3HJJA 2Q4JA 3N9WA 5FUHA 2WLEA 1KRRA 1YP4A 1H5RB 1GX0A 5EIYA 1FXOA 1KRUA 2IU9A 3IGJA 2J0AA 2XWNA 4IRQA 1WSZA 1ZDFA 1OCXA 4G87A 4DDZA 1S4OA 1LZJA 1ON6A 1R81A 3I0EA 2P6WA 1K4VA 1FGXA 3V0OA 2YCMA 3BRKX 3GOSA 4KQLA 3E26A 4N69A 4Y7TA 5C1HA 2RJ0A 2WGZA 4ZDQA 1V83A 1W55A 5JQQA 2WVMA 5BXCA 4EAAA 5FYEA 4J09A 3KWDA 3SPTA 2X5SA 2I5EA 5FU8A 4EA8A 5C1GA 2QIAA 4CJCA 1VGWA 4JISA 4ASJA 3V90A 3USQA 3V8ZA 4R37A 3ZLKA 1MP3A 4B4BA 3OU9A 1HJLA 1JVDA 4FRBA 4IHHA 3FSBA 2O1FA 1JYKA 3D5NA 2YQHA 1VZTA 1G8OA 2AM3A 3ZGFA 5ADXV 3JUKA 3OTMA 1G23A 3JUJA 3K8DA 3BSWA 4HO9A 1FG5N 1JYLA 3SXAA 4EEMA 2RJ8A 4EGGA 1QQ0A 4MYBA 5AJOA 2O1HA 5C38A 5DG3A 3IOIA 1SSMA 1H4DA 1G95A 1S80A 2VS4A 3BSYA 2BO6A 2O1GA 3P47A 1OMZA 4KC1A 2VXMA 2ICYA 2P72A 1XATA 1OMXA 3OKRA 3OH1A 1NMMB 1HM9A 4B4MA 1KRVA 3Q1XA 5CQLX 2MZBA 4AYLA 2GGQA 3SX5A 1GWWA 1IIMA 3BCVA 2Y6PA 1ZCYA 5C4CA 1QG8A 4LW3A 5CMFX 3JTJA 2A8UA 4B5BA 3MC4A 3MQHA 2NXVA 1G3LA 5DDTA 3V0MA 3EE5A 4P00A 2VSHA 4R36A 4ISXA 2YC5A 1H5RA 4DE7A 3K8EA 3D8VA 2IU8A 2BO7A 3CKVA 1H7FA 1O7OA 4EABA 3PMOA 1S4PA 3SXEA 2PGVA 4J18A 1KHRA 3PNNA 1H3MA 2J0BA 1H7TA 2BO8A 2VK9A 3VBNA 4Y6NA 1G0RA 4HO6A 5AJPA 5FU0A 4FRAA 2YQJA 3T57A 3T7MA 2TDTA 3I0DA 5CQOA 1ZI5A 3SXCA 1LVWA 5CQNX 2RIJA 2RJ1A 4FRPA 1ZHJA 3RSBA 1Z90A 1TVYA 2WLCA 4E75A 1INIA 3U2WA 3OUPA 4G3SA 1ZIZA 2APCA 3DUVA 1PZTA 2I5KA 3GUEA 1ZJ1A 4Y64A 1XHDA 2XWMA 1MC3A 3CKNA 1FRWA 2PX7A 4NANA 2YQCA 1SSTA 1QGSA 1GX4A 2QGIA 2P73A 3R8YA 4Y7FA 1NKHB 3HSQA 3SXBA 1ZI3A 1YP2A 4FIXA 3FWWA 4KXOA 1V82A 2AGDA 2BO4A 4KNRA 5C1LA 3C8VA 3SRTA 2VS5A 2X65A 1R7XA 1G93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C49 A;  4DEC A;  2V0J A;  1R7V A;  4D0T A;  2RIY A;  4FRL A;  4IHG A;  4M4K A;  3OTZ A;  1THJ A;  1JVG A;  1ZJ0 A;  2Y4K A;  5IDS A;  2Z87 A;  1FR9 A;  4H7O A;  4KPX A;  3I0I X;  3KWE A;  4KNX A;  4N6A A;  5CMG X;  3TK8 A;  4HZD A;  3VBJ A;  3BSS A;  2X5Z A;  1VGU A;  2E3D A;  1QWJ A;  2RJ6 A;  1MR9 A;  3FSY A;  1LZ7 A;  3U2U A;  2VXL A;  1ZJP A;  3DJ4 A;  1ZDG A;  2JCL A;  2Y4M A;  4KPZ A;  3I0G A;  3OH0 A;  3RMW A;  1KGQ A;  1QRE A;  3R5B A;  3BFP A;  2XMH A;  1LL0 A;  4Y7U A;  4N6B A;  3TV0 A;  1KGT A;  4FRD A;  4EEO A;  1W57 A;  5AFU V;  5F42 A;  3CKQ A;  1V67 A;  1YRO B;  3ZF8 A;  3SX8 A;  3SXD A;  4B2X A;  5IDT A;  1XZ6 A;  5AFU U;  2Z86 A;  3U0Y A;  1KK5 A;  1I52 A;  2OI6 A;  3P1B A;  2NPO A;  4D11 A;  3JQY A;  4HG6 A;  4L41 C;  4AAW A;  2OI7 A;  4AC3 A;  3U2X A;  4AA7 A;  5EJ1 A;  1R80 A;  2E8B A;  4FRO A;  2VSI A;  4FRM A;  4D0Z A;  1G1L A;  5AJN A;  4EE3 A;  3PKP A;  4R7P A;  3R3R A;  2AES A;  2Y4L A;  1FOA A;  4HO8 A;  3E25 A;  3ST8 A;  1ZJO A;  3CU0 A;  3DK5 A;  5E3R A;  5C47 A;  4M98 A;  1FZW A;  3FSX A;  1VGT A;  2X60 A;  4FRH A;  2QKX A;  2QH5 A;  3TIO A;  2RJ4 A;  1LZ0 A;  3I0C A;  2FYA A;  3OH2 A;  4HO4 A;  4C2S A;  1YP3 A;  5J49 A;  4ECM A;  3POL A;  3VBI A;  1V84 A;  4Y9X