4G3PA

Crystal structure of glmu from mycobacterium tuberculosis snapshot 3
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Structural Snapshots of Glmu from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 166
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g3pA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g3pA01
2AECA 2E3DA 1H3MA 5FUHA 3OTZA 3VBIA 5AJPA 3ZLLA 1KRVA 3VBPA 2OEGA 1KK4A 3Q80A 4HO2A 4D0ZA 2YQCA 3V90A 4Y7UA 2QIVX 1H5TA 2VFZA 2QIAA 3MC4A 3JUJA 4KXOA 4NAIA 1G8OA 5AJNA 3P47A 5EJZA 2X60A 4AYLA 2TDTA 4IRPA 1QQ0A 3U2XA 5ADXV 4M99A 4B4GA 2AQ9A 1ZI4A 1NWGB 1FR8A 2WVKA 2Q4JA 1GX4A 4EE4A 4HO5A 2VHEA 2ZU7A 2WLGA 1G0RA 1H4DA 3EEVA 1H5SD 4C2SA 1H5RB 1VZTA 1ZJ2A 4CVHA 4KC4A 5IDTA 1SSMA 4ZDQA 5CMIA 3D8VA 1R7VA 1LZIA 3CKJA 1QG8A 2VXLA 1MP3A 3U2TA 1H5SC 3U2VA 1ON6A 1GQ9A 3K8DA 1ZDGA 4CJCA 2OI7A 1FGGA 4Y7TA 1R81A 3SXCA 3I0HA 2RJ1A 4IHFA 2E8BA 2RJ4A 1R7TA 4DDZA 3V0NA 2RITA 1R7UA 3LW6A 3VNPA 2AM5A 1ZCVA 5E3RA 1ZCTA 1JYKA 3F1CA 1H5SA 3V0LA 3R2WA 4FRLA 4HO6A 1H7FA 1G2VA 2P73A 3IOHA 4EVWA 3OU9A 1FZWA 3R5CA 1FG5N 2O1GA 3FSBA 3IOJA 4R7PA 2V0IA 4DECA 3TZTA 4UEGA 1G95A 3R5AA 4G3SA 1G1LA 2VD4A 1NQIB 1TDTA 3SPTA 2YQHA 1H7EA 4KPZA 1INJA 1ON8A 1WT0A 4B4BA 4B5BA 2RIZA 5C1GA 3V0OA 4BQHA 2PGVA 1FGXA 5C36A 1LZ7A 4Y7FA 2O1FA 1TW5A 4FRAA 3HJJA 1FR9A 2W0VA 3NZ2A 1YP3A 1JYLA 1LL2A 5CMGX 2VSIA 5E3QA 2W0WA 3U0XA 3SXGA 4DE7A 5U2KA 1J2ZA 4Y9XA 5DEPA 3BSSA 4R37A 1KRRA 5I1FA 3I3AA 1TZFA 5FYEA 5FU8A 3DUVA 3CKNA 4D0TA 4FRPA 5CMJA 3OH4A 5C1HA 3JTJA 3OAMA 3SXBA 5EJ1A 2IC7A 3IXCA 1NF5B 2RIJA 4EGGA 5C47A 3U0YA 1JVDA 1JVGA 3ST8A 1G3LA 1V83A 1GWWA 4FRDA 1QREA 2D7IA 1W55A 4EEMA 1V3WA 3VBNA 3PMOA 4N69A 2IUAA 4KPXA 3OGZA 4FCEA 1LVWA 1VGWA 2YQJA 3OW5A 1MC3A 2FFVA 3MQHA 2X5ZA 3V0MA 4KQLA 3ZGFA 1SSQA 2ZU9A 2QKXA 3POLA 4Y6NA 3I0IX 3SXEA 2PA4A 4D11A 4HZDA 1YP2A 5AFUU 4R36A 3KIAA 1OQMB 1QRLA 1HJJA 3CKVA 1QRMA 3O3PA 3SXDA 2AE7A 4M4KA 3K8EA 3OH1A 3I3XA 5DDVA 1KGTA 4G3PA 5C8RA 1ZCYA 1O0RA 1VZUA 1WT2A 1VGTA 4KC2A 4FRBA 4HO8A 5FTSA 4EEOA 1QGSA 4HO4A 4ARWA 2ZU8A 4HURA 3V0QA 1FO9A 2Y4KA 4Y7GA 