3VNPA

Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
GMIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYKALQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein
publication title Crystal structure of hypothetical protein (GK2848) from Geobacillus Kaustophilus
rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 69
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3vnpA00
3BXYA 1FXJA 1YP2A 4EQYA 2GGQA 3R5DA 4HCQA 2WLCA 2WLEA 4EAAA 2JF2A 2WLFA 2OEFA 2Q4JA 5DEMA 3F1XA 4EGGA 1YP4A 5AFUU 4K6RA 1T3DA 3DHOA 4HURA 4G3PA 3GOSA 1G95A 1QRFA 4R7PA 3VBNA 3BSSA 2XATA 4EABA 4IHGA 1HV9A 1QRMA 3PMOA 2ICYA 1MRLA 4N6AA 3JQYA 4E6UA 2WLGA 1KRRA 2TDTA 3HJJA 3FWWA 4M98A 4N6BA 3VBKA 3MQGA 3FSCA 3GVDA 3KWCA 4IHFA 3MC4A 2WLDA 1Z90A 2IU9A 4G3SA 4M28A 3KWDA 1OCXA 1KRVA 4EA9A 1SSTA 3VBLA 1KRUA 3GUEA 3R3IA 3I3AA 3TIOA 3SPTA 2V0IA 4MYOA 4AA7A 4IHHA 4AC3A 3BSYA 4KNRA 3Q1XA 1KK4A 3DK5A 3P47A 5DEPA 1YP3A 3TK8A 3VNPA 3T57A 5ADXV 2ICXA 2GGOA 4G87A 4HUSA 4MZUA 5E3QA 1S80A 1QREA 1XHDA 3FS8A 2VD4A 2W0WA 3R8YA 1KQAA 4HZCA 5U2KA 3IGJA 3NZ2A 2QIAA 2IU8A 3I3XA 3R5CA 4N27A 1HM0A 4KNXA 4HZDA 3CJ8A 3FSYA 1THJA 3OW5A 1QRLA 2IC7A 3OU9A 5DG3A 1J2ZA 3P1BA 4M2BA 3R5AA 2OEGA 1QQ0A 2RIJA 3FTTA 1SSQA 4E79A 3D98A 3FSXA 3MQHA 4G3QA 5L6VA 3TISA 2VHEA 3DJ4A 2JF3A 3ECTA 3VBJA 3SRTA 3OUPA 5AFUV 3R3RA 3R2WA 1KGQA 1QRGA 4H7OA 4DCLA 1KGTA 2FKOA 2OI5A 2V0HA 1V67A 4KPXA 3KWEA 3VBIA 4E75A 1HM9A 3BSWA 3D8VA 5E3PA 1HM8A 2OI7A 3FSBA 4ISXA 4AAWA 1LXAA 3C8VA 2W0VA 2V0KA 3R0SA 3FOQA 4KPZA 5E3RA 3IXCA 1MR9A 2I5KA 3V4EA 3EG4A 4M99A 1TDTA 1G97A 1V3WA 2P2OA 4M9CA 4N69A 4EA7A 4R36A 2V0LA 3R1WA 1KK5A 3BRKX 3EH0A 4R37A 4J09A 3VBMA 3OTZA 2AQ9A 4E1KA 2IUAA 3OTMA 5ADXU 2NPOA 3EEVA 1SSMA 4M2AA 4KQLA 5F42A 2QIVX 1KHRA 2OI6A 2V0JA 4FCEA 3VBPA 1KK6A 3BFPA 5L6SA 4MFGA 3TWDA 4J18A 4E6TA 3TDTA 3TV0A 2QKXA 3R5BA 3ST8A 3HSQA 1FWYA 1XATA 4EA8A 1MR7A
chains in the Genus database with same CATH superfamily
