4G3PA

Crystal structure of glmu from mycobacterium tuberculosis snapshot 3
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots of Glmu from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Bifunctional protein GlmU
total genus 166
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g3pA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g3pA01
3JTJA 1IIMA 3OAMA 5AJNA 2OI6A 4M28A 2AGDA 3OUPA 4B4BA 2WLCA 2YQJA 2WLFA 4DECA 2FKOA 4MYBA 4EQYA 1W57A 5CQOA 2V0LA 4ASJA 2VSIA 2YQHA 4KPZA 1NQIB 2V0HA 2WVMA 5AFUV 4D11C 2XMHA 1IINA 1ON8A 1QGSA 3CKNA 4HZCA 2RIJA 3VBKA 4FRPA 1VPAA 3MQHA 1GQ9A 5EJ1A 2Q4JA 1FXJA 5C36A 1LXAA 2FFUA 1ZCVA 4M4KA 3SXAA 2E3DA 2UX8A 4FRBA 1H7FA 1VICA 4IHGA 2Z86A 3V0NA 1VZXA 5AJPA 1ZDFA 1ZCUA 1XZ6A 3TDTA 2YC5A 2RJ1A 5FU8A 1R7TA 3OW5A 1KGTA 2FYAA 2PGYA 3ZGGA 2ICXA 1NWGB 1O7OA 2P73A 4P02A 1ON6A 3V0OA 4E79A 3TQDA 4ARWA 3U2WA 1QREA 3CKOA 3OKRA 4KXOA 1MC3A 5FTSA 3K8EA 3I0CA 5C3BA 1H4DA 1W55A 4Y62A 4HOCA 1NF5B 2VXLA 1LL0A 1MR7A 2BO4A 3V8ZA 3OGZA 1NKHB 2IU8A 5L6VA 4Y64A 4DCLA 5L6SA 3R2WA 4FRHA 5EJZA 2RJ6A 1KRUA 1KHRA 2WAWA 3D8VA 3Q80A 3ZLKA 1LZ7A 1VGZA 4LW3A 4G87A 3OTZA 5C4EA 3IOIA 1G1LA 3EEVA 3FWWA 2OI5A 3ECTA 3TK8A 5BXCA 1H7TA 3EH0A 3LW6A 4ISXA 4NAIA 1W77A 3OTMA 1INIA 3OH0A 3CJ8A 3KWCA 1MP4A 3VBNA 3Q4SA 3SX8A 1G95A 3FOQA 2PGVA 4KC4A 3U2TA 1FGXA 3E25A 1HM8A 1NMMB 4Y9XA 3OH3A 3FSYA 4KPXA 4EA9A 4HO9A 3SX5A 2RJ0A 3V90A 2OEFA 3T7MA 4FCEA 1PZTA 3VBMA 1H5SD 4J18A 2AQ9A 1G0RA 2JCKA 1WT3A 3GVDA 5C4FA 3EE5A 4AC3A 1WT2A 4HO6A 2FYBA 3JUJA 4E6TA 3T57A 5I1FA 3CGXA 2WE9A 1MRLA 2BO6A 4M2BA 1LZ0A 5C48A 2X5ZA 3OH1A 3PKPA 1H7LA 2JCOA 1QQ0A 5C4CA 2V0KA 1YP3A 1LZIA 2PA4A 4L41C 2WGZA 1H5TA 5CQMX 4HO4A 4N27A 1R7YA 3NZ2A 5C1GA 1GWWA 3U2UA 1XHBA 3IOHA 3POLA 4Y63A 1R7UA 3DK5A 3FSCA 2Y4KA 4M99A 2GGOA 1JYKA 4EEGA 2RIXA 4JD0A 1TZFA 4IHHA 4CJBA 1O23B 4HUSA 2XATA 3SXEA 1WT0A 4Y7TA 3I0FA 3Q7UA 4Y7FA 3DJ4A 1LZJA 1O0RA 4Y6NA 2O1HA 3OC9A 1YP2A 5HS2A 1ZJ2A 3U2XA 1WVCA 1OCXA 4FQWA 1G23A 2E8BA 5DG3A 3N9WA 3DUVA 2QH5A 4IRPA 4EAAA 3U2VA 5C38A 1ZIZA 4B5BA 3R1WA 1O7QA 2AE7A 4FREA 4YS8A 4CJCA 2YQSA 3VBPA 5CMGX 4EA7A 2AH9A 1J2ZA 3TZTA 3HSQA 3TWDA 1H5SA 1SS9A 1TW1A 1QRMA 1VZTA 3R8YA 1XHDA 3BRKX 3SXDA 1R81A 4DE7A 4N6BA 5F42A 3V4EA 1WT1A 1SSMA 4FRQA 3BCVA 3EG4A 1G8OA 1G3LA 1QRLA 2NPOA 1LL2A 3SXGA 4D0ZA 5IDTA 4FCUA 2OEGA 3V0QA 4D11A 1FR8A 4HO0A 4D0TA 1GQCA 1QWJA 1KRVA 1H7HA 4CJ8A 4B2WA 3U0XA 4EGGA 3C8VA 5DEPA 3GOSA 2X65A 5C1HA 4E75A 3ZLLA 2Y7AA 1VZUA 2JCLA 3TIOA 3MC4A 2AECA 1T3DA 4UEGA 3F1CA 1GX0A 3USRA 4Y7VA 1TVYA 1FXOA 4EEOA 5FTVA 1H4CA 3SXBA 3T7NA 4EE5A 1ZDGA 2FFVA 1G97A 2RITA 4HO8A 4IRQA 1H4EA 5EIYA 2WLEA 3R5AA 3SX3A 3OH4A 1SSTA 1V67A 5U2KA 5DDTA 4CVHA 5E3QA 2AM3A 1QRFA 2ZU8A 5J49A 3I0GA 1HJLA 2WEEA 2RJ4A 1R82A 4Y7UA 1QGQA 4AA7A 4BQHA 2WLDA 4BMAA 3P1BA 1V83A 4KT7A 1TDTA 4Y7GA 2Y4JA 5DDVA 4KQLA 1VM8A 2VXMA 1VGUA 5CMHA 1INJA 3Q1XA 5DEMA 1G93A 2FYCB 3BSSA 4KNRA 3PNNA 1ZJ1A 5ADXV 4HO2A 2Z87A 1KK4A 2APCA 2VSHA 3BSYA 1HJJA 1E5KA 3R3IA 2I5KA 5AFUU 1R80A 2D7RA 2QIAA 2VS3A 1KK5A 2Y6PA 3D5NA 3RSBA 4EA8A 3SX7A 1PZYB 3TISA 1OMZA 4HG6A 1VH1A 1H5RA 4G3SA 1R7XA 2IUAA 4HCQA 3SRTA 1S80A 1V84A 5ADXU 3OU9A 4M98A 3GUEA 3KWDA 3KWEA 4Y6UA 3V0LA 2I7BA 2IU9A 1YROB 4AAWA 2V0JA 4B4MA 2P6WA 1ZJPA 3FSBA 3HL3A 3I0HA 1ZJ0A 1JYLA 1ZI3A 3VBJA 1V3WA 3U0YA 4FRLA 1H3MA 3CKQA 1HM0A 4LW6A 3CKVA 1MP3A 5CMFX 1YP4A 3I3XA 2FY7A 1ZHJA 1HV9A 4R36A 2PX7A 5FUHA 4B4GA 4P00A 3SPTA 5CMIA 3R5DA 2XWNA 1THJA 2X60A 2CU2A 3CKJA 1FRWA 2IC7A 2JF2A 3BFPA 1VH3A 3RMVA 5C3AA 2YC3A 3FTTA 3R5CA 3SXCA 5C4BA 5JQQA 1S4PA 5IFYA 4HO5A 2RIZA 1JV3A 1GWVA 1GX4A 2YQCA 1FWYA 3I0KA 3FSXA 1KWSA 1MR9A 3JQYA 1FOAA 1KRRA 4EVWA 2RJ7A 4FRMA 4EABA 1GA8A 1TW5A 2YCMA 1K4VA 1QRGA 1S4OA 3QVBA 2WLGA 5FU0A 2GGQA 2FYDB 2W0VA 3E26A 2D0JA 1FZWA 2AESA 4AYJA 1FGGA 3I0JA 1ZJOA 1FO9A 3VNPA 4XWIA 4AYLA 2XMEA 4EE3A 1Z90A 1OQMB 4NAKA 3R0SA 2Y4MA 1JVDA 2TDTA 1H5TB 1ZCTA 3K8DA 2YESA 5CMJA 4K6RA 2VD4A 3F1XA 2WVKA 4B42A 5E3PA 1LVWA 2VFZA 4J09A 1V82A 2O1GA 4NALA 1EZIA 1EYRA 3RMWA 3PMOA 1VGTA 1H7GA 1VGWA 1ZI5A 4MYOA 2X5SA 5CQLX 1ZJ3A 4ECMA 3NGWA 4HURA 2VS4A 3R3RA 1H7EA 1G2VA 3HJJA 1I52A 4KRVA 3TV0A 1ZCYA 1JV1A 1LL3A 2RJ8A 1H7QA 2BO8A 2QIVX 2A8UA 3BSWA 4JISA 1R7VA 4M9CA 1JVGA 4M2AA 2ZU9A 3V8YA 4B3UA 5C8RA 2WVLA 4ZDQA 4N6AA 3IGJA 2RIYA 4MNDA 1H5SC 4FRDA 5C3DA 1KK6A 3IOJA 2O1FA 3F1YA 3O3PA 4FROA 2DPWA 5IDSA 2BO7A 1H5SB 3I0EA 3FS8A 3T7OA 3V91A 3I3AA 4MZUA 5C1LA 3DHOA 4D48A 4B2XA 2AM4A 1HM9A 4EE4A 3PKQA 4IHFA 2XWMA 2QGIA 4DDZA 3D98A 1ZI1A 3JUKA 3ST8A 2P2OA 2D7IA 1FO8A 4MFGA 5FV9A 2NXVA 2A8WA 3ZGFA 5C49A 3I0IX 4NANA 2AM5A 5C4DA 4HO3A 1KQAA 5E3RA 1OMXA 2Y4LA 2ZU7A 2JF3A 1NHEB 5AJOA 4KC2A 4N69A 2JCJA 4FRAA 3P47A 4E6UA 5FYEA 3I0DA 4ASYA 1SSQA 3I0LA 2VHEA 3BXYA 1MP5A 4KC1A 3V0PA 3MQGA 2I5EA 2ICYA 2QKXA 2OI7A 4R7PA 2VS5A 2RJ5A 3CU0A 2RJ9A 5C47A 2W0WA 2MZBA 3R5BA 1KGQA 4EEAA 4EEMA 1G9RA 2XWLA 4R37A 3VBLA 3IXCA 4G3PA 1QG8A 3V0MA 2P72A 5CQPA 1S4NA 1FR9A 2V0IA 4HZDA 4G3QA 5CQNX 4C2SA 3USQA 1H5RB 4GBPA 1ZI4A 3OH2A 1FG5N 4KNXA 1WSZA 3VBIA 3KIAA 1XATA 4H7OA 4E1KA 3ZF8A