A;  4D11 C;  1ZJ3 A;  1VZX A;  4G3P A;  5C48 A;  2FFV A;  1FO8 A;  4P02 A;  4HO3 A;  3VBM A;  4HUS A;  3I0H A;  3VBP A;  3V4E A;  1H7H A;  5C4E A;  1QRG A;  1GQC A;  1ZI1 A;  1O0R A;  5DDV A;  2RIX A;  3NGW A;  1OQM B;  1LL3 A;  1H7L A;  1PZY B;  3CGX A;  4NAK A;  3I0F A;  4ASY A;  2RJ9 A;  2RIZ A;  2VHE A;  2YQS A;  2WAW A;  2ICX A;  2D7R A;  3EH0 A;  5CMI A;  2ZU7 A;  1QRF A;  2W0V A;  5E3Q A;  4MND A;  5C4B A;  1FWY A;  3NZ2 A;  2FKO A;  4M2A A;  2WLG A;  2IUA A;  1VGZ A;  4HZC A;  1H5S C;  5C36 A;  1HM0 A;  2W0W A;  5FV9 A;  3I3A A;  4M2B A;  3FOQ A;  1O7Q A;  1VZU A;  1WVC A;  2JCO A;  3I0K A;  1ON8 A;  3FTT A;  2RJ7 A;  4M28 A;  3DHO A;  3I0J A;  1GA8 A;  2AM5 A;  4FRQ A;  4BMA A;  3R1W A;  2DPW A;  4UEG A;  4K6R A;  1ZCT A;  4Y63 A;  3TWD A;  4FCU A;  2QIV X;  4EQY A;  3TIS A;  3TDT A;  2WLF A;  1H5S B;  4HUR A;  3OH4 A;  4GBP A;  4EVW A;  1LL2 A;  1R7U A;  5IFY A;  3F1Y A;  2XME A;  1TZF A;  4AYJ A;  4E6T A;  2XWL A;  2WLD A;  4HO5 A;  2AQ9 A;  3O3P A;  1KWS A;  1VIC A;  2V0H A;  1G2V A;  4CJ8 A;  2RJ5 A;  1QGQ A;  3Q7U A;  4EE4 A;  1TW5 A;  2OEF A;  1ZI4 A;  5C4D A;  5HS2 A;  1VM8 A;  1MP5 A;  4NAI A;  3V0N A;  2UX8 A;  4MYO A;  3EEV A;  1GWV A;  4G3Q A;  3QVB A;  4Y7V A;  2PA4 A;  3SXG A;  1H5S D;  1FR8 A;  3U2V A;  1H4E A;  3KIA A;  1ZCV A;  2AH9 A;  1O23 B;  2VD4 A;  1INJ A;  1SS9 A;  4FRE A;  3OGZ A;  3MQG A;  2FYB A;  3V91 A;  3ECT A;  3OH3 A;  4FCE A;  2OI5 A;  5EJZ A;  3I0L A;  4HO0 A;  5CQM X;  5FTS A;  1QRM A;  1FXJ A;  1IIN A;  1VH3 A;  3IOH A;  3IXC A;  4CVH A;  3VBK A;  1TW1 A;  5CMJ A;  2AM4 A;  4Y62 A;  1NQI B;  3OAM A;  3ZGG A;  2RIT A;  5FTV A;  5C3D A;  3OW5 A;  4CJB A;  2CU2 A;  2IC7 A;  3SX7 A;  3R2W A;  4KC2 A;  1XHB A;  3TZT A;  4MZU A;  2FYC B;  2P2O A;  3U0X A;  3F1C A;  1G9R A;  3TQD A;  2VS3 A;  3Q4S A;  4EA9 A;  2AE7 A;  2D0J A;  1ZJ2 A;  3V0L A;  3V0P A;  3CKO A;  4HOC A;  4ARW A;  3OC9 A;  2ZU9 A;  3HL3 A;  1EZI A;  1NHE B;  3R5D A;  4EEG A;  3Q80 A;  2ZU8 A;  5CQP A;  1ZCU A;  2A8W A;  5C3B A;  1SSQ A;  3D98 A;  5DEP A;  3R0S A;  1QRL A;  3GVD A;  3RMV A;  2XAT A;  2YC3 A;  3R5C A;  3R3I A;  5ADX U;  4Y6U A;  2I7B A;  2V0L A;  2AEC A;  1W77 A;  5L6V A;  4B2W A;  2YES A;  1H7G A;  1MR7 A;  3IOJ A;  4NAL A;  1E5K A;  1WT1 A;  1KK6 A;  2PGY A;  4E79 A;  4HO2 A;  5C3A A;  1H5S A;  1R82 A;  1JV3 A;  3U2T A;  1HM8 A;  1H7Q A;  1KK4 A;  1HV9 A;  1MRL A;  3CJ8 A;  5E3P A;  4DCL A;  1H7E A;  4FQW A;  5C8R A;  2WE9 A;  1R7Y A;  4B42 A;  4YS8 A;  3SX3 A;  3V0Q A;  1H5T A;  2FY7 A;  1MP4 A;  4IRP A;  2WVK A;  4JD0 A;  1WT0 A;  3VBL A;  1J2Z A;  4KT7 A;  4M99 A;  4E1K A;  4Y7G A;  1TDT A;  1T3D A;  1S4N A;  5CMH A;  4B3U A;  1VPA A;  5I1F A;  2FYD B;  1GQ9 A;  1G97 A;  1WT3 A;  4KC4 A;  4EEA A;  3R5A A;  5DEM A;  1LZI A;  2Y4J A;  3T7N A;  2JF2 A;  3F1X A;  4BQH A;  4KRV A;  1WT2 A;  