3BXYA 1FXJA 1YP2A 4EQYA 2GGQA 3R5DA 4HCQA 2WLCA 2WLEA 3GQ9A 4EAAA 2JF2A 2WLFA 2OEFA 2Q4JA 5DEMA 3F1XA 4EGGA 1YP4A 5AFUU 4K6RA 1T3DA 3DHOA 4HURA 3OH1A 4G3PA 3GOSA 1G95A 1QRFA 4R7PA 3VBNA 3BSSA 2XATA 4EABA 4IHGA 1HV9A 1QRMA 3PMOA 2ICYA 1MRLA 4N6AA 3JQYA 3OH4A 4E6UA 2WLGA 1KRRA 2TDTA 1N4IA 3HJJA 3FWWA 4M98A 4N6BA 3VBKA 3MQGA 1Z2FA 3FSCA 3GVDA 3KWCA 4IHFA 3MC4A 2WLDA 1Z90A 2IU9A 4G3SA 4M28A 3KWDA 1OCXA 1KRVA 4EA9A 1SSTA 3GQAA 1KRUA 3GUEA 3VBLA 3R3IA 3I3AA 3TIOA 3SPTA 2V0IA 4MYOA 4AA7A 4IHHA 4AC3A 3BSYA 4KNRA 3Q1XA 1KK4A 3DK5A 3P47A 5DEPA 1YP3A 3TK8A 3VNPA 3T57A 5ADXV 2ICXA 2GGOA 4G87A 4HUSA 4MZUA 5E3QA 1S80A 1QREA 1XHDA 3FS8A 2VD4A 2W0WA 3R8YA 1KQAA 4HZCA 5U2KA 3IGJA 3NZ2A 2QIAA 2IU8A 3I3XA 3R5CA 4N27A 1HM0A 1EWWA 3OH2A 4KNXA 4HZDA 3CJ8A 3FSYA 1THJA 3OW5A 1QRLA 2IC7A 3OU9A 5DG3A 1J2ZA 3P1BA 4M2BA 3OGZA 3R5AA 2OEGA 1QQ0A 2RIJA 3FTTA 1SSQA 4E79A 3D98A 3FSXA 3MQHA 4G3QA 5L6VA 3TISA 2VHEA 3DJ4A 2JF3A 3ECTA 3VBJA 1M8NA 3SRTA 3OUPA 5AFUV 3R3RA 3R2WA 1KGQA 1QRGA 4H7OA 4DCLA 1KGTA 2FKOA 2OI5A 2V0HA 1V67A 4KPXA 3KWEA 3VBIA 4E75A 1HM9A 3BSWA 3D8VA 5E3PA 1HM8A 2OI7A 3FSBA 4ISXA 4AAWA 1LXAA 3C8VA 2W0VA 2V0KA 3R0SA 3FOQA 4KPZA 5E3RA 3IXCA 1MR9A 2I5KA 3V4EA 3EG4A 4M99A 3GQ7A 1TDTA 1G97A 1V3WA 2P2OA 3OH3A 4M9CA 4N69A 4EA7A 4R36A 2V0LA 3R1WA 3GQ8A 1KK5A 3BRKX 3EH0A 4R37A 4J09A 3VBMA 1L0SA 3OTZA 2AQ9A 4E1KA 2IUAA 3OTMA 5ADXU 2NPOA 3EEVA 1SSMA 4M2AA 4KQLA 5F42A 2QIVX 1KHRA 2OI6A 2V0JA 4FCEA 3VBPA 1KK6A 3BFPA 5L6SA 4MFGA 3TWDA 4J18A 4E6TA 3TDTA 3TV0A 2QKXA 3OH0A 3R5BA 3ST8A 3HSQA 1FWYA 1XATA 4EA8A 1MR7A 3SUCA
chains in the Genus database with same CATH topology
3BXYA 1FXJA 1YP2A 4EQYA 2GGQA 3R5DA 4HCQA 2WLCA 2WLEA 4EAAA 2JF2A 2WLFA 2OEFA 2Q4JA 5DEMA 3F1XA 4EGGA 1YP4A 5AFUU 4K6RA 1T3DA 3DHOA 4HURA 4G3PA 3GOSA 1G95A 1QRFA 4R7PA 3VBNA 3BSSA 2XATA 4EABA 4IHGA 1HV9A 1QRMA 3PMOA 2ICYA 1MRLA 4N6AA 3JQYA 4E6UA 2WLGA 1KRRA 2TDTA 3HJJA 3FWWA 4M98A 4N6BA 3VBKA 3MQGA 3FSCA 3GVDA 3KWCA 4IHFA 3MC4A 2WLDA 1Z90A 2IU9A 4G3SA 4M28A 3KWDA 1OCXA 1KRVA 4EA9A 1SSTA 3VBLA 1KRUA 3GUEA 3R3IA 3I3AA 3TIOA 