chains in the Genus database with same CATH superfamily
3JTJA 1IIMA 3OAMA 5AJNA 2OI6A 4M28A 2AGDA 2J0AA 3OUPA 4B4BA 2WLCA 2YQJA 2WLFA 4DECA 2FKOA 4MYBA 4EQYA 1W57A 5CQOA 2V0LA 4ASJA 2VSIA 2YQHA 4KPZA 1NQIB 2V0HA 2WVMA 2C0NA 5AFUV 4D11C 2XMHA 1IINA 1ON8A 5D91A 1QGSA 3CKNA 4HZCA 2RIJA 3VBKA 4FRPA 1VPAA 3MQHA 1GQ9A 5EJ1A 2Q4JA 1FXJA 5C36A 1LXAA 2FFUA 1ZCVA 4M4KA 3SXAA 2E3DA 2UX8A 4FRBA 1H7FA 1VICA 4IHGA 2Z86A 3V0NA 1VZXA 5AJPA 1ZDFA 1ZCUA 1XZ6A 3TDTA 2YC5A 2RJ1A 5FU8A 1R7TA 3OW5A 4FIXA 1KGTA 1L0SA 2FYAA 2PGYA 3ZGGA 2ICXA 1NWGB 1O7OA 2P73A 4P02A 1ON6A 3V0OA 4E79A 3TQDA 4ARWA 3U2WA 1QREA 3CKOA 3OKRA 4KXOA 1MC3A 5FTSA 3K8EA 3I0CA 5C3BA 1H4DA 1W55A 4Y62A 4HOCA 1NF5B 2VXLA 1LL0A 1MR7A 2BO4A 3V8ZA 3OGZA 1NKHB 2IU8A 5L6VA 4Y64A 4DCLA 5L6SA 3R2WA 4FRHA 5EJZA 2RJ6A 1KRUA 1KHRA 2WAWA 3D8VA 3Q80A 4MIXA 3ZLKA 1LZ7A 3GQAA 1VGZA 4LW3A 4G87A 3OTZA 5C4EA 3IOIA 1G1LA 3EEVA 3FWWA 2OI5A 3ECTA 3TK8A 5BXCA 1H7TA 3EH0A 3LW6A 4ISXA 4NAIA 1W77A 3OTMA 3OH0A 1INIA 3CJ8A 3KWCA 1N4IA 1MP4A 3VBNA 3Q4SA 3SX8A 1G95A 3FOQA 2PGVA 4KC4A 3U2TA 1FGXA 3E25A 1NMMB 1HM8A 4Y9XA 3OH3A 3FSYA 4KPXA 4EA9A 4HO9A 3SX5A 2RJ0A 3V90A 2OEFA 3T7MA 4FCEA 1PZTA 3VBMA 1H5SD 4J18A 2AQ9A 1G0RA 2JCKA 1WT3A 3GVDA 5C4FA 3EE5A 4AC3A 1WT2A 4HO6A 2FYBA 3JUJA 4E6TA 3T57A 5I1FA 3CGXA 4O6NA 2WE9A 1MRLA 2BO6A 4M2BA 1LZ0A 5C48A 2X5ZA 3OH1A 3PKPA 1H7LA 2JCOA 1QQ0A 5C4CA 2V0KA 1YP3A 1LZIA 2PA4A 4L41C 2WGZA 1H5TA 5CQMX 4HO4A 4N27A 1R7YA 3NZ2A 5C1GA 1GWWA 3U2UA 1XHBA 3IOHA 3POLA 4Y63A 1R7UA 3DK5A 3FSCA 2Y4KA 4M99A 2GGOA 1JYKA 4EEGA 2RIXA 4JD0A 1TZFA 4IHHA 4CJBA 1O23B 4HUSA 2XATA 3SXEA 1WT0A 4Y7TA 3I0FA 3Q7UA 4Y7FA 3DJ4A 1LZJA 1O0RA 4Y6NA 2O1HA 3OC9A 1YP2A 5HS2A 1ZJ2A 3U2XA 1WVCA 1OCXA 4FQWA 1G23A 2E8BA 5DG3A 3N9WA 3DUVA 2QH5A 4O6MA 4IRPA 4EAAA 3U2VA 5C38A 1ZIZA 4B5BA 3R1WA 1O7QA 2AE7A 4FREA 4YS8A 4CJCA 2YQSA 3VBPA 5CMGX 4EA7A 2AH9A 1J2ZA 3TZTA 2J0BA 3HSQA 3TWDA 1H5SA 1SS9A 1TW1A 1QRMA 1VZTA 3R8YA 1XHDA 3BRKX 3SXDA 1R81A 4DE7A 4N6BA 5F42A 3V4EA 1WT1A 1SSMA 4FRQA 3BCVA 3EG4A 1G8OA 1G3LA 1QRLA 2NPOA 1LL2A 3SXGA 4D0ZA 5IDTA 4FCUA 2OEGA 3V0QA 4D11A 1FR8A 4HO0A 4D0TA 1GQCA 4FIYA 1QWJA 1KRVA 1H7HA 4CJ8A 4B2WA 3U0XA 4EGGA 3C8VA 5DEPA 3GOSA 3GQ8A 2X65A 4E75A 5C1HA 3ZLLA 2Y7AA 3GQ7A 1VZUA 2JCLA 3TIOA 3MC4A 2AECA 2VK9A 1T3DA 4UEGA 3F1CA 1GX0A 3SUCA 3USRA 4Y7VA 1TVYA 1FXOA 4EEOA 5FTVA 1H4CA 3SXBA 3T7NA 4EE5A 1ZDGA 2FFVA 1G97A 2RITA 4HO8A 4IRQA 1H4EA 5EIYA 2WLEA 3R5AA 3SX3A 3OH4A 1SSTA 1V67A 5U2KA 5DDTA 5D92A 4CVHA 5E3QA 2AM3A 1QRFA 2ZU8A 5J49A 3I0GA 1HJLA 2WEEA 2RJ4A 1R82A 4Y7UA 1QGQA 4AA7A 4BQHA 2WLDA 4BMAA 3P1BA 1V83A 4KT7A 1TDTA 4Y7GA 2Y4JA 1Z2FA 5DDVA 4KQLA 1VM8A 2VXMA 1VGUA 5CMHA 1INJA 3Q1XA 5DEMA 1G93A 2FYCB 3BSSA 4KNRA 3PNNA 1ZJ1A 5ADXV 4HO2A 2Z87A 1KK4A 2APCA 2VSHA 3BSYA 1HJJA 1E5KA 1M8NA 2I5KA 3R3IA 5AFUU 1R80A 2D7RA 2QIAA 2VS3A 1KK5A 2Y6PA 3D5NA 3RSBA 4EA8A 3SX7A 1PZYB 3TISA 1OMZA 4HG6A 1VH1A 1H5RA 4G3SA 1R7XA 2IUAA 4HCQA 3SRTA 1S80A 1V84A 5ADXU 3OU9A 4M98A 3GUEA 3KWDA 3KWEA 4Y6UA 3V0LA 2I7BA 2IU9A 1YROB 4AAWA 2V0JA 4B4MA 2P6WA 1ZJPA 3FSBA 3HL3A 3I0HA 1ZJ0A 1JYLA 1ZI3A 3VBJA 1V3WA 3U0YA 4FRLA 1H3MA 3CKQA 1HM0A 4LW6A 3CKVA 1MP3A 5CMFX 1YP4A 3I3XA 2FY7A 1ZHJA 1HV9A 4R36A 2PX7A 5FUHA 4B4GA 4P00A 3SPTA 5CMIA 3R5DA 2XWNA 1THJA 2X60A 2CU2A 3CKJA 1FRWA 2IC7A 2JF2A 3BFPA 1VH3A 3RMVA 5C3AA 2YC3A 3FTTA 3R5CA 3SXCA 5C4BA 5JQQA 1S4PA 5IFYA 4HO5A 2RIZA 1JV3A 1GWVA 1GX4A 2YQCA 1FWYA 3I0KA 3FSXA 1KWSA 1MR9A 3JQYA 1FOAA 1KRRA 4EVWA 2RJ7A 4FRMA 4EABA 1GA8A 1TW5A 2YCMA 1K4VA 1QRGA 1S4OA 3QVBA 2WLGA 5FU0A 2GGQA 2FYDB 1EWWA 2W0VA 3E26A 2D0JA 1FZWA 2AESA 4AYJA 1FGGA 3I0JA 1ZJOA 1FO9A 3VNPA 4XWIA 4AYLA 2XMEA 4EE3A 1Z90A 1OQMB 4NAKA 3R0SA 2Y4MA 1JVDA 2TDTA 1H5TB 1ZCTA 3K8DA 2YESA 5CMJA 4K6RA 2VD4A 3F1XA 3GQ9A 2WVKA 4B42A 5E3PA 1LVWA 2VFZA 4J09A 1V82A 2O1GA 4NALA 1EZIA 1EYRA 3RMWA 3PMOA 1VGTA 1H7GA 1VGWA 1ZI5A 4MYOA 2X5SA 5CQLX 1ZJ3A 4ECMA 3NGWA 4HURA 2VS4A 3R3RA 1H7EA 1G2VA 3HJJA 1I52A 4KRVA 3TV0A 1ZCYA 1JV1A 1LL3A 2RJ8A 1H7QA 2BO8A 2QIVX 2A8UA 3BSWA 4JISA 1R7VA 4M9CA 