2GGO A;  1R7T A;  2JCK A;  4N27 A;  4B4G A;  4EE5 A;  1JV1 A;  3I3X A;  1HJJ A;  3USR A;  3FS8 A;  2FFU A;  3T7O A;  1NWG B;  1KQA A;  2VFZ A;  4E6U A;  2D7I A;  2WEE A;  4LW6 A;  2Y7A A;  3ZLL A;  1EYR A;  3CKJ A;  2JF3 A;  3LW6 A;  1VH1 A;  4EA7 A;  5C4F A;  2JCJ A;  1H4C A;  4IHF A;  1NF5 B;  1LXA A;  4HCQ A;  3EG4 A;  1FO9 A;  3BXY A;  5L6S A;  4D48 A;  2V0K A;  3PKQ A;  1H5T B;  2OEG A;  3FSC A;  4MFG A;  3V8Y A;  4M9C A;  1V3W A;  1FGG A;  2V0I A;  2WVL A;  4XWI A;  3KWC A;  5U2K A;  3VNP A;  3HJJ A;  2Q4J A;  3N9W A;  5FUH A;  2WLE A;  1KRR A;  1YP4 A;  1H5R B;  1GX0 A;  5EIY A;  1FXO A;  1KRU A;  2IU9 A;  3IGJ A;  2XWN A;  4IRQ A;  1WSZ A;  1ZDF A;  1OCX A;  4G87 A;  4DDZ A;  1S4O A;  1LZJ A;  1ON6 A;  1R81 A;  3I0E A;  2P6W A;  1K4V A;  1FGX A;  3V0O A;  2YCM A;  3BRK X;  3GOS A;  4KQL A;  3E26 A;  4N69 A;  4Y7T A;  5C1H A;  2RJ0 A;  2WGZ A;  4ZDQ A;  1V83 A;  1W55 A;  5JQQ A;  2WVM A;  5BXC A;  4EAA A;  5FYE A;  4J09 A;  3KWD A;  3SPT A;  2X5S A;  2I5E A;  5FU8 A;  4EA8 A;  5C1G A;  2QIA A;  4CJC A;  1VGW A;  4JIS A;  4ASJ A;  3V90 A;  3USQ A;  3V8Z A;  4R37 A;  3ZLK A;  1MP3 A;  4B4B A;  3OU9 A;  1HJL A;  1JVD A;  4FRB A;  4IHH A;  3FSB A;  2O1F A;  1JYK A;  3D5N A;  2YQH A;  1VZT A;  1G8O A;  2AM3 A;  3ZGF A;  5ADX V;  3JUK A;  3OTM A;  1G23 A;  3JUJ A;  3K8D A;  3BSW A;  4HO9 A;  1FG5 N;  1JYL A;  3SXA A;  4EEM A;  2RJ8 A;  4EGG A;  1QQ0 A;  4MYB A;  5AJO A;  2O1H A;  5C38 A;  5DG3 A;  3IOI A;  1SSM A;  1H4D A;  1G95 A;  1S80 A;  2VS4 A;  3BSY A;  2BO6 A;  2O1G A;  3P47 A;  1OMZ A;  4KC1 A;  2VXM A;  2ICY A;  2P72 A;  1XAT A;  1OMX A;  3OKR A;  3OH1 A;  1NMM B;  1HM9 A;  4B4M A;  1KRV A;  3Q1X A;  5CQL X;  2MZB A;  4AYL A;  2GGQ A;  3SX5 A;  1GWW A;  1IIM A;  3BCV A;  2Y6P A;  1ZCY A;  5C4C A;  1QG8 A;  4LW3 A;  5CMF X;  3JTJ A;  2A8U A;  4B5B A;  3MC4 A;  3MQH A;  2NXV A;  1G3L A;  5DDT A;  3V0M A;  3EE5 A;  4P00 A;  2VSH A;  4R36 A;  4ISX A;  2YC5 A;  1H5R A;  4DE7 A;  3K8E A;  3D8V A;  2IU8 A;  2BO7 A;  3CKV A;  1H7F A;  1O7O A;  4EAB A;  3PMO A;  1S4P A;  3SXE A;  2PGV A;  4J18 A;  1KHR A;  3PNN A;  1H3M A;  1H7T A;  2BO8 A;  4Y6N A;  3VBN A;  5AJP A;  1G0R A;  4HO6 A;  5FU0 A;  4FRA A;  2YQJ A;  3T57 A;  3T7M A;  2TDT A;  3I0D A;  5CQO A;  1ZI5 A;  3SXC A;  1LVW A;  5CQN X;  2RIJ A;  2RJ1 A;  4FRP A;  1ZHJ A;  3RSB A;  1Z90 A;  1TVY A;  2WLC A;  4E75 A;  1INI A;  3U2W A;  3OUP A;  4G3S A;  1ZIZ A;  2APC A;  3DUV A;  1PZT A;  2I5K A;  3GUE A;  1ZJ1 A;  4Y64 A;  1XHD A;  2XWM A;  1MC3 A;  3CKN A;  1FRW A;  2PX7 A;  4NAN A;  2YQC A;  1SST A;  1QGS A;  1GX4 A;  2QGI A;  2P73 A;  3R8Y A;  4Y7F A;  1NKH B;  3HSQ A;  3SXB A;  1ZI3 A;  1YP2 A;  4KXO A;  3FWW A;  1V82 A;  2AGD A;  2BO4 A;  4KNR A;  5C1L A;  3C8V A;  3SRT A;  2VS5 A;  2X65 A;  1R7X A;  1G93 A; 
#chains in the Genus database with same CATH topology
