3VNPA

Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
GMIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYKALQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical conserved protein
publication title Crystal structure of hypothetical protein (GK2848) from Geobacillus Kaustophilus
rcsb
source organism Geobacillus kaustophilus
total genus 69
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3vnpA00
1Z90A 1KRRA 1MR9A 4DCLA 2QKXA 4HURA 1YP2A 1MR7A 4ISXA 3KWEA 4AC3A 4IHGA 1HM8A 4KNRA 3KWCA 1KGTA 1FXJA 1J2ZA 3R1WA 5E3PA 1KK6A 2V0LA 4R36A 4R37A 3ST8A 5L6VA 3VBJA 3R2WA 3VBIA 5ADXV 3BFPA 3C8VA 4E1KA 3NZ2A 2XATA 2OI6A 1XHDA 4KNXA 1KGQA 1QQ0A 4M28A 3TWDA 3BSWA 4H7OA 3FTTA 3Q1XA 5F42A 3VBNA 2V0IA 3BXYA 3R5BA 1QRLA 3PMOA 3OTZA 3BSYA 3EH0A 4G3SA 2QIVX 1MRLA 2WLDA 3R5CA 3R3RA 3MC4A 3R8YA 4MYOA 2WLEA 5AFUV 2I5KA 5L6SA 1QREA 3V4EA 5E3QA 2IU9A 3F1XA 3EEVA 3R5AA 3P47A 3I3XA 3BSSA 4AAWA 1QRGA 5U2KA 3MQHA 3SPTA 1TDTA 2VHEA 4M2BA 3GVDA 4E6UA 3R0SA 1QRMA 3SRTA 1HV9A 2IC7A 2QIAA 3VBKA 2ICYA 3FWWA 2GGOA 4R7PA 2JF3A 4J18A 1HM9A 3HSQA 3CJ8A 1YP3A 2V0JA 1KHRA 3HJJA 2W0VA 1SSMA 3MQGA 5ADXU 3VBMA 3GUEA 4HZDA 3D98A 3I3AA 4K6RA 3OTMA 2P2OA 4M98A 4KPXA 4E75A 1G97A 5DEMA 3TISA 2Q4JA 3FSXA 2IU8A 3KWDA 3TV0A 1XATA 4N6AA 3EG4A 3R3IA 1KRVA 2JF2A 1YP4A 1SSTA 3JQYA 2WLGA 1HM0A 4FCEA 5AFUU 4AA7A 4KQLA 2WLCA 1KRUA 1KK4A 4N6BA 3DJ4A 4G3PA 4EAAA 3VBLA 3OU9A 4IHHA 4KPZA 2VD4A 3FOQA 3FSCA 4EA8A 3DK5A 4MZUA 3TK8A 4E79A 2AQ9A 4HUSA 4IHFA 4EA7A 2ICXA 2OI5A 4HZCA 4J09A 4E6TA 5DG3A 1S80A 1T3DA 4M99A 1THJA 3BRKX 3OUPA 2RIJA 4N69A 2NPOA 4EABA 3T57A 3OW5A 4M9CA 5DEPA 3GOSA 1G95A 1KK5A 1QRFA 2V0HA 3FSBA 2TDTA 3R5DA 4G3QA 2IUAA 1FWYA 3FS8A 1V67A 3VBPA 3IGJA 3D8VA 1SSQA 5E3RA 4HCQA 2FKOA 2OI7A 3FSYA 3P1BA 4M2AA 4EGGA 1OCXA 3TDTA 3DHOA 2WLFA 4EQYA 4G87A 3ECTA 3IXCA 1KQAA 4MFGA 4EA9A 1V3WA 2W0WA 2OEFA 4N27A 3VNPA 3TIOA 1LXAA 2GGQA 2OEGA 2V0KA
chains in the Genus database with same CATH superfamily