1JVGA 4M2AA 2ZU9A 3V8YA 4B3UA 5C8RA 2WVLA 4ZDQA 4N6AA 3IGJA 2RIYA 4MNDA 1H5SC 4FRDA 5C3DA 1KK6A 3IOJA 2O1FA 3F1YA 3O3PA 4FROA 2DPWA 5IDSA 2BO7A 1H5SB 3I0EA 3FS8A 3T7OA 3V91A 3I3AA 4MZUA 5C1LA 3DHOA 4D48A 4B2XA 2AM4A 1HM9A 4EE4A 3PKQA 4IHFA 2XWMA 2QGIA 4DDZA 3D98A 1ZI1A 3JUKA 3ST8A 2P2OA 2D7IA 1FO8A 4MFGA 5FV9A 2NXVA 2A8WA 3ZGFA 5C49A 3I0IX 4NANA 2AM5A 5C4DA 4HO3A 1KQAA 5E3RA 1OMXA 2Y4LA 2ZU7A 2JF3A 1NHEB 5AJOA 4KC2A 4N69A 2JCJA 4FRAA 3P47A 4E6UA 5FYEA 3I0DA 4ASYA 1SSQA 3I0LA 2VHEA 3BXYA 1MP5A 4KC1A 3V0PA 3MQGA 2I5EA 2ICYA 2QKXA 2OI7A 4R7PA 2VS5A 2RJ5A 3CU0A 2RJ9A 5C47A 2W0WA 2MZBA 3R5BA 1KGQA 4EEAA 4EEMA 1G9RA 2XWLA 4R37A 3VBLA 3IXCA 4G3PA 1QG8A 3V0MA 2P72A 5CQPA 1S4NA 1FR9A 2V0IA 4HZDA 4G3QA 5CQNX 4C2SA 3USQA 1H5RB 4GBPA 1ZI4A 3OH2A 1FG5N 4KNXA 1WSZA 3VBIA 3KIAA 1XATA 4H7OA 4E1KA 3ZF8A 4Q7CA
chains in the Genus database with same CATH topology
3JTJA 1IIMA 3OAMA 5AJNA 2OI6A 4M28A 2AGDA 2J0AA 3OUPA 4B4BA 2WLCA 2YQJA 2WLFA 4DECA 2FKOA 4MYBA 4EQYA 1W57A 5CQOA 2V0LA 4ASJA 2VSIA 2YQHA 4KPZA 1NQIB 2V0HA 2WVMA 2C0NA 5AFUV 4D11C 2XMHA 1IINA 1ON8A 5D91A 1QGSA 3CKNA 4HZCA 2RIJA 3VBKA 4FRPA 1VPAA 3MQHA 1GQ9A 5EJ1A 2Q4JA 1FXJA 5C36A 1LXAA 2FFUA 1ZCVA 4M4KA 3SXAA 2E3DA 2UX8A 4FRBA 1H7FA 1VICA 4IHGA 2Z86A 3V0NA 1VZXA 5AJPA 1ZDFA 1ZCUA 1XZ6A 3TDTA 2YC5A 2RJ1A 5FU8A 1R7TA 3OW5A 4FIXA 1KGTA 2FYAA 2PGYA 3ZGGA 2ICXA 1NWGB 1O7OA 2P73A 4P02A 1ON6A 3V0OA 4E79A 3TQDA 4ARWA 3U2WA 1QREA 3CKOA 3OKRA 4KXOA 1MC3A 5FTSA 3K8EA 3I0CA 5C3BA 1H4DA 1W55A 4Y62A 4HOCA 1NF5B 2VXLA 1LL0A 1MR7A 2BO4A 3V8ZA 3OGZA 1NKHB 2IU8A 5L6VA 4Y64A 4DCLA 5L6SA 3R2WA 4FRHA 5EJZA 2RJ6A 1KRUA 1KHRA 2WAWA 3D8VA 3Q80A 4MIXA 3ZLKA 1LZ7A 1VGZA 4LW3A 4G87A 3OTZA 5C4EA 3IOIA 1G1LA 3EEVA 3FWWA 2OI5A 3ECTA 3TK8A 5BXCA 1H7TA 3EH0A 3LW6A 4ISXA 4NAIA 1W77A 3OTMA 1INIA 3OH0A 3CJ8A 3KWCA 1MP4A 3VBNA 3Q4SA 3SX8A 1G95A 3FOQA 2PGVA 4KC4A 3U2TA 1FGXA 3E25A 1HM8A 1NMMB 4Y9XA 3OH3A 3FSYA 4KPXA 4EA9A 4HO9A 3SX5A 2RJ0A 3V90A 2OEFA 3T7MA 4FCEA 1PZTA 3VBMA 1H5SD 4J18A 2AQ9A 1G0RA 2JCKA 1WT3A 3GVDA 5C4FA 3EE5A 4AC3A 1WT2A 4HO6A 2FYBA 3JUJA 4E6TA 3T57A 5I1FA 3CGXA 4O6NA 2WE9A 1MRLA 2BO6A 4M2BA 1LZ0A 5C48A 2X5ZA 3OH1A 3PKPA 1H7LA 2JCOA 1QQ0A 5C4CA 2V0KA 1YP3A 1LZIA 2PA4A 4L41C 2WGZA 1H5TA 5CQMX 4HO4A 4N27A 1R7YA 3NZ2A 5C1GA 1GWWA 3U2UA 1XHBA 3IOHA 3POLA 4Y63A 1R7UA 3DK5A 3FSCA 2Y4KA 4M99A 2GGOA 1JYKA 4EEGA 2RIXA 4JD0A 1TZFA 4IHHA 4CJBA 1O23B 4HUSA 2XATA 3SXEA 1WT0A 4Y7TA 3I0FA 3Q7UA 4Y7FA 3DJ4A 1LZJA 1O0RA 4Y6NA 2O1HA 3OC9A 1YP2A 5HS2A 1ZJ2A 3U2XA 1WVCA 1OCXA 4FQWA 1G23A 2E8BA 5DG3A 3N9WA 3DUVA 2QH5A 4O6MA 4IRPA 4EAAA 3U2VA 5C38A 1ZIZA 4B5BA 3R1WA 1O7QA 2AE7A 4FREA 4YS8A 4CJCA 2YQSA 3VBPA 5CMGX 4EA7A 2AH9A 1J2ZA 3TZTA 2J0BA 3HSQA 3TWDA 1H5SA 1SS9A 1TW1A 1QRMA 1VZTA 3R8YA 1XHDA 3BRKX 3SXDA 1R81A 4DE7A 4N6BA 5F42A 3V4EA 1WT1A 1SSMA 4FRQA 3BCVA 3EG4A 1G8OA 1G3LA 1QRLA 2NPOA 1LL2A 3SXGA 4D0ZA 5IDTA 4FCUA 2OEGA 3V0QA 4D11A 1FR8A 4HO0A 4D0TA 1GQCA 4FIYA 1QWJA 1KRVA 1H7HA 4CJ8A 4B2WA 3U0XA 4EGGA 3C8VA 5DEPA 3GOSA 2X65A 5C1HA 4E75A 3ZLLA 2Y7AA 1VZUA 2JCLA 3TIOA 3MC4A 2AECA 2VK9A 1T3DA 4UEGA 3F1CA 1GX0A 3USRA 4Y7VA 1TVYA 1FXOA 4EEOA 5FTVA 1H4CA 3SXBA 3T7NA 4EE5A 1ZDGA 2FFVA 1G97A 2RITA 4HO8A 4IRQA 1H4EA 5EIYA 2WLEA 3R5AA 3SX3A 3OH4A 1SSTA 1V67A 5U2KA 5DDTA 5D92A 4CVHA 5E3QA 2AM3A 1QRFA 2ZU8A 5J49A 3I0GA 1HJLA 2WEEA 2RJ4A 1R82A 4Y7UA 1QGQA 4AA7A 4BQHA 2WLDA 4BMAA 3P1BA 1V83A 4KT7A 1TDTA 4Y7GA 2Y4JA 5DDVA 4KQLA 1VM8A 2VXMA 1VGUA 5CMHA 1INJA 3Q1XA 5DEMA 1G93A 2FYCB 3BSSA 4KNRA 3PNNA 1ZJ1A 5ADXV 4HO2A 2Z87A 1KK4A 2APCA 2VSHA 3BSYA 1HJJA 1E5KA 3R3IA 2I5KA 5AFUU 1R80A 2D7RA 2QIAA 2VS3A 1KK5A 2Y6PA 3D5NA 3RSBA 4EA8A 3SX7A 1PZYB 3TISA 1OMZA 4HG6A 1VH1A 1H5RA 4G3SA 1R7XA 2IUAA 4HCQA 3SRTA 1S80A 1V84A 5ADXU 3OU9A 4M98A 3GUEA 3KWDA 3KWEA 4Y6UA 3V0LA 2I7BA 2IU9A 1YROB 4AAWA 2V0JA 4B4MA 2P6WA 1ZJPA 3FSBA 3HL3A 3I0HA 1ZJ0A 1JYLA 1ZI3A 3VBJA 1V3WA 3U0YA 4FRLA 1H3MA 3CKQA 1HM0A 4LW6A 3CKVA 1MP3A 5CMFX 1YP4A 3I3XA 2FY7A 1ZHJA 1HV9A 4R36A 2PX7A 5FUHA 4B4GA 4P00A 3SPTA 5CMIA 3R5DA 2XWNA 1THJA 2X60A 2CU2A 3CKJA 1FRWA 2IC7A 2JF2A 3BFPA 1VH3A 3RMVA 5C3AA 2YC3A 3FTTA 3R5CA 3SXCA 5C4BA 5JQQA 1S4PA 5IFYA 4HO5A 2RIZA 1JV3A 1GWVA 1GX4A 2YQCA 1FWYA 3I0KA 3FSXA 1KWSA 1MR9A 3JQYA 1FOAA 1KRRA 4EVWA 2RJ7A 4FRMA 4EABA 1GA8A 1TW5A 2YCMA 1K4VA 1QRGA 1S4OA 3QVBA 2WLGA 5FU0A 2GGQA 2FYDB 2W0VA 3E26A 2D0JA 1FZWA 2AESA 4AYJA 1FGGA 3I0JA 1ZJOA 1FO9A 3VNPA 4XWIA 4AYLA 2XMEA 4EE3A 1Z90A 1OQMB 4NAKA 3R0SA 2Y4MA 1JVDA 2TDTA 1H5TB 1ZCTA 3K8DA 2YESA 5CMJA 4K6RA 2VD4A 3F1XA 2WVKA 