 5C49 A;  4DEC A;  2V0J A;  1R7V A;  4D0T A;  2RIY A;  4FRL A;  4IHG A;  4M4K A;  3GQ9 A;  3OTZ A;  1THJ A;  1JVG A;  1ZJ0 A;  2Y4K A;  5IDS A;  2Z87 A;  1FR9 A;  4H7O A;  4KPX A;  3I0I X;  3KWE A;  4KNX A;  4N6A A;  5CMG X;  3TK8 A;  4HZD A;  3VBJ A;  3BSS A;  2X5Z A;  1VGU A;  2E3D A;  1QWJ A;  2RJ6 A;  1MR9 A;  3FSY A;  1LZ7 A;  3U2U A;  2VXL A;  1ZJP A;  3DJ4 A;  1ZDG A;  2JCL A;  2Y4M A;  3OH0 A;  4KPZ A;  3I0G A;  3RMW A;  1KGQ A;  1QRE A;  3R5B A;  3BFP A;  2XMH A;  1LL0 A;  4Y7U A;  4N6B A;  3TV0 A;  1KGT A;  4FRD A;  4EEO A;  1W57 A;  5AFU V;  5F42 A;  3CKQ A;  1V67 A;  1YRO B;  3ZF8 A;  3SX8 A;  3SXD A;  4B2X A;  5IDT A;  1XZ6 A;  1N4I A;  5AFU U;  2Z86 A;  3U0Y A;  1KK5 A;  1I52 A;  2OI6 A;  3P1B A;  4MIX A;  2NPO A;  4D11 A;  3JQY A;  4HG6 A;  5D92 A;  4L41 C;  4AAW A;  2OI7 A;  4AC3 A;  3U2X A;  4AA7 A;  5EJ1 A;  1R80 A;  2E8B A;  4FRO A;  2VSI A;  4FRM A;  4D0Z A;  1G1L A;  5AJN A;  4EE3 A;  3PKP A;  4R7P A;  3R3R A;  2AES A;  2Y4L A;  1FOA A;  4HO8 A;  3E25 A;  3GQA A;  3ST8 A;  1ZJO A;  3DK5 A;  5E3R A;  3CU0 A;  5C47 A;  4M98 A;  1FZW A;  3FSX A;  1VGT A;  2X60 A;  4FRH A;  2QKX A;  2QH5 A;  3TIO A;  2RJ4 A;  1LZ0 A;  3I0C A;  3OH2 A;  2FYA A;  4HO4 A;  4C2S A;  1YP3 A;  5J49 A;  4ECM A;  3POL A;  3VBI A;  1V84 A;  3GQ8 A;  4Y9X A;  4D11 C;  1ZJ3 A;  1VZX A;  4G3P A;  5C48 A;  2FFV A;  1FO8 A;  4P02 A;  4HO3 A;  3VBM A;  4HUS A;  3I0H A;  3VBP A;  3V4E A;  1H7H A;  5C4E A;  1QRG A;  1GQC A;  1ZI1 A;  1O0R A;  5DDV A;  2RIX A;  3NGW A;  1OQM B;  1LL3 A;  1H7L A;  1PZY B;  3CGX A;  4NAK A;  3I0F A;  4ASY A;  4O6N A;  2RJ9 A;  2RIZ A;  2VHE A;  2YQS A;  1EWW A;  2WAW A;  2ICX A;  2D7R A;  3EH0 A;  5CMI A;  2ZU7 A;  1QRF A;  2W0V A;  5E3Q A;  4MND A;  5C4B A;  1FWY A;  3NZ2 A;  2FKO A;  4M2A A;  2WLG A;  2IUA A;  1VGZ A;  4HZC A;  1H5S C;  5C36 A;  1HM0 A;  2W0W A;  5FV9 A;  3I3A A;  4M2B A;  3FOQ A;  1O7Q A;  1VZU A;  1WVC A;  1Z2F A;  2JCO A;  3I0K A;  4Q7C A;  1ON8 A;  3FTT A;  2RJ7 A;  4M28 A;  3DHO A;  3I0J A;  1GA8 A;  2AM5 A;  4FRQ A;  4BMA A;  3R1W A;  2DPW A;  4UEG A;  4K6R A;  1ZCT A;  4Y63 A;  3TWD A;  4FCU A;  2QIV X;  4EQY A;  3TIS A;  3TDT A;  2WLF A;  1H5S B;  3OH4 A;  4HUR A;  4GBP A;  4EVW A;  1LL2 A;  1R7U A;  5IFY A;  3F1Y A;  2XME A;  1TZF A;  4AYJ A;  4E6T A;  2XWL A;  2WLD A;  4HO5 A;  2AQ9 A;  3O3P A;  1KWS A;  1VIC A;  2V0H A;  1G2V A;  4CJ8 A;  2RJ5 A;  1QGQ A;  3Q7U A;  4EE4 A;  1TW5 A;  2OEF A;  1ZI4 A;  5C4D A;  5HS2 A;  1VM8 A;  1MP5 A;  4NAI A;  3V0N A;  2UX8 A;  4MYO A;  3EEV A;  1GWV A;  4G3Q A;  3QVB A;  4Y7V A;  2PA4 A;  3SXG A;  1H5S D;  1FR8 A;  3U2V A;  1M8N A;  1H4E A;  3KIA A;  1ZCV A;  2AH9 A;  1O23 B;  2VD4 A;  1INJ A;  1SS9 A;  4FRE A;  3OGZ A;  3MQG A;  2FYB A;  3V91 A;  3ECT A;  3OH3 A;  4FCE A;  2OI5 A;  5EJZ A;  3I0L A;  4HO0 A;  5CQM X;  5FTS A;  1QRM A;  1FXJ A;  1IIN A;  1VH3 A;  3IOH A;  3IXC A;  4CVH A;  3VBK A;  1TW1 A;  5CMJ A;  2AM4 A;  4Y62 A;  1NQI B;  3OAM A;  3ZGG A;  2RIT A;  5FTV A;  5C3D A;  3OW5 A;  3GQ7 A;  4CJB A;  2CU2 A;  2IC7 A;  3SX7 A;  1L0S A;  3R2W A;  4KC2 A;  1XHB A;  3TZT A;  4MZU A;  2FYC B;  2P2O A;  3U0X A;  3F1C A;  1G9R A;  3TQD A;  2VS3 A;  3Q4S A;  4EA9 A;  2AE7 A;  2D0J A;  1ZJ2 A;  3V0L A;  3V0P A;  3CKO A;  4HOC A;  4ARW A;  3OC9 A;  2ZU9 A;  4FIY A;  3HL3 A;  1EZI A;  1NHE B;  3R5D A;  4EEG A;  3Q80 A;  2ZU8 A;  5CQP A;  1ZCU A;  2A8W A;  5C3B A;  1SSQ A;  3D98 A;  5DEP A;  3R0S A;  1QRL A;  3GVD A;  3RMV A;  2XAT A;  2YC3 A;  3R5C A;  3R3I A;  5ADX U;  4Y6U A;  2I7B A;  2V0L A;  2AEC A;  1W77 A;  5L6V A;  4B2W A;  2YES A;  1H7G A;  1MR7 A;  3IOJ A;  4NAL A;  1E5K A;  1WT1 A;  1KK6 A;  2PGY A;  4E79 A;  4HO2 A;  5C3A A;  1H5S A;  1R82 A;  1JV3 A;  3U2T A;  1HM8 A;  1H7Q A;  1KK4 A;  1HV9 A;  1MRL A;  3CJ8 A;  5E3P A;  4DCL A;  1H7E A;  4FQW A;  5C8R A;  2WE9 A;  1R7Y A;  5D91 A;  4B42 A;  4YS8 A;  3SX3 A;  3V0Q A;  1H5T A;  2FY7 A;  1MP4 A;  4IRP A;  2WVK A;  4JD0 A;  1WT0 A;  3VBL A;  1J2Z A;  4KT7 A;  4M99 A;  4E1K A;  4Y7G A;  1TDT A;  1T3D A;  1S4N A;  5CMH A;  4B3U A;  1VPA A;  2C0N A;  2FYD B;  5I1F A;  1GQ9 A;  1G97 A;  1WT3 A;  4KC4 A;  4EEA A;  3R5A A;  5DEM A;  1LZI A;  2Y4J A;  3T7N A;  2JF2 A;  3F1X A;  4BQH A;  4KRV A;  1WT2 A;  2GGO A;  1R7T A;  2JCK A;  4N27 A;  4B4G A;  4EE5 A;  1JV1 A;  3I3X A;  1HJJ A;  3USR A;  3FS8 A;  2FFU A;  3T7O A;  1NWG B;  1KQA A;  2VFZ A;  4O6M A;  4E6U A;  2D7I A;  2WEE A;  4LW6 A;  2Y7A A;  3ZLL A;  1EYR A;  3CKJ A;  2JF3 A;  3LW6 A;  1VH1 A;  4EA7 A;  5C4F A;  2JCJ A;  1H4C A;  4IHF A;  1NF5 B;  1LXA A;  4HCQ A;  3EG4 A;  1FO9 A;  3BXY A;  5L6S A;  4D48 A;  2V0K A;  3PKQ A;  1H5T B;  2OEG A;  3FSC A;  4MFG A;  3V8Y A;  4M9C A;  1V3W A;  1FGG A;  2V0I A;  2WVL A;  4XWI A;  3KWC A;  5U2K A;  3VNP A;  3HJJ A;  2Q4J A;  3N9W A;  5FUH A;  2WLE A;  1KRR A;  1YP4 A;  1H5R B;  1GX0 A;  5EIY A;  1FXO A;  1KRU A;  2IU9 A;  3IGJ A;  2J0A A;  2XWN A;  4IRQ A;  1WSZ A;  1ZDF A;  1OCX A;  4G87 A;  4DDZ A;  1S4O A;  1LZJ A;  1ON6 A;  1R81 A;  3I0E A;  2P6W A;  1K4V A;  1FGX A;  3V0O A;  2YCM A;  3BRK X;  3GOS A;  4KQL A;  3E26 A;  4N69 A;  4Y7T A;  5C1H A;  2RJ0 A;  2WGZ A;  4ZDQ A;  1V83 A;  1W55 A;  5JQQ A;  2WVM A;  5BXC A;  4EAA A;  5FYE A;  4J09 A;  3KWD A;  3SPT A;  2X5S A;  2I5E A;  5FU8 A;  4EA8 A;  5C1G A;  2QIA A;  4CJC A;  1VGW A;  4JIS A;  4ASJ A;  3V90 A;  3USQ A;  3V8Z A;  4R37 A;  3ZLK A;  1MP3 A;  4B4B A;  3OU9 A;  1HJL A;  1JVD A;  4FRB A;  4IHH A;  3FSB A;  2O1F A;  1JYK A;  3D5N A;  2YQH A;  1VZT A;  1G8O A;  2AM3 A;  3ZGF A;  5ADX V;  3JUK A;  3OTM A;  1G23 A;  3JUJ A;  3K8D A;  3BSW A;  4HO9 A;  1FG5 N;  1JYL A;  3SXA A;  4EEM A;  2RJ8 A;  4EGG A;  1QQ0 A;  