1Z90A 1KRRA 1MR9A 4DCLA 2QKXA 4HURA 1YP2A 1MR7A 4ISXA 3KWEA 3OH3A 4IHGA 4AC3A 1HM8A 4KNRA 3KWCA 1KGTA 1FXJA 1J2ZA 3R1WA 5E3PA 1KK6A 2V0LA 4R36A 4R37A 3ST8A 5L6VA 3VBJA 3R2WA 3VBIA 3OH4A 5ADXV 3BFPA 3C8VA 4E1KA 3NZ2A 2XATA 2OI6A 1XHDA 4KNXA 1KGQA 1QQ0A 4M28A 3TWDA 3BSWA 4H7OA 3FTTA 3Q1XA 5F42A 3VBNA 2V0IA 3BXYA 3R5BA 1QRLA 3PMOA 3OTZA 3BSYA 4EGGA 3EH0A 4G3SA 2QIVX 1MRLA 2WLDA 3TDTA 3R5CA 3R3RA 3OGZA 3MC4A 3R8YA 4MYOA 2WLEA 5AFUV 2I5KA 5L6SA 1QREA 3V4EA 5E3QA 2IU9A 3F1XA 1N4IA 3EEVA 3R5AA 3P47A 3I3XA 3BSSA 4AAWA 1QRGA 5U2KA 3SUCA 3MQHA 3SPTA 1TDTA 2VHEA 1Z2FA 4M2BA 3GVDA 4E6UA 3R0SA 1QRMA 3SRTA 1HV9A 2IC7A 2QIAA 3VBKA 2ICYA 3FWWA 2GGOA 4R7PA 2JF3A 4J18A 1HM9A 3HSQA 3OH0A 3CJ8A 1YP3A 2V0JA 1KHRA 3HJJA 2W0VA 1SSMA 3MQGA 5ADXU 3VBMA 3GUEA 4HZDA 3D98A 3I3AA 4K6RA 3OTMA 2P2OA 4M98A 4KPXA 4E75A 1G97A 5DEMA 3TISA 2Q4JA 3FSXA 2IU8A 3KWDA 3TV0A 1XATA 4N6AA 3EG4A 3R3IA 1KRVA 2JF2A 1YP4A 1M8NA 1SSTA 2WLGA 1HM0A 3JQYA 4FCEA 5AFUU 4AA7A 3GQ8A 4KQLA 2WLCA 1KRUA 3GQ7A 1KK4A 4N6BA 3DJ4A 4G3PA 4EAAA 3VBLA 3OU9A 4IHHA 4KPZA 2VD4A 3FOQA 3FSCA 4EA8A 3DK5A 4MZUA 3TK8A 4E79A 2AQ9A 4HUSA 4IHFA 4EA7A 2ICXA 2OI5A 3OH2A 4HZCA 4J09A 4E6TA 5DG3A 1S80A 1T3DA 4M99A 1THJA 3BRKX 3OUPA 2RIJA 3GQAA 4N69A 2NPOA 4EABA 4EQYA 3T57A 3OW5A 4M9CA 5DEPA 3GOSA 1G95A 1KK5A 1QRFA 2V0HA 3FSBA 2TDTA 3R5DA 4G3QA 2IUAA 1FWYA 3FS8A 1V67A 3VBPA 3IGJA 3D8VA 1SSQA 1EWWA 5E3RA 4HCQA 2FKOA 2OI7A 1L0SA 3FSYA 3GQ9A 3OH1A 1OCXA 3P1BA 3DHOA 2WLFA 4M2AA 4G87A 3ECTA 3IXCA 1KQAA 4MFGA 4EA9A 1V3WA 2W0WA 2OEFA 4N27A 3VNPA 3TIOA 1LXAA 2GGQA 2OEGA 2V0KA
chains in the Genus database with same CATH topology
1Z90A 1KRRA 1MR9A 4DCLA 2QKXA 4HURA 1YP2A 1MR7A 4ISXA 3KWEA 4AC3A 4IHGA 1HM8A 4KNRA 3KWCA 1KGTA 1FXJA 1J2ZA 3R1WA 5E3PA 1KK6A 2V0LA 4R36A 4R37A 3ST8A 5L6VA 3VBJA 3R2WA 3VBIA 5ADXV 3BFPA 3C8VA 4E1KA 3NZ2A 2XATA 2OI6A 1XHDA 4KNXA 1KGQA 1QQ0A 4M28A 3TWDA 3BSWA 4H7OA 3FTTA 3Q1XA 5F42A 3VBNA 2V0IA 3BXYA 3R5BA 1QRLA 3PMOA 3OTZA 3BSYA 3EH0A 4G3SA 2QIVX 1MRLA 2WLDA 3R5CA 3R3RA 3MC4A 3R8YA 4MYOA 2WLEA 5AFUV 2I5KA 