4B42A 5E3PA 1LVWA 2VFZA 4J09A 1V82A 2O1GA 4NALA 1EZIA 1EYRA 3RMWA 3PMOA 1VGTA 1H7GA 1VGWA 1ZI5A 4MYOA 2X5SA 5CQLX 1ZJ3A 4ECMA 3NGWA 4HURA 2VS4A 3R3RA 1H7EA 1G2VA 3HJJA 1I52A 4KRVA 3TV0A 1ZCYA 1JV1A 1LL3A 2RJ8A 1H7QA 2BO8A 2QIVX 2A8UA 3BSWA 4JISA 1R7VA 4M9CA 1JVGA 4M2AA 2ZU9A 3V8YA 4B3UA 5C8RA 2WVLA 4ZDQA 4N6AA 3IGJA 2RIYA 4MNDA 1H5SC 4FRDA 5C3DA 1KK6A 3IOJA 2O1FA 3F1YA 3O3PA 4FROA 2DPWA 5IDSA 2BO7A 1H5SB 3I0EA 3FS8A 3T7OA 3V91A 3I3AA 4MZUA 5C1LA 3DHOA 4D48A 4B2XA 2AM4A 1HM9A 4EE4A 3PKQA 4IHFA 2XWMA 2QGIA 4DDZA 3D98A 1ZI1A 3JUKA 3ST8A 2P2OA 2D7IA 1FO8A 4MFGA 5FV9A 2NXVA 2A8WA 3ZGFA 5C49A 3I0IX 4NANA 2AM5A 5C4DA 4HO3A 1KQAA 5E3RA 1OMXA 2Y4LA 2ZU7A 2JF3A 1NHEB 5AJOA 4KC2A 4N69A 2JCJA 4FRAA 3P47A 4E6UA 5FYEA 3I0DA 4ASYA 1SSQA 3I0LA 2VHEA 3BXYA 1MP5A 4KC1A 3V0PA 3MQGA 2I5EA 2ICYA 2QKXA 2OI7A 4R7PA 2VS5A 2RJ5A 3CU0A 2RJ9A 5C47A 2W0WA 2MZBA 3R5BA 1KGQA 4EEAA 4EEMA 1G9RA 2XWLA 4R37A 3VBLA 3IXCA 4G3PA 1QG8A 3V0MA 2P72A 5CQPA 1S4NA 1FR9A 2V0IA 4HZDA 4G3QA 5CQNX 4C2SA 3USQA 1H5RB 4GBPA 1ZI4A 3OH2A 1FG5N 4KNXA 1WSZA 3VBIA 3KIAA 1XATA 4H7OA 4E1KA 3ZF8A 4Q7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTJ A;  1IIM A;  3OAM A;  5AJN A;  2OI6 A;  4M28 A;  2AGD A;  3OUP A;  4B4B A;  2WLC A;  2YQJ A;  2WLF A;  4DEC A;  2FKO A;  4MYB A;  4EQY A;  1W57 A;  5CQO A;  2V0L A;  4ASJ A;  2VSI A;  2YQH A;  4KPZ A;  1NQI B;  2V0H A;  2WVM A;  5AFU V;  4D11 C;  2XMH A;  1IIN A;  1ON8 A;  1QGS A;  3CKN A;  4HZC A;  2RIJ A;  3VBK A;  4FRP A;  1VPA A;  3MQH A;  1GQ9 A;  5EJ1 A;  2Q4J A;  1FXJ A;  5C36 A;  1LXA A;  2FFU A;  1ZCV A;  4M4K A;  3SXA A;  2E3D A;  2UX8 A;  4FRB A;  1H7F A;  1VIC A;  4IHG A;  2Z86 A;  3V0N A;  1VZX A;  5AJP A;  1ZDF A;  1ZCU A;  1XZ6 A;  3TDT A;  2YC5 A;  2RJ1 A;  5FU8 A;  1R7T A;  3OW5 A;  1KGT A;  2FYA A;  2PGY A;  3ZGG A;  2ICX A;  1NWG B;  1O7O A;  2P73 A;  4P02 A;  1ON6 A;  3V0O A;  4E79 A;  3TQD A;  4ARW A;  3U2W A;  1QRE A;  3CKO A;  3OKR A;  4KXO A;  1MC3 A;  5FTS A;  3K8E A;  3I0C A;  5C3B A;  1H4D A;  1W55 A;  4Y62 A;  4HOC A;  1NF5 B;  2VXL A;  1LL0 A;  1MR7 A;  2BO4 A;  3V8Z A;  3OGZ A;  1NKH B;  2IU8 A;  5L6V A;  4Y64 A;  4DCL A;  5L6S A;  3R2W A;  4FRH A;  5EJZ A;  2RJ6 A;  1KRU A;  1KHR A;  2WAW A;  3D8V A;  3Q80 A;  3ZLK A;  1LZ7 A;  1VGZ A;  4LW3 A;  4G87 A;  3OTZ A;  5C4E A;  3IOI A;  1G1L A;  3EEV A;  3FWW A;  2OI5 A;  3ECT A;  3TK8 A;  5BXC A;  1H7T A;  3EH0 A;  3LW6 A;  4ISX A;  4NAI A;  1W77 A;  3OTM A;  1INI A;  3OH0 A;  3CJ8 A;  3KWC A;  1MP4 A;  3VBN A;  3Q4S A;  3SX8 A;  1G95 A;  3FOQ A;  2PGV A;  4KC4 A;  3U2T A;  1FGX A;  3E25 A;  1HM8 A;  1NMM B;  4Y9X A;  3OH3 A;  3FSY A;  4KPX A;  4EA9 A;  4HO9 A;  3SX5 A;  2RJ0 A;  3V90 A;  2OEF A;  3T7M A;  4FCE A;  1PZT A;  3VBM A;  1H5S D;  4J18 A;  2AQ9 A;  1G0R A;  2JCK A;  1WT3 A;  3GVD A;  5C4F A;  3EE5 A;  4AC3 A;  1WT2 A;  4HO6 A;  2FYB A;  3JUJ A;  4E6T A;  3T57 A;  5I1F A;  3CGX A;  2WE9 A;  1MRL A;  2BO6 A;  4M2B A;  1LZ0 A;  5C48 A;  2X5Z A;  3OH1 A;  3PKP A;  1H7L A;  2JCO A;  1QQ0 A;  5C4C A;  2V0K A;  1YP3 A;  1LZI A;  2PA4 A;  4L41 C;  2WGZ A;  1H5T A;  5CQM X;  4HO4 A;  4N27 A;  1R7Y A;  3NZ2 A;  5C1G A;  1GWW A;  3U2U A;  1XHB A;  3IOH A;  3POL A;  4Y63 A;  1R7U A;  3DK5 A;  3FSC A;  2Y4K A;  4M99 A;  2GGO A;  1JYK A;  4EEG A;  2RIX A;  4JD0 A;  1TZF A;  4IHH A;  4CJB A;  1O23 B;  4HUS A;  2XAT A;  3SXE A;  1WT0 A;  4Y7T A;  3I0F A;  3Q7U A;  4Y7F A;  3DJ4 A;  1LZJ A;  1O0R A;  4Y6N A;  2O1H A;  3OC9 A;  1YP2 A;  5HS2 A;  1ZJ2 A;  3U2X A;  1WVC A;  1OCX A;  4FQW A;  1G23 A;  2E8B A;  5DG3 A;  3N9W A;  3DUV A;  2QH5 A;  4IRP A;  4EAA A;  3U2V A;  5C38 A;  1ZIZ A;  4B5B A;  3R1W A;  1O7Q A;  2AE7 A;  4FRE A;  4YS8 A;  4CJC A;  2YQS A;  3VBP A;  5CMG X;  4EA7 A;  2AH9 A;  1J2Z A;  3TZT A;  3HSQ A;  3TWD A;  1H5S A;  1SS9 A;  1TW1 A;  1QRM A;  1VZT A;  3R8Y A;  1XHD A;  3BRK X;  3SXD A;  1R81 A;  4DE7 A;  4N6B A;  5F42 A;  3V4E A;  1WT1 A;  1SSM A;  4FRQ A;  3BCV A;  3EG4 A;  1G8O A;  1G3L A;  1QRL A;  2NPO A;  1LL2 A;  3SXG A;  4D0Z A;  5IDT A;  4FCU A;  2OEG A;  3V0Q A;  4D11 A;  1FR8 A;  4HO0 A;  4D0T A;  1GQC A;  1QWJ A;  1KRV A;  1H7H A;  4CJ8 A;  4B2W A;  3U0X A;  4EGG A;  3C8V A;  5DEP A;  3GOS A;  2X65 A;  5C1H A;  4E75 A;  3ZLL A;  2Y7A A;  1VZU A;  2JCL A;  3TIO A;  3MC4 A;  2AEC A;  1T3D A;  4UEG A;  3F1C A;  1GX0 A;  3USR A;  4Y7V A;  1TVY A;  1FXO A;  4EEO A;  5FTV A;  1H4C A;  3SXB A;  3T7N A;  4EE5 A;  1ZDG A;  2FFV A;  1G97 A;  2RIT A;  4HO8 A;  4IRQ A;  1H4E A;  5EIY A;  2WLE A;  3R5A A;  3SX3 A;  3OH4 A;  1SST A;  1V67 A;  5U2K A;  5DDT A;  4CVH A;  5E3Q A;  2AM3 A;  1QRF A;  2ZU8 A;  5J49 A;  3I0G A;  1HJL A;  2WEE A;  2RJ4 A;  1R82 A;  4Y7U A;  1QGQ A;  4AA7 A;  4BQH A;  2WLD A;  4BMA A;  3P1B A;  1V83 A;  4KT7 A;  1TDT A;  4Y7G A;  2Y4J A;  5DDV A;  4KQL A;  1VM8 A;  2VXM A;  1VGU A;  5CMH A;  1INJ A;  3Q1X A;  5DEM A;  1G93 A;  2FYC B;  3BSS A;  4KNR A;  3PNN A;  1ZJ1 A;  5ADX V;  4HO2 A;  2Z87 A;  1KK4 A;  2APC A;  2VSH A;  3BSY A;  1HJJ A;  1E5K A;  3R3I A;  2I5K A;  5AFU U;  1R80 A;  2D7R A;  2QIA A;  2VS3 A;  1KK5 A;  2Y6P A;  3D5N A;  3RSB A;  4EA8 A;  3SX7 A;  1PZY B;  3TIS A;  1OMZ A;  4HG6 A;  1VH1 A;  1H5R A;  4G3S A;  1R7X A;  2IUA A;  4HCQ A;  3SRT A;  1S80 A;  1V84 A;  5ADX U;  3OU9 A;  4M98 A;  3GUE A;  3KWD A;  3KWE A;  4Y6U A;  3V0L A;  2I7B A;  2IU9 A;  1YRO B;  4AAW A;  2V0J A;  4B4M A;  2P6W A;  1ZJP A;  3FSB A;  3HL3 A;  3I0H A;  1ZJ0 A;  1JYL A;  1ZI3 A;  3VBJ A;  1V3W A;  3U0Y A;  4FRL A;  1H3M A;  3CKQ A;  1HM0 A;  4LW6 A;  3CKV A;  1MP3 A;  5CMF X;  1YP4 A;  3I3X A;  2FY7 A;  1ZHJ A;  1HV9 A;  4R36 A;  2PX7 A;  5FUH A;  4B4G A;  4P00 A;  3SPT A;  5CMI A;  3R5D A;  2XWN A;  1THJ A;  2X60 A;  2CU2 A;  3CKJ A;  1FRW A;  2IC7 A;  2JF2 A;  3BFP A;  1VH3 A;  3RMV A;  5C3A A;  2YC3 A;  3FTT A;  3R5C A;  3SXC A;  5C4B A;  5JQQ A;  1S4P A;  5IFY A;  4HO5 A;  2RIZ A;  1JV3 A;  1GWV A;  1GX4 A;  2YQC A;  1FWY A;  3I0K A;  3FSX A;  1KWS A;  1MR9 A;  3JQY A;  1FOA A;  1KRR A;  4EVW A;  2RJ7 A;  4FRM A;  4EAB A;  1GA8 A;  1TW5 A;  2YCM A;  1K4V A;  1QRG A;  1S4O A;  3QVB A;  2WLG A;  5FU0 A;  2GGQ A;  2FYD B;  2W0V A;  3E26 A;  2D0J A;  1FZW A;  2AES A;  4AYJ A;  1FGG A;  3I0J A;  1ZJO A;  1FO9 A;  3VNP A;  4XWI A;  4AYL A;  2XME A;  4EE3 A;  1Z90 A;  1OQM B;  4NAK A;  3R0S A;  2Y4M A;  1JVD A;  2TDT A;  1H5T B;  1ZCT A;  3K8D A;  2YES A;  5CMJ A;  4K6R A;  2VD4 A;  3F1X A;  2WVK A;  4B42 A;  5E3P A;  1LVW A;  2VFZ A;  4J09 A;  1V82 A;  2O1G A;  4NAL A;  1EZI A;  1EYR A;  3RMW A;  3PMO A;  1VGT A;  1H7G A;  1VGW A;  1ZI5 A;  4MYO A;  2X5S A;  5CQL X;  1ZJ3 A;  4ECM A;  3NGW A;  4HUR A;  2VS4 A;  3R3R A;  1H7E A;  1G2V A;  3HJJ A;  1I52 A;  4KRV A;  3TV0 A;  1ZCY A;  1JV1 A;  1LL3 A;  2RJ8 A;  1H7Q A;  2BO8 A;  2QIV X;  2A8U A;  3BSW A;  4JIS A;  1R7V A;  4M9C A;  1JVG A;  4M2A A;  2ZU9 A;  3V8Y A;  4B3U A;  5C8R A;  2WVL A;  4ZDQ A;  4N6A A;  3IGJ A;  2RIY A;  4MND A;  1H5S C;  4FRD A;  5C3D A;  1KK6 A;  3IOJ A;  2O1F A;  3F1Y A;  3O3P A;  4FRO A;  2DPW A;  5IDS A;  2BO7 A;  1H5S B;  3I0E A;  3FS8 A;  3T7O A;  3V91 A;  3I3A A;  4MZU A;  5C1L A;  3DHO A;  4D48 A;  4B2X A;  2AM4 A;  1HM9 A;  4EE4 A;  3PKQ A;  4IHF A;  2XWM A;  2QGI A;  4DDZ A;  3D98 A;  1ZI1 A;  3JUK A;  3ST8 A;  2P2O A;  2D7I A;  1FO8 A;  4MFG A;  5FV9 A;  2NXV A;  2A8W A;  3ZGF A;  5C49 A;  3I0I X;  4NAN A;  2AM5 A;  5C4D A;  4HO3 A;  1KQA A;  5E3R A;  1OMX A;  2Y4L A;  2ZU7 A;  2JF3 A;  1NHE B;  5AJO A;  4KC2 A;  4N69 A;  2JCJ A;  4FRA A;  3P47 A;  4E6U A;  5FYE A;  3I0D A;  4ASY A;  1SSQ A;  3I0L A;  2VHE A;  3BXY A;  1MP5 A;  4KC1 A;  3V0P A;  3MQG A;  2I5E A;  2ICY A;  2QKX A;  2OI7 A;  4R7P A;  2VS5 A;  2RJ5 A;  3CU0 A;  2RJ9 A;  5C47 A;  2W0W A;  2MZB A;  3R5B A;  1KGQ A;  4EEA A;  4EEM A;  1G9R A;  2XWL A;  4R37 A;  3VBL A;  3IXC A;  4G3P A;  1QG8 A;  3V0M A;  2P72 A;  5CQP A;  1S4N A;  1FR9 A;  2V0I A;  4HZD A;  4G3Q A;  5CQN X;  4C2S A;  3USQ A;  1H5R B;  4GBP A;  1ZI4 A;  3OH2 A;  1FG5 N;  4KNX A;  1WSZ A;  3VBI A;  3KIA A;  1XAT A;  4H7O A;  4E1K A;  3ZF8 A; 
#chains in the Genus database with same CATH topology
 3JTJ A;  1IIM A;  3OAM A;  5AJN A;  2OI6 A;  4M28 A;  2AGD A;  2J0A A;  3OUP A;  4B4B A;  2WLC A;  2YQJ A;  2WLF A;  4DEC A;  2FKO A;  4MYB A;  4EQY A;  1W57 A;  5CQO A;  2V0L A;  4ASJ A;  2VSI A;  2YQH A;  4KPZ A;  1NQI B;  2V0H A;  2WVM A;  2C0N A;  5AFU V;  4D11 C;  2XMH A;  1IIN A;  1ON8 A;  5D91 A;  1QGS A;  3CKN A;  4HZC A;  2RIJ A;  3VBK A;  4FRP A;  1VPA A;  3MQH A;  1GQ9 A;  5EJ1 A;  2Q4J A;  1FXJ A;  5C36 A;  1LXA A;  2FFU A;  1ZCV A;  4M4K A;  3SXA A;  2E3D A;  2UX8 A;  4FRB A;  1H7F A;  1VIC A;  4IHG A;  2Z86 A;  3V0N A;  1VZX A;  5AJP A;  1ZDF A;  1ZCU A;  1XZ6 A;  3TDT A;  2YC5 A;  2RJ1 A;  5FU8 A;  1R7T A;  3OW5 A;  4FIX A;  1KGT A;  1L0S A;  2FYA A;  2PGY A;  3ZGG A;  2ICX A;  1NWG B;  1O7O A;  2P73 A;  4P02 A;  1ON6 A;  3V0O A;  4E79 A;  3TQD A;  4ARW A;  3U2W A;  1QRE A;  