4MYB A;  5AJO A;  2O1H A;  5C38 A;  5DG3 A;  3IOI A;  1SSM A;  1H4D A;  1G95 A;  1S80 A;  2VS4 A;  3BSY A;  2BO6 A;  2O1G A;  3P47 A;  1OMZ A;  4KC1 A;  2VXM A;  2ICY A;  2P72 A;  1XAT A;  1OMX A;  3OKR A;  3OH1 A;  1NMM B;  1HM9 A;  4B4M A;  1KRV A;  3Q1X A;  5CQL X;  2MZB A;  4AYL A;  2GGQ A;  3SX5 A;  1GWW A;  1IIM A;  3BCV A;  2Y6P A;  1ZCY A;  5C4C A;  1QG8 A;  4LW3 A;  5CMF X;  3JTJ A;  2A8U A;  4B5B A;  3MC4 A;  3MQH A;  2NXV A;  1G3L A;  5DDT A;  3V0M A;  3EE5 A;  4P00 A;  2VSH A;  4R36 A;  4ISX A;  2YC5 A;  1H5R A;  4DE7 A;  3K8E A;  3D8V A;  2IU8 A;  2BO7 A;  3CKV A;  1H7F A;  1O7O A;  4EAB A;  3PMO A;  1S4P A;  3SXE A;  2PGV A;  4J18 A;  1KHR A;  3PNN A;  1H3M A;  2J0B A;  1H7T A;  2BO8 A;  2VK9 A;  3VBN A;  4Y6N A;  1G0R A;  4HO6 A;  5AJP A;  5FU0 A;  4FRA A;  2YQJ A;  3T57 A;  3T7M A;  2TDT A;  3I0D A;  3SUC A;  5CQO A;  1ZI5 A;  3SXC A;  1LVW A;  5CQN X;  2RIJ A;  2RJ1 A;  4FRP A;  1ZHJ A;  3RSB A;  1Z90 A;  1TVY A;  2WLC A;  4E75 A;  1INI A;  3U2W A;  3OUP A;  4G3S A;  1ZIZ A;  2APC A;  3DUV A;  1PZT A;  2I5K A;  3GUE A;  1ZJ1 A;  4Y64 A;  1XHD A;  2XWM A;  1MC3 A;  3CKN A;  1FRW A;  2PX7 A;  4NAN A;  2YQC A;  1SST A;  1QGS A;  1GX4 A;  2QGI A;  2P73 A;  3R8Y A;  4Y7F A;  1NKH B;  3HSQ A;  3SXB A;  1ZI3 A;  1YP2 A;  4FIX A;  3FWW A;  4KXO A;  1V82 A;  2AGD A;  2BO4 A;  4KNR A;  5C1L A;  3C8V A;  3SRT A;  2VS5 A;  2X65 A;  1R7X A;  1G93 A; 
#chains in the Genus database with same CATH homology
 5C49 A;  4DEC A;  2V0J A;  1R7V A;  4D0T A;  2RIY A;  4FRL A;  4IHG A;  4M4K A;  3OTZ A;  1THJ A;  1JVG A;  1ZJ0 A;  2Y4K A;  5IDS A;  2Z87 A;  1FR9 A;  4H7O A;  4KPX A;  3I0I X;  3KWE A;  4KNX A;  4N6A A;  5CMG X;  3TK8 A;  4HZD A;  3VBJ A;  3BSS A;  2X5Z A;  1VGU A;  2E3D A;  1QWJ A;  2RJ6 A;  1MR9 A;  3FSY A;  1LZ7 A;  3U2U A;  2VXL A;  1ZJP A;  3DJ4 A;  1ZDG A;  2JCL A;  2Y4M A;  4KPZ A;  3I0G A;  3OH0 A;  3RMW A;  1KGQ A;  1QRE A;  3R5B A;  3BFP A;  2XMH A;  1LL0 A;  4Y7U A;  4N6B A;  3TV0 A;  1KGT A;  4FRD A;  4EEO A;  1W57 A;  5AFU V;  5F42 A;  3CKQ A;  1V67 A;  1YRO B;  3ZF8 A;  3SX8 A;  3SXD A;  4B2X A;  5IDT A;  1XZ6 A;  5AFU U;  2Z86 A;  3U0Y A;  1KK5 A;  1I52 A;  2OI6 A;  3P1B A;  4MIX A;  2NPO A;  4D11 A;  3JQY A;  4HG6 A;  5D92 A;  4L41 C;  4AAW A;  2OI7 A;  4AC3 A;  3U2X A;  4AA7 A;  5EJ1 A;  1R80 A;  2E8B A;  4FRO A;  2VSI A;  4FRM A;  4D0Z A;  1G1L A;  5AJN A;  4EE3 A;  3PKP A;  4R7P A;  3R3R A;  2AES A;  2Y4L A;  1FOA A;  4HO8 A;  3E25 A;  3ST8 A;  1ZJO A;  3CU0 A;  3DK5 A;  5E3R A;  5C47 A;  4M98 A;  1FZW A;  3FSX A;  1VGT A;  2X60 A;  4FRH A;  2QKX A;  2QH5 A;  3TIO A;  2RJ4 A;  1LZ0 A;  3I0C A;  2FYA A;  3OH2 A;  4HO4 A;  4C2S A;  1YP3 A;  5J49 A;  4ECM A;  3POL A;  3VBI A;  1V84 A;  4Y9X A;  4D11 C;  1ZJ3 A;  1VZX A;  4G3P A;  5C48 A;  2FFV A;  1FO8 A;  4P02 A;  4HO3 A;  3VBM A;  4HUS