3SPTA 2V0IA 4MYOA 4AA7A 4IHHA 4AC3A 3BSYA 4KNRA 3Q1XA 1KK4A 3DK5A 3P47A 5DEPA 1YP3A 3TK8A 3VNPA 3T57A 5ADXV 2ICXA 2GGOA 4G87A 4HUSA 4MZUA 5E3QA 1S80A 1QREA 1XHDA 3FS8A 2VD4A 2W0WA 3R8YA 1KQAA 4HZCA 5U2KA 3IGJA 3NZ2A 2QIAA 2IU8A 3I3XA 3R5CA 4N27A 1HM0A 4KNXA 4HZDA 3CJ8A 3FSYA 1THJA 3OW5A 1QRLA 2IC7A 3OU9A 5DG3A 1J2ZA 3P1BA 4M2BA 3R5AA 2OEGA 1QQ0A 2RIJA 3FTTA 1SSQA 4E79A 3D98A 3FSXA 3MQHA 4G3QA 5L6VA 3TISA 2VHEA 3DJ4A 2JF3A 3ECTA 3VBJA 3SRTA 3OUPA 5AFUV 3R3RA 3R2WA 1KGQA 1QRGA 4H7OA 4DCLA 1KGTA 2FKOA 2OI5A 2V0HA 1V67A 4KPXA 3KWEA 3VBIA 4E75A 1HM9A 3BSWA 3D8VA 5E3PA 1HM8A 2OI7A 3FSBA 4ISXA 4AAWA 1LXAA 3C8VA 2W0VA 2V0KA 3R0SA 3FOQA 4KPZA 5E3RA 3IXCA 1MR9A 2I5KA 3V4EA 3EG4A 4M99A 1TDTA 1G97A 1V3WA 2P2OA 4M9CA 4N69A 4EA7A 4R36A 2V0LA 3R1WA 1KK5A 3BRKX 3EH0A 4R37A 4J09A 3VBMA 3OTZA 2AQ9A 4E1KA 2IUAA 3OTMA 5ADXU 2NPOA 3EEVA 1SSMA 4M2AA 4KQLA 5F42A 2QIVX 1KHRA 2OI6A 2V0JA 4FCEA 3VBPA 1KK6A 3BFPA 5L6SA 4MFGA 3TWDA 4J18A 4E6TA 3TDTA 3TV0A 2QKXA 3R5BA 3ST8A 3HSQA 1FWYA 1XATA 4EA8A 1MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXY A;  1FXJ A;  1YP2 A;  4EQY A;  2GGQ A;  3R5D A;  4HCQ A;  2WLC A;  2WLE A;  4EAA A;  2JF2 A;  2WLF A;  2OEF A;  2Q4J A;  5DEM A;  3F1X A;  4EGG A;  1YP4 A;  5AFU U;  4K6R A;  1T3D A;  3DHO A;  4HUR A;  4G3P A;  3GOS A;  1G95 A;  1QRF A;  4R7P A;  3VBN A;  3BSS A;  2XAT A;  4EAB A;  4IHG A;  1HV9 A;  1QRM A;  3PMO A;  2ICY A;  1MRL A;  4N6A A;  3JQY A;  4E6U A;  2WLG A;  1KRR A;  2TDT A;  3HJJ A;  3FWW A;  4M98 A;  4N6B A;  3VBK A;  3MQG A;  3FSC A;  3GVD A;  3KWC A;  4IHF A;  3MC4 A;  2WLD A;  1Z90 A;  2IU9 A;  4G3S A;  4M28 A;  3KWD A;  1OCX A;  1KRV A;  4EA9 A;  1SST A;  3VBL A;  1KRU A;  3GUE A;  3R3I A;  3I3A A;  3TIO A;  3SPT A;  2V0I A;  4MYO A;  4AA7 A;  4IHH A;  4AC3 A;  3BSY A;  4KNR A;  3Q1X A;  1KK4 A;  3DK5 A;  3P47 A;  5DEP A;  1YP3 A;  3TK8 A;  3VNP A;  3T57 A;  5ADX V;  2ICX A;  2GGO A;  4G87 A;  4HUS A;  4MZU A;  5E3Q A;  1S80 A;  1QRE A;  1XHD A;  3FS8 