3CKO A;  3OKR A;  4KXO A;  1MC3 A;  5FTS A;  3K8E A;  3I0C A;  5C3B A;  1H4D A;  1W55 A;  4Y62 A;  4HOC A;  1NF5 B;  2VXL A;  1LL0 A;  1MR7 A;  2BO4 A;  3V8Z A;  3OGZ A;  1NKH B;  2IU8 A;  5L6V A;  4Y64 A;  4DCL A;  5L6S A;  3R2W A;  4FRH A;  5EJZ A;  2RJ6 A;  1KRU A;  1KHR A;  2WAW A;  3D8V A;  3Q80 A;  4MIX A;  3ZLK A;  1LZ7 A;  3GQA A;  1VGZ A;  4LW3 A;  4G87 A;  3OTZ A;  5C4E A;  3IOI A;  1G1L A;  3EEV A;  3FWW A;  2OI5 A;  3ECT A;  3TK8 A;  5BXC A;  1H7T A;  3EH0 A;  3LW6 A;  4ISX A;  4NAI A;  1W77 A;  3OTM A;  3OH0 A;  1INI A;  3CJ8 A;  3KWC A;  1N4I A;  1MP4 A;  3VBN A;  3Q4S A;  3SX8 A;  1G95 A;  3FOQ A;  2PGV A;  4KC4 A;  3U2T A;  1FGX A;  3E25 A;  1NMM B;  1HM8 A;  4Y9X A;  3OH3 A;  3FSY A;  4KPX A;  4EA9 A;  4HO9 A;  3SX5 A;  2RJ0 A;  3V90 A;  2OEF A;  3T7M A;  4FCE A;  1PZT A;  3VBM A;  1H5S D;  4J18 A;  2AQ9 A;  1G0R A;  2JCK A;  1WT3 A;  3GVD A;  5C4F A;  3EE5 A;  4AC3 A;  1WT2 A;  4HO6 A;  2FYB A;  3JUJ A;  4E6T A;  3T57 A;  5I1F A;  3CGX A;  4O6N A;  2WE9 A;  1MRL A;  2BO6 A;  4M2B A;  1LZ0 A;  5C48 A;  2X5Z A;  3OH1 A;  3PKP A;  1H7L A;  2JCO A;  1QQ0 A;  5C4C A;  2V0K A;  1YP3 A;  1LZI A;  2PA4 A;  4L41 C;  2WGZ A;  1H5T A;  5CQM X;  4HO4 A;  4N27 A;  1R7Y A;  3NZ2 A;  5C1G A;  1GWW A;  3U2U A;  1XHB A;  3IOH A;  3POL A;  4Y63 A;  1R7U A;  3DK5 A;  3FSC A;  2Y4K A;  4M99 A;  2GGO A;  1JYK A;  4EEG A;  2RIX A;  4JD0 A;  1TZF A;  4IHH A;  4CJB A;  1O23 B;  4HUS A;  2XAT A;  3SXE A;  1WT0 A;  4Y7T A;  3I0F A;  3Q7U A;  4Y7F A;  3DJ4 A;  1LZJ A;  1O0R A;  4Y6N A;  2O1H A;  3OC9 A;  1YP2 A;  5HS2 A;  1ZJ2 A;  3U2X A;  1WVC A;  1OCX A;  4FQW A;  1G23 A;  2E8B A;  5DG3 A;  3N9W A;  3DUV A;  2QH5 A;  4O6M A;  4IRP A;  4EAA A;  3U2V A;  5C38 A;  1ZIZ A;  4B5B A;  3R1W A;  1O7Q A;  2AE7 A;  4FRE A;  4YS8 A;  4CJC A;  2YQS A;  3VBP A;  5CMG X;  4EA7 A;  2AH9 A;  1J2Z A;  3TZT A;  2J0B A;  3HSQ A;  3TWD A;  1H5S A;  1SS9 A;  1TW1 A;  1QRM A;  1VZT A;  3R8Y A;  1XHD A;  3BRK X;  3SXD A;  1R81 A;  4DE7 A;  4N6B A;  5F42 A;  3V4E A;  1WT1 A;  1SSM A;  4FRQ A;  3BCV A;  3EG4 A;  1G8O A;  1G3L A;  1QRL A;  2NPO A;  1LL2 A;  3SXG A;  4D0Z A;  5IDT A;  4FCU A;  2OEG A;  3V0Q A;  4D11 A;  1FR8 A;  4HO0 A;  4D0T A;  1GQC A;  4FIY A;  1QWJ A;  1KRV A;  1H7H A;  4CJ8 A;  4B2W A;  3U0X A;  4EGG A;  3C8V A;  5DEP A;  3GOS A;  3GQ8 A;  2X65 A;  4E75 A;  5C1H A;  3ZLL A;  2Y7A A;  3GQ7 A;  1VZU A;  2JCL A;  3TIO A;  3MC4 A;  2AEC A;  2VK9 A;  1T3D A;  4UEG A;  3F1C A;  1GX0 A;  3SUC A;  3USR A;  4Y7V A;  1TVY A;  1FXO A;  4EEO A;  5FTV A;  1H4C A;  3SXB A;  3T7N A;  4EE5 A;  1ZDG A;  2FFV A;  1G97 A;  2RIT A;  4HO8 A;  4IRQ A;  1H4E A;  5EIY A;  2WLE A;  3R5A A;  3SX3 A;  3OH4 A;  1SST A;  1V67 A;  5U2K A;  5DDT A;  5D92 A;  4CVH A;  5E3Q A;  2AM3 A;  1QRF A;  2ZU8 A;  5J49 A;  3I0G A;  1HJL A;  2WEE A;  2RJ4 A;  1R82 A;  4Y7U A;  1QGQ A;  4AA7 A;  4BQH A;  2WLD A;  4BMA A;  3P1B A;  1V83 A;  4KT7 A;  1TDT A;  4Y7G A;  2Y4J A;  1Z2F A;  5DDV A;  4KQL A;  1VM8 A;  2VXM A;  1VGU A;  5CMH A;  1INJ A;  3Q1X A;  5DEM A;  1G93 A;  2FYC B;  3BSS A;  4KNR A;  3PNN A;  1ZJ1 A;  5ADX V;  4HO2 A;  2Z87 A;  1KK4 A;  2APC A;  2VSH A;  3BSY A;  1HJJ A;  1E5K A;  1M8N A;  2I5K A;  3R3I A;  5AFU U;  1R80 A;  2D7R A;  2QIA A;  2VS3 A;  1KK5 A;  2Y6P A;  3D5N A;  3RSB A;  4EA8 A;  3SX7 A;  1PZY B;  3TIS A;  1OMZ A;  4HG6 A;  1VH1 A;  1H5R A;  4G3S A;  1R7X A;  2IUA A;  4HCQ A;  3SRT A;  1S80 A;  1V84 A;  5ADX U;  3OU9 A;  4M98 A;  3GUE A;  3KWD A;  3KWE A;  4Y6U A;  3V0L A;  2I7B A;  2IU9 A;  1YRO B;  4AAW A;  2V0J A;  4B4M A;  2P6W A;  1ZJP A;  3FSB A;  3HL3 A;  3I0H A;  1ZJ0 A;  1JYL A;  1ZI3 A;  3VBJ A;  1V3W A;  3U0Y A;  4FRL A;  1H3M A;  3CKQ A;  1HM0 A;  4LW6 A;  3CKV A;  1MP3 A;  5CMF X;  1YP4 A;  3I3X A;  2FY7 A;  1ZHJ A;  1HV9 A;  4R36 A;  2PX7 A;  5FUH A;  4B4G A;  4P00 A;  3SPT A;  5CMI A;  3R5D A;  2XWN A;  1THJ A;  2X60 A;  2CU2 A;  3CKJ A;  1FRW A;  2IC7 A;  2JF2 A;  3BFP A;  1VH3 A;  3RMV A;  5C3A A;  2YC3 A;  3FTT A;  3R5C A;  3SXC A;  5C4B A;  5JQQ A;  1S4P A;  5IFY A;  4HO5 A;  2RIZ A;  1JV3 A;  1GWV A;  1GX4 A;  2YQC A;  1FWY A;  3I0K A;  3FSX A;  1KWS A;  1MR9 A;  3JQY A;  1FOA A;  1KRR A;  4EVW A;  2RJ7 A;  4FRM A;  4EAB A;  1GA8 A;  1TW5 A;  2YCM A;  1K4V A;  1QRG A;  1S4O A;  3QVB A;  2WLG A;  5FU0 A;  2GGQ A;  2FYD B;  1EWW A;  2W0V A;  3E26 A;  2D0J A;  1FZW A;  2AES A;  4AYJ A;  1FGG A;  3I0J A;  1ZJO A;  1FO9 A;  3VNP A;  4XWI A;  4AYL A;  2XME A;  