5L6SA 1QREA 3V4EA 5E3QA 2IU9A 3F1XA 3EEVA 3R5AA 3P47A 3I3XA 3BSSA 4AAWA 1QRGA 5U2KA 3MQHA 3SPTA 1TDTA 2VHEA 4M2BA 3GVDA 4E6UA 3R0SA 1QRMA 3SRTA 1HV9A 2IC7A 2QIAA 3VBKA 2ICYA 3FWWA 2GGOA 4R7PA 2JF3A 4J18A 1HM9A 3HSQA 3CJ8A 1YP3A 2V0JA 1KHRA 3HJJA 2W0VA 1SSMA 3MQGA 5ADXU 3VBMA 3GUEA 4HZDA 3D98A 3I3AA 4K6RA 3OTMA 2P2OA 4M98A 4KPXA 4E75A 1G97A 5DEMA 3TISA 2Q4JA 3FSXA 2IU8A 3KWDA 3TV0A 1XATA 4N6AA 3EG4A 3R3IA 1KRVA 2JF2A 1YP4A 1SSTA 3JQYA 2WLGA 1HM0A 4FCEA 5AFUU 4AA7A 4KQLA 2WLCA 1KRUA 1KK4A 4N6BA 3DJ4A 4G3PA 4EAAA 3VBLA 3OU9A 4IHHA 4KPZA 2VD4A 3FOQA 3FSCA 4EA8A 3DK5A 4MZUA 3TK8A 4E79A 2AQ9A 4HUSA 4IHFA 4EA7A 2ICXA 2OI5A 4HZCA 4J09A 4E6TA 5DG3A 1S80A 1T3DA 4M99A 1THJA 3BRKX 3OUPA 2RIJA 4N69A 2NPOA 4EABA 3T57A 3OW5A 4M9CA 5DEPA 3GOSA 1G95A 1KK5A 1QRFA 2V0HA 3FSBA 2TDTA 3R5DA 4G3QA 2IUAA 1FWYA 3FS8A 1V67A 3VBPA 3IGJA 3D8VA 1SSQA 5E3RA 4HCQA 2FKOA 2OI7A 3FSYA 3P1BA 4M2AA 4EGGA 1OCXA 3TDTA 3DHOA 2WLFA 4EQYA 4G87A 3ECTA 3IXCA 1KQAA 4MFGA 4EA9A 1V3WA 2W0WA 2OEFA 4N27A 3VNPA 3TIOA 1LXAA 2GGQA 2OEGA 2V0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z90 A;  1KRR A;  1MR9 A;  4DCL A;  2QKX A;  4HUR A;  1YP2 A;  1MR7 A;  4ISX A;  3KWE A;  4AC3 A;  4IHG A;  1HM8 A;  4KNR A;  3KWC A;  1KGT A;  1FXJ A;  1J2Z A;  3R1W A;  5E3P A;  1KK6 A;  2V0L A;  4R36 A;  4R37 A;  3ST8 A;  5L6V A;  3VBJ A;  3R2W A;  3VBI A;  5ADX V;  3BFP A;  3C8V A;  4E1K A;  3NZ2 A;  2XAT A;  2OI6 A;  1XHD A;  4KNX A;  1KGQ A;  1QQ0 A;  4M28 A;  3TWD A;  3BSW A;  4H7O A;  3FTT A;  3Q1X A;  5F42 A;  3VBN A;  2V0I A;  3BXY A;  3R5B A;  1QRL A;  3PMO A;  3OTZ A;  3BSY A;  3EH0 A;  4G3S A;  2QIV X;  1MRL A;  2WLD A;  3R5C A;  3R3R A;  3MC4 A;  3R8Y A;  4MYO A;  2WLE A;  5AFU V;  2I5K A;  5L6S A;  1QRE A;  3V4E A;  5E3Q A;  2IU9 A;  3F1X A;  3EEV A;  3R5A A;  3P47 A;  3I3X A;  3BSS A;  4AAW A;  1QRG A;  5U2K A;  3MQH A;  3SPT A;  1TDT A;  2VHE A;  4M2B A;  3GVD A;  4E6U A;  3R0S A;  1QRM A;  3SRT A;  1HV9 A;  2IC7 A;  2QIA A;  3VBK A;  2ICY A;  3FWW