A;  2VD4 A;  2W0W A;  3R8Y A;  1KQA A;  4HZC A;  5U2K A;  3IGJ A;  3NZ2 A;  2QIA A;  2IU8 A;  3I3X A;  3R5C A;  4N27 A;  1HM0 A;  4KNX A;  4HZD A;  3CJ8 A;  3FSY A;  1THJ A;  3OW5 A;  1QRL A;  2IC7 A;  3OU9 A;  5DG3 A;  1J2Z A;  3P1B A;  4M2B A;  3R5A A;  2OEG A;  1QQ0 A;  2RIJ A;  3FTT A;  1SSQ A;  4E79 A;  3D98 A;  3FSX A;  3MQH A;  4G3Q A;  5L6V A;  3TIS A;  2VHE A;  3DJ4 A;  2JF3 A;  3ECT A;  3VBJ A;  3SRT A;  3OUP A;  5AFU V;  3R3R A;  3R2W A;  1KGQ A;  1QRG A;  4H7O A;  4DCL A;  1KGT A;  2FKO A;  2OI5 A;  2V0H A;  1V67 A;  4KPX A;  3KWE A;  3VBI A;  4E75 A;  1HM9 A;  3BSW A;  3D8V A;  5E3P A;  1HM8 A;  2OI7 A;  3FSB A;  4ISX A;  4AAW A;  1LXA A;  3C8V A;  2W0V A;  2V0K A;  3R0S A;  3FOQ A;  4KPZ A;  5E3R A;  3IXC A;  1MR9 A;  2I5K A;  3V4E A;  3EG4 A;  4M99 A;  1TDT A;  1G97 A;  1V3W A;  2P2O A;  4M9C A;  4N69 A;  4EA7 A;  4R36 A;  2V0L A;  3R1W A;  1KK5 A;  3BRK X;  3EH0 A;  4R37 A;  4J09 A;  3VBM A;  3OTZ A;  2AQ9 A;  4E1K A;  2IUA A;  3OTM A;  5ADX U;  2NPO A;  3EEV A;  1SSM A;  4M2A A;  4KQL A;  5F42 A;  2QIV X;  1KHR A;  2OI6 A;  2V0J A;  4FCE A;  3VBP A;  1KK6 A;  3BFP A;  5L6S A;  4MFG A;  3TWD A;  4J18 A;  4E6T A;  3TDT A;  3TV0 A;  2QKX A;  3R5B A;  3ST8 A;  3HSQ A;  1FWY A;  1XAT A;  4EA8 A;  1MR7 A; 
#chains in the Genus database with same CATH topology
 3BXY A;  1FXJ A;  1YP2 A;  4EQY A;  2GGQ A;  3R5D A;  4HCQ A;  2WLC A;  2WLE A;  3GQ9 A;  4EAA A;  2JF2 A;  2WLF A;  2OEF A;  2Q4J A;  5DEM A;  3F1X A;  4EGG A;  1YP4 A;  5AFU U;  4K6R A;  1T3D A;  3DHO A;  4HUR A;  3OH1 A;  4G3P A;  3GOS A;  1G95 A;  1QRF A;  4R7P A;  3VBN A;  3BSS A;  2XAT A;  4EAB A;  4IHG A;  1HV9 A;  1QRM A;  3PMO A;  2ICY A;  1MRL A;  4N6A A;  3JQY A;  3OH4 A;  4E6U A;  2WLG A;  1KRR A;  2TDT A;  1N4I A;  3HJJ A;  3FWW A;  4M98 A;  4N6B A;  3VBK A;  3MQG A;  1Z2F A;  3FSC A;  3GVD A;  3KWC A;  4IHF A;  3MC4 A;  2WLD A;  1Z90 A;  2IU9 A;  4G3S A;  4M28 A;  3KWD A;  1OCX A;  1KRV A;  4EA9 A;  1SST A;  3GQA A;  