4EE3 A;  1Z90 A;  1OQM B;  4NAK A;  3R0S A;  2Y4M A;  1JVD A;  2TDT A;  1H5T B;  1ZCT A;  3K8D A;  2YES A;  5CMJ A;  4K6R A;  2VD4 A;  3F1X A;  3GQ9 A;  2WVK A;  4B42 A;  5E3P A;  1LVW A;  2VFZ A;  4J09 A;  1V82 A;  2O1G A;  4NAL A;  1EZI A;  1EYR A;  3RMW A;  3PMO A;  1VGT A;  1H7G A;  1VGW A;  1ZI5 A;  4MYO A;  2X5S A;  5CQL X;  1ZJ3 A;  4ECM A;  3NGW A;  4HUR A;  2VS4 A;  3R3R A;  1H7E A;  1G2V A;  3HJJ A;  1I52 A;  4KRV A;  3TV0 A;  1ZCY A;  1JV1 A;  1LL3 A;  2RJ8 A;  1H7Q A;  2BO8 A;  2QIV X;  2A8U A;  3BSW A;  4JIS A;  1R7V A;  4M9C A;  1JVG A;  4M2A A;  2ZU9 A;  3V8Y A;  4B3U A;  5C8R A;  2WVL A;  4ZDQ A;  4N6A A;  3IGJ A;  2RIY A;  4MND A;  1H5S C;  4FRD A;  5C3D A;  1KK6 A;  3IOJ A;  2O1F A;  3F1Y A;  3O3P A;  4FRO A;  2DPW A;  5IDS A;  2BO7 A;  1H5S B;  3I0E A;  3FS8 A;  3T7O A;  3V91 A;  3I3A A;  4MZU A;  5C1L A;  3DHO A;  4D48 A;  4B2X A;  2AM4 A;  1HM9 A;  4EE4 A;  3PKQ A;  4IHF A;  2XWM A;  2QGI A;  4DDZ A;  3D98 A;  1ZI1 A;  3JUK A;  3ST8 A;  2P2O A;  2D7I A;  1FO8 A;  4MFG A;  5FV9 A;  2NXV A;  2A8W A;  3ZGF A;  5C49 A;  3I0I X;  4NAN A;  2AM5 A;  5C4D A;  4HO3 A;  1KQA A;  5E3R A;  1OMX A;  2Y4L A;  2ZU7 A;  2JF3 A;  1NHE B;  5AJO A;  4KC2 A;  4N69 A;  2JCJ A;  4FRA A;  3P47 A;  4E6U A;  5FYE A;  3I0D A;  4ASY A;  1SSQ A;  3I0L A;  2VHE A;  3BXY A;  1MP5 A;  4KC1 A;  3V0P A;  3MQG A;  2I5E A;  2ICY A;  2QKX A;  2OI7 A;  4R7P A;  2VS5 A;  2RJ5 A;  3CU0 A;  2RJ9 A;  5C47 A;  2W0W A;  2MZB A;  3R5B A;  1KGQ A;  4EEA A;  4EEM A;  1G9R A;  2XWL A;  4R37 A;  3VBL A;  3IXC A;  4G3P A;  1QG8 A;  3V0M A;  2P72 A;  5CQP A;  1S4N A;  1FR9 A;  2V0I A;  4HZD A;  4G3Q A;  5CQN X;  4C2S A;  3USQ A;  1H5R B;  4GBP A;  1ZI4 A;  3OH2 A;  1FG5 N;  4KNX A;  1WSZ A;  3VBI A;  3KIA A;  1XAT A;  4H7O A;  4E1K A;  3ZF8 A;  4Q7C A; 
#chains in the Genus database with same CATH homology
 3JTJ A;  1IIM A;  3OAM A;  5AJN A;  2OI6 A;  4M28 A;  2AGD A;  2J0A A;  3OUP A;  4B4B A;  2WLC A;  2YQJ A;  2WLF A;  4DEC A;  2FKO A;  4MYB A;  4EQY A;  1W57 A;  5CQO A;  2V0L A;  4ASJ A;  2VSI A;  2YQH A;  4KPZ A;  1NQI B;  2V0H A;  2WVM A;  2C0N A;  5AFU V;  4D11 C;  2XMH A;  1IIN A;  1ON8 A;  5D91 A;  1QGS A;  3CKN A;  4HZC A;  2RIJ A;  3VBK A;  4FRP A;  1VPA A;  3MQH A;  1GQ9 A;  5EJ1 A;  2Q4J A;  1FXJ A;  5C36 A;  1LXA A;  2FFU A;  1ZCV A;  4M4K A;  3SXA A;  2E3D A;  2UX8 A;  4FRB A;  1H7F A;  1VIC A;  4IHG A;  2Z86 A;  3V0N A;  1VZX A;  5AJP A;  1ZDF A;  1ZCU A;  1XZ6 A;  3TDT A;  2YC5 A;  2RJ1 A;  5FU8 A;  1R7T A;  3OW5 A;  4FIX A;  1KGT A;  2FYA A;  2PGY A;  3ZGG A;  2ICX A;  1NWG B;  1O7O A;  2P73 A;  4P02 A;  1ON6 A;  3V0O A;  4E79 A;  3TQD A;  4ARW A;  3U2W A;  1QRE A;  3CKO A;  3OKR A;  4KXO A;  1MC3 A;  5FTS A;  3K8E A;  3I0C A;  5C3B A;  1H4D A;  1W55 A;  4Y62 A;  4HOC A;  1NF5 B;  2VXL A;  1LL0 A;  1MR7 A;  2BO4 A;  3V8Z A;  3OGZ A;  1NKH B;  2IU8 A;  5L6V A;  4Y64 A;  4DCL A;  5L6S A;  3R2W A;  4FRH A;  5EJZ A;  2RJ6 A;  1KRU A;  1KHR A;  2WAW A;  3D8V A;  3Q80 A;  4MIX A;  3ZLK A;  1LZ7 A;  1VGZ A;  4LW3 A;  4G87 A;  3OTZ A;  5C4E A;  3IOI A;  1G1L A;  3EEV A;  3FWW A;  2OI5 A;  3ECT A;  3TK8 A;  5BXC A;  1H7T A;  3EH0 A;  3LW6 A;  4ISX A;  4NAI A;  1W77 A;  3OTM A;  1INI A;  3OH0 A;  3CJ8 A;  3KWC A;  1MP4 A;  3VBN A;  3Q4S A;  3SX8 A;  1G95 A;  3FOQ A;  2PGV A;  4KC4 A;  3U2T A;  1FGX A;  3E25 A;  1HM8 A;  1NMM B;  4Y9X A;  3OH3 A;  3FSY A;  4KPX A;  4EA9 A;  4HO9 A;  3SX5 A;  2RJ0 A;  3V90 A;  2OEF A;  3T7M A;  4FCE A;  1PZT A;  3VBM A;  1H5S D;  4J18 A;  2AQ9 A;  1G0R A;  2JCK A;  1WT3 A;  3GVD A;  5C4F A;  3EE5 A;  4AC3 A;  1WT2 A;  4HO6 A;  2FYB A;  3JUJ A;  4E6T A;  3T57 A;  5I1F A;  3CGX A;  4O6N A;  2WE9 A;  1MRL A;  2BO6 A;  4M2B A;  1LZ0 A;  5C48 A;  2X5Z A;  3OH1 A;  3PKP A;  1H7L A;  2JCO A;  1QQ0 A;  5C4C A;  2V0K A;  1YP3 A;  1LZI A;  2PA4 A;  4L41 C;  2WGZ A;  1H5T A;  5CQM X;  4HO4 A;  4N27 A;  1R7Y A;  3NZ2 A;  5C1G A;  1GWW A;  3U2U A;  1XHB A;  3IOH A;  3POL A;  4Y63 A;  1R7U A;  3DK5 A;  3FSC A;  2Y4K A;  4M99 A;  2GGO A;  1JYK A;  4EEG A;  2RIX A;  4JD0 A;  1TZF A;  4IHH A;  4CJB A;  1O23 B;  4HUS A;  2XAT A;  3SXE A;  1WT0 A;  4Y7T A;  3I0F A;  3Q7U A;  4Y7F A;  3DJ4 A;  1LZJ A;  1O0R A;  4Y6N A;  2O1H A;  3OC9 A;  1YP2 A;  5HS2 A;  1ZJ2 A;  3U2X A;  1WVC A;  1OCX A;  4FQW A;  1G23 A;  2E8B A;  5DG3 A;  3N9W A;  3DUV A;  2QH5 A;  4O6M A;  4IRP A;  4EAA A;  3U2V A;  5C38 A;  1ZIZ A;  4B5B A;  3R1W A;  1O7Q A;  2AE7 A;  4FRE A;  4YS8 