1O7QA 4Y64A 3GUEA 1OCXA 1FXOA 5FTVA 5JQQA 1OMXA 2XWLA 5FU0A 1XHBA 1H7LA 1VH1A 2JCLA 2ICYA 2V0LA 3T7NA 4IRQA 1G23A 2PGYA 4MNDA 1XZ6A 1QRFA 3PKQA 4B42A 5IDSA 3FOQA 3EE5A 3I0LA 2APCA 4FCUA 4MYOA 3FSXA 3FSYA 1HV9A 4EEGA 2AGDA 1KHRA 1XATA 4B2WA 1H7QA 5CQNX 3Q4SA 4IHGA 3C8VA 2X5SA 2VS3A 3EG4A 3SX8A 1SS9A 3RMWA 4J18A 4M28A 3I0GA 5DG3A 2A8UA 2WAWA 1O23B 3IOIA 3BFPA 2I7BA 5L6VA 1V67A 1VM8A 2P2OA 2BO6A 2Y6PA 3JQYA 2AM3A 1VZXA 1ZJOA 3CU0A 2JF3A 4B3UA 5J49A 1HM8A 1MR7A 3FSCA 2AM4A 3GOSA 4B4MA 4G87A 4AA7A 3TIOA 3OH0A 3CGXA 4KNRA 4NAKA 4MYBA 1T3DA 3V8ZA 2P72A 1SSTA 3VBKA 4Y63A 1H5RA 3V8YA 1O7OA 5C4DA 4HZCA 3QVBA 2NPOA 5C4CA 4Y7VA 1I52A 3FS8A 2NXVA 2OI5A 4JISA 1OMZA 2QH5A 3USRA 1ZJ0A 5C3AA 2I5KA 1ZJPA 3R3RA 2RIYA 4E6TA 2ICXA 1GQCA 5CQMX 1H4EA 5IFYA 3GVDA 1WSZA 4P00A 1YROB 2QGIA 1PZYB 1QWJA 2RJ5A 2D0JA 2VSHA 1MR9A 2RIXA 5AFUV 2V0KA 3BRKX 2WVMA 4LW6A 2BO4A 4FQWA 1MRLA 4CJ8A 1GWVA 2D7RA 4J09A 1IINA 2OI6A 2FYDB 3FWWA 1HJLA 3Q7UA 3I0KA 5HS2A 5FV9A 4DCLA 3ZLKA 3TWDA 4EE3A 1W77A 4D11C 1LZ0A 2AESA 4E1KA 3JUKA 2XWNA 2CU2A 4ECMA 2AH9A 3TK8A 4JD0A 4K6RA 1H5TB 2FYBA 3FTTA 4HO0A 1H7TA 1MP4A 2WLFA 5F42A 2FKOA 4KRVA 4FRHA 1KGQA 1XHDA 4HOCA 3N9WA 3RMVA 1W57A 3DK5A 3V4EA 4L41C 1KK5A 1H7HA 4EA7A 1NHEB 5C48A 4MZUA 1GA8A 3PKPA 4G3QA 1ZI3A 1S80A 3R3IA 3OH3A 5CMHA 4EEAA 1FOAA 1R7XA 1HM9A 2O1HA 4AC3A 4LW3A 1FWYA 2XMHA 1QRGA 2YC5A 3ECTA 2GGOA 3HL3A 4EABA 1G93A 1FXJA 1ZIZA 5C4BA 1YP4A 1NMMB 1V82A 3V0PA 2Y4JA 2WGZA 3CKOA 2XATA 2Z87A 4AYJA 2Y4MA 4BMAA 3T7MA 1Z90A 3Q1XA 2MZBA 3KWCA 5E3PA 5C3DA 1H4CA 2RJ7A 1V84A 2WLEA 3KWDA 3T57A 4E79A 4ASYA 4EQYA 3OH2A 1G9RA 4Y6UA 1S4PA 4FREA 5C4EA 5CMFX 1EZIA 1GX0A 4ASJA 3SX7A 4NALA 1H5SB 2WVLA 1VGUA 4B2XA 1VICA 1LZJA 1WT1A 4N6AA 2FYAA 2XMEA 5CQPA 4YS8A 2P6WA 1LL3A 5C3BA 1PZTA 4IHHA 3TV0A 1ZCUA 2YC3A 4GBPA 2VS4A 5EIYA 3U2WA 4HUSA 1R80A 1VPAA 3DHOA 4NANA 1KWSA 3R1WA 2UX8A 3OC9A 2GGQA 3F1XA 4HG6A 1TW1A 1HM0A 4ISXA 1LL0A 1H7GA 3D5NA 3CJ8A 3SXAA 4D48A 2V0JA 1KQAA 5C38A 1K4VA 1MP5A 1FRWA 3EH0A 1S4OA 5CQOA 1FO8A 4EE5A 4EA8A 1S4NA 1R7YA 2PX7A 3PNNA 1WT3A 2FY7A 2WLDA 4H7OA 