1KRU A;  3GUE A;  3VBL A;  3R3I A;  3I3A A;  3TIO A;  3SPT A;  2V0I A;  4MYO A;  4AA7 A;  4IHH A;  4AC3 A;  3BSY A;  4KNR A;  3Q1X A;  1KK4 A;  3DK5 A;  3P47 A;  5DEP A;  1YP3 A;  3TK8 A;  3VNP A;  3T57 A;  5ADX V;  2ICX A;  2GGO A;  4G87 A;  4HUS A;  4MZU A;  5E3Q A;  1S80 A;  1QRE A;  1XHD A;  3FS8 A;  2VD4 A;  2W0W A;  3R8Y A;  1KQA A;  4HZC A;  5U2K A;  3IGJ A;  3NZ2 A;  2QIA A;  2IU8 A;  3I3X A;  3R5C A;  4N27 A;  1HM0 A;  1EWW A;  3OH2 A;  4KNX A;  4HZD A;  3CJ8 A;  3FSY A;  1THJ A;  3OW5 A;  1QRL A;  2IC7 A;  3OU9 A;  5DG3 A;  1J2Z A;  3P1B A;  4M2B A;  3OGZ A;  3R5A A;  2OEG A;  1QQ0 A;  2RIJ A;  3FTT A;  1SSQ A;  4E79 A;  3D98 A;  3FSX A;  3MQH A;  4G3Q A;  5L6V A;  3TIS A;  2VHE A;  3DJ4 A;  2JF3 A;  3ECT A;  3VBJ A;  1M8N A;  3SRT A;  3OUP A;  5AFU V;  3R3R A;  3R2W A;  1KGQ A;  1QRG A;  4H7O A;  4DCL A;  1KGT A;  2FKO A;  2OI5 A;  2V0H A;  1V67 A;  4KPX A;  3KWE A;  3VBI A;  4E75 A;  1HM9 A;  3BSW A;  3D8V A;  5E3P A;  1HM8 A;  2OI7 A;  3FSB A;  4ISX A;  4AAW A;  1LXA A;  3C8V A;  2W0V A;  2V0K A;  3R0S A;  3FOQ A;  4KPZ A;  5E3R A;  3IXC A;  1MR9 A;  2I5K A;  3V4E A;  3EG4 A;  4M99 A;  3GQ7 A;  1TDT A;  1G97 A;  1V3W A;  2P2O A;  3OH3 A;  4M9C A;  4N69 A;  4EA7 A;  4R36 A;  2V0L A;  3R1W A;  3GQ8 A;  1KK5 A;  3BRK X;  3EH0 A;  4R37 A;  4J09 A;  3VBM A;  1L0S A;  3OTZ A;  2AQ9 A;  4E1K A;  2IUA A;  3OTM A;  5ADX U;  2NPO A;  3EEV A;  1SSM A;  4M2A A;  4KQL A;  5F42 A;  2QIV X;  1KHR A;  2OI6 A;  2V0J A;  4FCE A;  3VBP A;  1KK6 A;  3BFP A;  5L6S A;  4MFG A;  3TWD A;  4J18 A;  4E6T A;  3TDT A;  3TV0 A;  2QKX A;  3OH0 A;  3R5B A;  3ST8 A;  3HSQ A;  1FWY A;  1XAT A;  4EA8 A;  1MR7 A;  3SUC A; 
#chains in the Genus database with same CATH homology