A;  4CJC A;  2YQS A;  3VBP A;  5CMG X;  4EA7 A;  2AH9 A;  1J2Z A;  3TZT A;  2J0B A;  3HSQ A;  3TWD A;  1H5S A;  1SS9 A;  1TW1 A;  1QRM A;  1VZT A;  3R8Y A;  1XHD A;  3BRK X;  3SXD A;  1R81 A;  4DE7 A;  4N6B A;  5F42 A;  3V4E A;  1WT1 A;  1SSM A;  4FRQ A;  3BCV A;  3EG4 A;  1G8O A;  1G3L A;  1QRL A;  2NPO A;  1LL2 A;  3SXG A;  4D0Z A;  5IDT A;  4FCU A;  2OEG A;  3V0Q A;  4D11 A;  1FR8 A;  4HO0 A;  4D0T A;  1GQC A;  4FIY A;  1QWJ A;  1KRV A;  1H7H A;  4CJ8 A;  4B2W A;  3U0X A;  4EGG A;  3C8V A;  5DEP A;  3GOS A;  2X65 A;  5C1H A;  4E75 A;  3ZLL A;  2Y7A A;  1VZU A;  2JCL A;  3TIO A;  3MC4 A;  2AEC A;  2VK9 A;  1T3D A;  4UEG A;  3F1C A;  1GX0 A;  3USR A;  4Y7V A;  1TVY A;  1FXO A;  4EEO A;  5FTV A;  1H4C A;  3SXB A;  3T7N A;  4EE5 A;  1ZDG A;  2FFV A;  1G97 A;  2RIT A;  4HO8 A;  4IRQ A;  1H4E A;  5EIY A;  2WLE A;  3R5A A;  3SX3 A;  3OH4 A;  1SST A;  1V67 A;  5U2K A;  5DDT A;  5D92 A;  4CVH A;  5E3Q A;  2AM3 A;  1QRF A;  2ZU8 A;  5J49 A;  3I0G A;  1HJL A;  2WEE A;  2RJ4 A;  1R82 A;  4Y7U A;  1QGQ A;  4AA7 A;  4BQH A;  2WLD A;  4BMA A;  3P1B A;  1V83 A;  4KT7 A;  1TDT A;  4Y7G A;  2Y4J A;  5DDV A;  4KQL A;  1VM8 A;  2VXM A;  1VGU A;  5CMH A;  1INJ A;  3Q1X A;  5DEM A;  1G93 A;  2FYC B;  3BSS A;  4KNR A;  3PNN A;  1ZJ1 A;  5ADX V;  4HO2 A;  2Z87 A;  1KK4 A;  2APC A;  2VSH A;  3BSY A;  1HJJ A;  1E5K A;  3R3I A;  2I5K A;  5AFU U;  1R80 A;  2D7R A;  2QIA A;  2VS3 A;  1KK5 A;  2Y6P A;  3D5N A;  3RSB A;  4EA8 A;  3SX7 A;  1PZY B;  3TIS A;  1OMZ A;  4HG6 A;  1VH1 A;  1H5R A;  4G3S A;  1R7X A;  2IUA A;  4HCQ A;  3SRT A;  1S80 A;  1V84 A;  5ADX U;  3OU9 A;  4M98 A;  3GUE A;  3KWD A;  3KWE A;  4Y6U A;  3V0L A;  2I7B A;  2IU9 A;  1YRO B;  4AAW A;  2V0J A;  4B4M A;  2P6W A;  1ZJP A;  3FSB A;  3HL3 A;  3I0H A;  1ZJ0 A;  1JYL A;  1ZI3 A;  3VBJ A;  1V3W A;  3U0Y A;  4FRL A;  1H3M A;  3CKQ A;  1HM0 A;  4LW6 A;  3CKV A;  1MP3 A;  5CMF X;  1YP4 A;  3I3X A;  2FY7 A;  1ZHJ A;  1HV9 A;  4R36 A;  2PX7 A;  5FUH A;  4B4G A;  4P00 A;  3SPT A;  5CMI A;  3R5D A;  2XWN A;  1THJ A;  2X60 A;  2CU2 A;  3CKJ A;  1FRW A;  2IC7 A;  2JF2 A;  3BFP A;  1VH3 A;  3RMV A;  5C3A A;  2YC3 A;  3FTT A;  3R5C A;  3SXC A;  5C4B A;  5JQQ A;  1S4P A;  5IFY A;  4HO5 A;  2RIZ A;  1JV3 A;  1GWV A;  1GX4 A;  2YQC A;  1FWY A;  3I0K A;  3FSX A;  1KWS A;  1MR9 A;  3JQY A;  1FOA A;  1KRR A;  4EVW A;  2RJ7 A;  4FRM A;  4EAB A;  1GA8 A;  1TW5 A;  2YCM A;  1K4V A;  1QRG A;  1S4O A;  3QVB A;  2WLG A;  5FU0 A;  2GGQ A;  2FYD B;  2W0V A;  3E26 A;  2D0J A;  1FZW A;  2AES A;  4AYJ A;  1FGG A;  3I0J A;  1ZJO A;  1FO9 A;  3VNP A;  4XWI A;  4AYL A;  2XME A;  4EE3 A;  1Z90 A;  1OQM B;  4NAK A;  3R0S A;  2Y4M A;  1JVD A;  2TDT A;  1H5T B;  1ZCT A;  3K8D A;  2YES A;  5CMJ A;  4K6R A;  2VD4 A;  3F1X A;  2WVK A;  4B42 A;  5E3P A;  1LVW A;  2VFZ A;  4J09 A;  1V82 A;  2O1G A;  4NAL A;  1EZI A;  1EYR A;  3RMW A;  3PMO A;  1VGT A;  1H7G A;  1VGW A;  1ZI5 A;  4MYO A;  2X5S A;  5CQL X;  1ZJ3 A;  4ECM A;  3NGW A;  4HUR A;  2VS4 A;  3R3R A;  1H7E A;  1G2V A;  3HJJ A;  1I52 A;  4KRV A;  3TV0 A;  1ZCY A;  1JV1 A;  1LL3 A;  2RJ8 A;  1H7Q A;  2BO8 A;  2QIV X;  2A8U A;  3BSW A;  4JIS A;  1R7V A;  4M9C A;  1JVG A;  4M2A A;  2ZU9 A;  3V8Y A;  4B3U A;  5C8R A;  2WVL A;  4ZDQ A;  4N6A A;  3IGJ A;  2RIY A;  4MND A;  1H5S C;  4FRD A;  5C3D A;  1KK6 A;  3IOJ A;  2O1F A;  3F1Y A;  3O3P A;  4FRO A;  2DPW A;  5IDS A;  2BO7 A;  1H5S B;  3I0E A;  3FS8 A;  3T7O A;  3V91 A;  3I3A A;  4MZU A;  5C1L A;  3DHO A;  4D48 A;  4B2X A;  2AM4 A;  1HM9 A;  4EE4 A;  3PKQ A;  4IHF A;  2XWM A;  2QGI A;  4DDZ A;  3D98 A;  1ZI1 A;  3JUK A;  3ST8 A;  2P2O A;  2D7I A;  1FO8 A;  4MFG A;  5FV9 A;  2NXV A;  2A8W A;  3ZGF A;  5C49 A;  3I0I X;  4NAN A;  2AM5 A;  5C4D A;  4HO3 A;  1KQA A;  5E3R A;  1OMX A;  2Y4L A;  2ZU7 A;  2JF3 A;  1NHE B;  5AJO A;  4KC2 A;  4N69 A;  2JCJ A;  4FRA A;  3P47 A;  4E6U A;  5FYE A;  3I0D A;  4ASY A;  1SSQ A;  3I0L A;  2VHE A;  3BXY A;  1MP5 A;  4KC1 A;  3V0P A;  3MQG A;  2I5E A;  2ICY A;  2QKX A;  2OI7 A;  4R7P A;  2VS5 A;  2RJ5 A;  3CU0 A;  2RJ9 A;  5C47 A;  2W0W A;  2MZB A;  3R5B A;  1KGQ A;  4EEA A;  4EEM A;  1G9R A;  2XWL A;  4R37 A;  3VBL A;  3IXC A;  4G3P A;  1QG8 A;  3V0M A;  2P72 A;  5CQP A;  1S4N A;  1FR9 A;  2V0I A;  4HZD A;  4G3Q A;  5CQN X;  4C2S A;  3USQ A;  1H5R B;  4GBP A;  1ZI4 A;  3OH2 A;  1FG5 N;  4KNX A;  1WSZ A;  3VBI A;  3KIA A;  1XAT A;  4H7O A;  4E1K A;  3ZF8 A;  4Q7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...