A;  2GGO A;  4R7P A;  2JF3 A;  4J18 A;  1HM9 A;  3HSQ A;  3CJ8 A;  1YP3 A;  2V0J A;  1KHR A;  3HJJ A;  2W0V A;  1SSM A;  3MQG A;  5ADX U;  3VBM A;  3GUE A;  4HZD A;  3D98 A;  3I3A A;  4K6R A;  3OTM A;  2P2O A;  4M98 A;  4KPX A;  4E75 A;  1G97 A;  5DEM A;  3TIS A;  2Q4J A;  3FSX A;  2IU8 A;  3KWD A;  3TV0 A;  1XAT A;  4N6A A;  3EG4 A;  3R3I A;  1KRV A;  2JF2 A;  1YP4 A;  1SST A;  3JQY A;  2WLG A;  1HM0 A;  4FCE A;  5AFU U;  4AA7 A;  4KQL A;  2WLC A;  1KRU A;  1KK4 A;  4N6B A;  3DJ4 A;  4G3P A;  4EAA A;  3VBL A;  3OU9 A;  4IHH A;  4KPZ A;  2VD4 A;  3FOQ A;  3FSC A;  4EA8 A;  3DK5 A;  4MZU A;  3TK8 A;  4E79 A;  2AQ9 A;  4HUS A;  4IHF A;  4EA7 A;  2ICX A;  2OI5 A;  4HZC A;  4J09 A;  4E6T A;  5DG3 A;  1S80 A;  1T3D A;  4M99 A;  1THJ A;  3BRK X;  3OUP A;  2RIJ A;  4N69 A;  2NPO A;  4EAB A;  3T57 A;  3OW5 A;  4M9C A;  5DEP A;  3GOS A;  1G95 A;  1KK5 A;  1QRF A;  2V0H A;  3FSB A;  2TDT A;  3R5D A;  4G3Q A;  2IUA A;  1FWY A;  3FS8 A;  1V67 A;  3VBP A;  3IGJ A;  3D8V A;  1SSQ A;  5E3R A;  4HCQ A;  2FKO A;  2OI7 A;  3FSY A;  3P1B A;  4M2A A;  4EGG A;  1OCX A;  3TDT A;  3DHO A;  2WLF A;  4EQY A;  4G87 A;  3ECT A;  3IXC A;  1KQA A;  4MFG A;  4EA9 A;  1V3W A;  2W0W A;  2OEF A;  4N27 A;  3VNP A;  3TIO A;  1LXA A;  2GGQ A;  2OEG A;  2V0K A; 
#chains in the Genus database with same CATH topology
 1Z90 A;  1KRR A;  1MR9 A;  4DCL A;  2QKX A;  4HUR A;  1YP2 A;  1MR7 A;  4ISX A;  3KWE A;  3OH3 A;  4IHG A;  4AC3 A;  1HM8 A;  4KNR A;  3KWC A;  1KGT A;  1FXJ A;  1J2Z A;  3R1W A;  5E3P A;  1KK6 A;  2V0L A;  4R36 A;  4R37 A;  3ST8 A;  5L6V A;  3VBJ A;  3R2W A;  3VBI A;  3OH4 A;  5ADX V;  3BFP A;  3C8V A;  4E1K A;  3NZ2 A;  2XAT A;  2OI6 A;  1XHD A;  4KNX A;  1KGQ A;  1QQ0 A;  4M28 A;  3TWD A;  3BSW A;  4H7O A;  3FTT A;  3Q1X A;  5F42 A;  3VBN A;  2V0I A;  3BXY A;  3R5B A;  1QRL A;  3PMO A;  3OTZ A;  3BSY A;  4EGG A;  3EH0 A;  4G3S A;  2QIV X;  1MRL A;  2WLD A;  3TDT A;  3R5C A;  3R3R A;  3OGZ A;  3MC4 A;  3R8Y A;  4MYO A;  