 3BXY A;  1FXJ A;  1YP2 A;  4EQY A;  2GGQ A;  3R5D A;  4HCQ A;  2WLC A;  2WLE A;  4EAA A;  2JF2 A;  2WLF A;  2OEF A;  2Q4J A;  5DEM A;  3F1X A;  4EGG A;  1YP4 A;  5AFU U;  4K6R A;  1T3D A;  3DHO A;  4HUR A;  4G3P A;  3GOS A;  1G95 A;  1QRF A;  4R7P A;  3VBN A;  3BSS A;  2XAT A;  4EAB A;  4IHG A;  1HV9 A;  1QRM A;  3PMO A;  2ICY A;  1MRL A;  4N6A A;  3JQY A;  4E6U A;  2WLG A;  1KRR A;  2TDT A;  3HJJ A;  3FWW A;  4M98 A;  4N6B A;  3VBK A;  3MQG A;  3FSC A;  3GVD A;  3KWC A;  4IHF A;  3MC4 A;  2WLD A;  1Z90 A;  2IU9 A;  4G3S A;  4M28 A;  3KWD A;  1OCX A;  1KRV A;  4EA9 A;  1SST A;  3VBL A;  1KRU A;  3GUE A;  3R3I A;  3I3A A;  3TIO A;  3SPT A;  2V0I A;  4MYO A;  4AA7 A;  4IHH A;  4AC3 A;  3BSY A;  4KNR A;  3Q1X A;  1KK4 A;  3DK5 A;  3P47 A;  5DEP A;  1YP3 A;  3TK8 A;  3VNP A;  3T57 A;  5ADX V;  2ICX A;  2GGO A;  4G87 A;  4HUS A;  4MZU A;  5E3Q A;  1S80 A;  1QRE A;  1XHD A;  3FS8 A;  2VD4 A;  2W0W A;  3R8Y A;  1KQA A;  4HZC A;  5U2K A;  3IGJ A;  3NZ2 A;  2QIA A;  2IU8 A;  3I3X A;  3R5C A;  4N27 A;  1HM0 A;  4KNX A;  4HZD A;  3CJ8 A;  3FSY A;  1THJ A;  3OW5 A;  1QRL A;  2IC7 A;  3OU9 A;  5DG3 A;  1J2Z A;  3P1B A;  4M2B A;  3R5A A;  2OEG A;  1QQ0 A;  2RIJ A;  3FTT A;  1SSQ A;  4E79 A;  3D98 A;  3FSX A;  3MQH A;  4G3Q A;  5L6V A;  3TIS A;  2VHE A;  3DJ4 A;  2JF3 A;  3ECT A;  3VBJ A;  3SRT A;  3OUP A;  5AFU V;  3R3R A;  3R2W A;  1KGQ A;  1QRG A;  4H7O A;  4DCL A;  1KGT A;  2FKO A;  2OI5 A;  2V0H A;  1V67 A;  4KPX A;  3KWE A;  3VBI A;  4E75 A;  1HM9 A;  3BSW A;  3D8V A;  5E3P A;  1HM8 A;  2OI7 A;  3FSB A;  4ISX A;  4AAW A;  1LXA A;  3C8V A;  2W0V A;  2V0K A;  3R0S A;  3FOQ A;  4KPZ A;  5E3R A;  3IXC A;  1MR9 A;  2I5K A;  3V4E A;  3EG4 A;  4M99 A;  1TDT A;  1G97 A;  1V3W A;  2P2O A;  4M9C A;  4N69 A;  4EA7 A;  4R36 A;  2V0L A;  3R1W A;  1KK5 A;  3BRK X;  3EH0 A;  4R37 A;  4J09 A;  3VBM A;  3OTZ A;  2AQ9 A;  4E1K A;  2IUA A;  3OTM A;  5ADX U;  2NPO A;  3EEV A;  1SSM A;  4M2A A;  4KQL A;  5F42 A;  2QIV X;  1KHR A;  2OI6 A;  2V0J A;  4FCE A;  3VBP A;  1KK6 A;  3BFP A;  5L6S A;  4MFG A;  3TWD A;  4J18 A;  4E6T A;  3TDT A;  3TV0 A;  2QKX A;  3R5B A;  3ST8 A;  3HSQ A;  1FWY A;  1XAT A;  4EA8 A;  1MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...