A;  3I0H A;  3VBP A;  3V4E A;  1H7H A;  5C4E A;  1QRG A;  1GQC A;  1ZI1 A;  1O0R A;  5DDV A;  2RIX A;  3NGW A;  1OQM B;  1LL3 A;  1H7L A;  1PZY B;  3CGX A;  4NAK A;  3I0F A;  4ASY A;  4O6N A;  2RJ9 A;  2RIZ A;  2VHE A;  2YQS A;  2WAW A;  2ICX A;  2D7R A;  3EH0 A;  5CMI A;  2ZU7 A;  1QRF A;  2W0V A;  5E3Q A;  4MND A;  5C4B A;  1FWY A;  3NZ2 A;  2FKO A;  4M2A A;  2WLG A;  2IUA A;  1VGZ A;  4HZC A;  1H5S C;  5C36 A;  1HM0 A;  2W0W A;  5FV9 A;  3I3A A;  4M2B A;  3FOQ A;  1O7Q A;  1VZU A;  1WVC A;  2JCO A;  3I0K A;  4Q7C A;  1ON8 A;  3FTT A;  2RJ7 A;  4M28 A;  3DHO A;  3I0J A;  1GA8 A;  2AM5 A;  4FRQ A;  4BMA A;  3R1W A;  2DPW A;  4UEG A;  4K6R A;  1ZCT A;  4Y63 A;  3TWD A;  4FCU A;  2QIV X;  4EQY A;  3TIS A;  3TDT A;  2WLF A;  1H5S B;  4HUR A;  3OH4 A;  4GBP A;  4EVW A;  1LL2 A;  1R7U A;  5IFY A;  3F1Y A;  2XME A;  1TZF A;  4AYJ A;  4E6T A;  2XWL A;  2WLD A;  4HO5 A;  2AQ9 A;  3O3P A;  1KWS A;  1VIC A;  2V0H A;  1G2V A;  4CJ8 A;  2RJ5 A;  1QGQ A;  3Q7U A;  4EE4 A;  1TW5 A;  2OEF A;  1ZI4 A;  5C4D A;  5HS2 A;  1VM8 A;  1MP5 A;  4NAI A;  3V0N A;  2UX8 A;  4MYO A;  3EEV A;  1GWV A;  4G3Q A;  3QVB A;  4Y7V A;  2PA4 A;  3SXG A;  1H5S D;  1FR8 A;  3U2V A;  1H4E A;  3KIA A;  1ZCV A;  2AH9 A;  1O23 B;  2VD4 A;  1INJ A;  1SS9 A;  4FRE A;  3OGZ A;  3MQG A;  2FYB A;  3V91 A;  3ECT A;  3OH3 A;  4FCE A;  2OI5 A;  5EJZ A;  3I0L A;  4HO0 A;  5CQM X;  5FTS A;  1QRM A;  1FXJ A;  1IIN A;  1VH3 A;  3IOH A;  3IXC A;  4CVH A;  3VBK A;  1TW1 A;  5CMJ A;  2AM4 A;  4Y62 A;  1NQI B;  3OAM A;  3ZGG A;  2RIT A;  5FTV A;  5C3D A;  3OW5 A;  4CJB A;  2CU2 A;  2IC7 A;  3SX7 A;  3R2W A;  4KC2 A;  1XHB A;  3TZT A;  4MZU A;  2FYC B;  2P2O A;  3U0X A;  3F1C A;  1G9R A;  3TQD A;  2VS3 A;  3Q4S A;  4EA9 A;  2AE7 A;  2D0J A;  1ZJ2 A;  3V0L A;  3V0P A;  3CKO A;  4HOC A;  4ARW A;  3OC9 A;  2ZU9 A;  4FIY A;  3HL3 A;  1EZI A;  1NHE B;  3R5D A;  4EEG A;  3Q80 A;  2ZU8 A;  5CQP A;  1ZCU A;  2A8W A;  5C3B A;  1SSQ A;  3D98 A;  5DEP A;  3R0S A;  1QRL A;  3GVD A;  3RMV A;  2XAT A;  2YC3 A;  3R5C A;  3R3I A;  5ADX U;  4Y6U A;  2I7B A;  2V0L A;  2AEC A;  1W77 A;  5L6V A;  4B2W A;  2YES A;  1H7G A;  1MR7 A;  3IOJ A;  4NAL A;  1E5K A;  1WT1 A;  1KK6 A;  2PGY A;  4E79 A;  4HO2 A;  5C3A A;  1H5S A;  1R82 A;  1JV3 A;  3U2T A;  1HM8 A;  1H7Q A;  1KK4 A;  1HV9 A;  1MRL A;  3CJ8 A;  5E3P A;  4DCL A;  1H7E A;  4FQW A;  5C8R A;  2WE9 A;  1R7Y A;  5D91 A;  4B42 A;  4YS8 A;  3SX3 A;  3V0Q A;  1H5T A;  2FY7 A;  1MP4 A;  4IRP A;  2WVK A;  4JD0 A;  1WT0 A;  3VBL A;  1J2Z A;  4KT7 A;  4M99 A;  4E1K A;  4Y7G A;  1TDT A;  1T3D A;  1S4N A;  5CMH A;  4B3U A;  1VPA A;  2C0N A;  2FYD B;  5I1F A;  1GQ9 A;  1G97 A;  1WT3 A;  4KC4 A;  4EEA A;  3R5A A;  5DEM A;  1LZI A;  2Y4J A;  3T7N A;  2JF2 A;  3F1X A;  4BQH A;  4KRV A;  1WT2 A;  2GGO A;  1R7T A;  2JCK A;  4N27 A;  4B4G A;  4EE5 A;  