2WLE A;  5AFU V;  2I5K A;  5L6S A;  1QRE A;  3V4E A;  5E3Q A;  2IU9 A;  3F1X A;  1N4I A;  3EEV A;  3R5A A;  3P47 A;  3I3X A;  3BSS A;  4AAW A;  1QRG A;  5U2K A;  3SUC A;  3MQH A;  3SPT A;  1TDT A;  2VHE A;  1Z2F A;  4M2B A;  3GVD A;  4E6U A;  3R0S A;  1QRM A;  3SRT A;  1HV9 A;  2IC7 A;  2QIA A;  3VBK A;  2ICY A;  3FWW A;  2GGO A;  4R7P A;  2JF3 A;  4J18 A;  1HM9 A;  3HSQ A;  3OH0 A;  3CJ8 A;  1YP3 A;  2V0J A;  1KHR A;  3HJJ A;  2W0V A;  1SSM A;  3MQG A;  5ADX U;  3VBM A;  3GUE A;  4HZD A;  3D98 A;  3I3A A;  4K6R A;  3OTM A;  2P2O A;  4M98 A;  4KPX A;  4E75 A;  1G97 A;  5DEM A;  3TIS A;  2Q4J A;  3FSX A;  2IU8 A;  3KWD A;  3TV0 A;  1XAT A;  4N6A A;  3EG4 A;  3R3I A;  1KRV A;  2JF2 A;  1YP4 A;  1M8N A;  1SST A;  2WLG A;  1HM0 A;  3JQY A;  4FCE A;  5AFU U;  4AA7 A;  3GQ8 A;  4KQL A;  2WLC A;  1KRU A;  3GQ7 A;  1KK4 A;  4N6B A;  3DJ4 A;  4G3P A;  4EAA A;  3VBL A;  3OU9 A;  4IHH A;  4KPZ A;  2VD4 A;  3FOQ A;  3FSC A;  4EA8 A;  3DK5 A;  4MZU A;  3TK8 A;  4E79 A;  2AQ9 A;  4HUS A;  4IHF A;  4EA7 A;  2ICX A;  2OI5 A;  3OH2 A;  4HZC A;  4J09 A;  4E6T A;  5DG3 A;  1S80 A;  1T3D A;  4M99 A;  1THJ A;  3BRK X;  3OUP A;  2RIJ A;  3GQA A;  4N69 A;  2NPO A;  4EAB A;  4EQY A;  3T57 A;  3OW5 A;  4M9C A;  5DEP A;  3GOS A;  1G95 A;  1KK5 A;  1QRF A;  2V0H A;  3FSB A;  2TDT A;  3R5D A;  4G3Q A;  2IUA A;  1FWY A;  3FS8 A;  1V67 A;  3VBP A;  3IGJ A;  3D8V A;  1SSQ A;  1EWW A;  5E3R A;  4HCQ A;  2FKO A;  2OI7 A;  1L0S A;  3FSY A;  3GQ9 A;  3OH1 A;  1OCX A;  3P1B A;  3DHO A;  2WLF A;  4M2A A;  4G87 A;  3ECT A;  3IXC A;  1KQA A;  4MFG A;  4EA9 A;  1V3W A;  2W0W A;  2OEF A;  4N27 A;  3VNP A;  3TIO A;  1LXA A;  2GGQ A;  2OEG A;  2V0K A; 
#chains in the Genus database with same CATH homology