1JV1 A;  3I3X A;  1HJJ A;  3USR A;  3FS8 A;  2FFU A;  3T7O A;  1NWG B;  1KQA A;  2VFZ A;  4O6M A;  4E6U A;  2D7I A;  2WEE A;  4LW6 A;  2Y7A A;  3ZLL A;  1EYR A;  3CKJ A;  2JF3 A;  3LW6 A;  1VH1 A;  4EA7 A;  5C4F A;  2JCJ A;  1H4C A;  4IHF A;  1NF5 B;  1LXA A;  4HCQ A;  3EG4 A;  1FO9 A;  3BXY A;  5L6S A;  4D48 A;  2V0K A;  3PKQ A;  1H5T B;  2OEG A;  3FSC A;  4MFG A;  3V8Y A;  4M9C A;  1V3W A;  1FGG A;  2V0I A;  2WVL A;  4XWI A;  3KWC A;  5U2K A;  3VNP A;  3HJJ A;  2Q4J A;  3N9W A;  5FUH A;  2WLE A;  1KRR A;  1YP4 A;  1H5R B;  1GX0 A;  5EIY A;  1FXO A;  1KRU A;  2IU9 A;  3IGJ A;  2J0A A;  2XWN A;  4IRQ A;  1WSZ A;  1ZDF A;  1OCX A;  4G87 A;  4DDZ A;  1S4O A;  1LZJ A;  1ON6 A;  1R81 A;  3I0E A;  2P6W A;  1K4V A;  1FGX A;  3V0O A;  2YCM A;  3BRK X;  3GOS A;  4KQL A;  3E26 A;  4N69 A;  4Y7T A;  5C1H A;  2RJ0 A;  2WGZ A;  4ZDQ A;  1V83 A;  1W55 A;  5JQQ A;  2WVM A;  5BXC A;  4EAA A;  5FYE A;  4J09 A;  3KWD A;  3SPT A;  2X5S A;  2I5E A;  5FU8 A;  4EA8 A;  5C1G A;  2QIA A;  4CJC A;  1VGW A;  4JIS A;  4ASJ A;  3V90 A;  3USQ A;  3V8Z A;  4R37 A;  3ZLK A;  1MP3 A;  4B4B A;  3OU9 A;  1HJL A;  1JVD A;  4FRB A;  4IHH A;  3FSB A;  2O1F A;  1JYK A;  3D5N A;  2YQH A;  1VZT A;  1G8O A;  2AM3 A;  3ZGF A;  5ADX V;  3JUK A;  3OTM A;  1G23 A;  3JUJ A;  3K8D A;  3BSW A;  4HO9 A;  1FG5 N;  1JYL A;  3SXA A;  4EEM A;  2RJ8 A;  4EGG A;  1QQ0 A;  4MYB A;  5AJO A;  2O1H A;  5C38 A;  5DG3 A;  3IOI A;  1SSM A;  1H4D A;  1G95 A;  1S80 A;  2VS4 A;  3BSY A;  2BO6 A;  2O1G A;  3P47 A;  1OMZ A;  4KC1 A;  2VXM A;  2ICY A;  2P72 A;  1XAT A;  1OMX A;  3OKR A;  3OH1 A;  1NMM B;  1HM9 A;  4B4M A;  1KRV A;  3Q1X A;  5CQL X;  2MZB A;  4AYL A;  2GGQ A;  3SX5 A;  1GWW A;  1IIM A;  3BCV A;  2Y6P A;  1ZCY A;  5C4C A;  1QG8 A;  4LW3 A;  5CMF X;  3JTJ A;  2A8U A;  4B5B A;  3MC4 A;  3MQH A;  2NXV A;  1G3L A;  5DDT A;  3V0M A;  3EE5 A;  4P00 A;  2VSH A;  4R36 A;  4ISX A;  2YC5 A;  1H5R A;  4DE7 A;  3K8E A;  3D8V A;  2IU8 A;  2BO7 A;  3CKV A;  1H7F A;  1O7O A;  4EAB A;  3PMO A;  1S4P A;  3SXE A;  2PGV A;  4J18 A;  1KHR A;  3PNN A;  1H3M A;  2J0B A;  1H7T A;  2BO8 A;  2VK9 A;  3VBN A;  4Y6N A;  1G0R A;  4HO6 A;  5AJP A;  5FU0 A;  4FRA A;  2YQJ A;  3T57 A;  3T7M A;  2TDT A;  3I0D A;  5CQO A;  1ZI5 A;  3SXC A;  1LVW A;  5CQN X;  2RIJ A;  2RJ1 A;  4FRP A;  1ZHJ A;  3RSB A;  1Z90 A;  1TVY A;  2WLC A;  4E75 A;  1INI A;  3U2W A;  3OUP A;  4G3S A;  1ZIZ A;  2APC A;  3DUV A;  1PZT A;  2I5K A;  3GUE A;  1ZJ1 A;  4Y64 A;  1XHD A;  2XWM A;  1MC3 A;  3CKN A;  1FRW A;  2PX7 A;  4NAN A;  2YQC A;  1SST A;  1QGS A;  1GX4 A;  2QGI A;  2P73 A;  3R8Y A;  4Y7F A;  1NKH B;  3HSQ A;  3SXB A;  1ZI3 A;  1YP2 A;  4FIX A;  3FWW A;  4KXO A;  1V82 A;  2AGD A;  2BO4 A;  4KNR A;  5C1L A;  3C8V A;  3SRT A;  2VS5 A;  2X65 A;  1R7X A;  1G93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...