 1Z90 A;  1KRR A;  1MR9 A;  4DCL A;  2QKX A;  4HUR A;  1YP2 A;  1MR7 A;  4ISX A;  3KWE A;  4AC3 A;  4IHG A;  1HM8 A;  4KNR A;  3KWC A;  1KGT A;  1FXJ A;  1J2Z A;  3R1W A;  5E3P A;  1KK6 A;  2V0L A;  4R36 A;  4R37 A;  3ST8 A;  5L6V A;  3VBJ A;  3R2W A;  3VBI A;  5ADX V;  3BFP A;  3C8V A;  4E1K A;  3NZ2 A;  2XAT A;  2OI6 A;  1XHD A;  4KNX A;  1KGQ A;  1QQ0 A;  4M28 A;  3TWD A;  3BSW A;  4H7O A;  3FTT A;  3Q1X A;  5F42 A;  3VBN A;  2V0I A;  3BXY A;  3R5B A;  1QRL A;  3PMO A;  3OTZ A;  3BSY A;  3EH0 A;  4G3S A;  2QIV X;  1MRL A;  2WLD A;  3R5C A;  3R3R A;  3MC4 A;  3R8Y A;  4MYO A;  2WLE A;  5AFU V;  2I5K A;  5L6S A;  1QRE A;  3V4E A;  5E3Q A;  2IU9 A;  3F1X A;  3EEV A;  3R5A A;  3P47 A;  3I3X A;  3BSS A;  4AAW A;  1QRG A;  5U2K A;  3MQH A;  3SPT A;  1TDT A;  2VHE A;  4M2B A;  3GVD A;  4E6U A;  3R0S A;  1QRM A;  3SRT A;  1HV9 A;  2IC7 A;  2QIA A;  3VBK A;  2ICY A;  3FWW A;  2GGO A;  4R7P A;  2JF3 A;  4J18 A;  1HM9 A;  3HSQ A;  3CJ8 A;  1YP3 A;  2V0J A;  1KHR A;  3HJJ A;  2W0V A;  1SSM A;  3MQG A;  5ADX U;  3VBM A;  3GUE A;  4HZD A;  3D98 A;  3I3A A;  4K6R A;  3OTM A;  2P2O A;  4M98 A;  4KPX A;  4E75 A;  1G97 A;  5DEM A;  3TIS A;  2Q4J A;  3FSX A;  2IU8 A;  3KWD A;  3TV0 A;  1XAT A;  4N6A A;  3EG4 A;  3R3I A;  1KRV A;  2JF2 A;  1YP4 A;  1SST A;  3JQY A;  2WLG A;  1HM0 A;  4FCE A;  5AFU U;  4AA7 A;  4KQL A;  2WLC A;  1KRU A;  1KK4 A;  4N6B A;  3DJ4 A;  4G3P A;  4EAA A;  3VBL A;  3OU9 A;  4IHH A;  4KPZ A;  2VD4 A;  3FOQ A;  3FSC A;  4EA8 A;  3DK5 A;  4MZU A;  3TK8 A;  4E79 A;  2AQ9 A;  4HUS A;  4IHF A;  4EA7 A;  2ICX A;  2OI5 A;  4HZC A;  4J09 A;  4E6T A;  5DG3 A;  1S80 A;  1T3D A;  4M99 A;  1THJ A;  3BRK X;  3OUP A;  2RIJ A;  4N69 A;  2NPO A;  4EAB A;  3T57 A;  3OW5 A;  4M9C A;  5DEP A;  3GOS A;  1G95 A;  1KK5 A;  1QRF A;  2V0H A;  3FSB A;  2TDT A;  3R5D A;  4G3Q A;  2IUA A;  1FWY A;  3FS8 A;  1V67 A;  3VBP A;  3IGJ A;  3D8V A;  1SSQ A;  5E3R A;  4HCQ A;  2FKO A;  2OI7 A;  3FSY A;  3P1B A;  4M2A A;  4EGG A;  1OCX A;  3TDT A;  3DHO A;  2WLF A;  4EQY A;  4G87 A;  3ECT A;  3IXC A;  1KQA A;  4MFG A;  4EA9 A;  1V3W A;  2W0W A;  2OEF A;  4N27 A;  3VNP A;  3TIO A;  1LXA A;  2GGQ A;  2OEG A;  2V0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...