2BO8A 5AJOA 3P1BA 1WVCA 3OKRA 2YESA 2A8WA 3I0DA 1KK6A 1ZJ1A 3BXYA 4M2AA 1VH3A 2V0HA 5C49A 2Y4LA 3ZF8A 5DEMA 3BCVA 3USQA 4HO3A 3TQDA 4AAWA 5ADXU 4Y62A 4M9CA 2JCKA 1INIA 2RJ0A 5CQLX 5C1LA 2I5EA 4HCQA 3VBJA 3ZGGA 4M98A 2Z86A 3VBLA 3D98A 1ZJ3A 4MFGA 2RJ6A 4E75A 4FRMA 3R5BA 1ZHJA 3BSWA 3DJ4A 1KRUA 1THJA 2YQSA 1R82A 3OTMA 1ZI1A 1ZI5A 3V91A 3CKQA 3OUPA 2JCJA 2JF2A 3R5DA 1IIMA 1E5KA 1JV3A 2VS5A 3I0EA 2RJ9A 4EAAA 3E26A 3R8YA 2FYCB 3E25A 3NGWA 3SX3A 3I0JA 5C4FA 3F1YA 4N27A 3RSBA 3T7OA 3MQGA 5DDTA 3TISA 3I0FA 2Y7AA 3SX5A 2XWMA 1ZDFA 3HSQA 2BO7A 3I0CA 4XWIA 1QGQA 2WEEA 4M2BA 2OEFA 4KNXA 4P02A 2X65A 1TVYA 3VBMA 2DPWA 3TDTA 3SRTA 1NKHB 1VGZA 1JV1A 5L6SA 4CJBA 4N6BA 4FRQA 4FROA 2WE9A 2FFUA 1EYRA 2WLCA 4EA9A 3BSYA 2RJ8A 1G97A 2IU9A 4E6UA 3U2UA 3IGJA 1LXAA 2YCMA 4KC1A 5BXCA 3KWEA 2JCOA 2IU8A 3R0SA 2VXMA 4HO9A 4KT7A
chains in the Genus database with same CATH superfamily
2AECA 2E3DA 5D92A 1H3MA 5FUHA 3OTZA 3VBIA 5AJPA 3ZLLA 1KRVA 3VBPA 2OEGA 1KK4A 3Q80A 4HO2A 4D0ZA 2YQCA 3V90A 4Y7UA 2QIVX 1H5TA 2VFZA 2QIAA 3MC4A 3JUJA 4KXOA 4NAIA 1G8OA 5AJNA 3P47A 5EJZA 2X60A 4AYLA 2TDTA 4IRPA 1QQ0A 3U2XA 5ADXV 4M99A 4B4GA 2AQ9A 1ZI4A 1NWGB 1FR8A 2WVKA 2Q4JA 1GX4A 4EE4A 4HO5A 2VHEA 2ZU7A 2WLGA 1G0RA 1H4DA 3EEVA 1H5SD 4C2SA 1H5RB 1VZTA 1ZJ2A 4CVHA 4KC4A 5IDTA 1SSMA 4ZDQA 5CMIA 5D91A 4O6MA 3D8VA 1R7VA 1LZIA 3CKJA 1QG8A 2VXLA 1MP3A 3U2TA 1H5SC 3U2VA 1ON6A 1GQ9A 3K8DA 1ZDGA 4CJCA 2J0BA 2OI7A 1FGGA 4Y7TA 1R81A 3SXCA 3I0HA 2RJ1A 4IHFA 2E8BA 2RJ4A 1R7TA 4DDZA 3V0NA 2RITA 1R7UA 3LW6A 1N4IA 3VNPA 2AM5A 1ZCVA 4MIXA 5E3RA 1ZCTA 1JYKA 3F1CA 1H5SA 3V0LA 3R2WA 4FRLA 4HO6A 1H7FA 1G2VA 4O6NA 2P73A 3IOHA 4EVWA 3OU9A 1L0SA 1FZWA 3R5CA 1FG5N 2O1GA 3FSBA 4FIYA 3IOJA 4R7PA 2V0IA 4DECA 3TZTA 4UEGA 1G95A 3R5AA 4G3SA 1G1LA 2VD4A 1NQIB 1TDTA 3SPTA 2YQHA 1H7EA 4KPZA 1INJA 1ON8A 1WT0A 4B4BA 4B5BA 2RIZA 5C1GA 3V0OA 4BQHA 2PGVA 1FGXA 5C36A 1LZ7A 4Y7FA 2O1FA 1TW5A 4FRAA 3HJJA 1FR9A 2W0VA 3NZ2A 1YP3A 1JYLA 1LL2A 4Q7CA 5CMGX 2VSIA 5E3QA 3GQ8A 2W0WA 3U0XA 3SXGA 4DE7A 5U2KA 1J2ZA 4Y9XA 5DEPA 3BSSA 4R37A 1KRRA 5I1FA 3I3AA 1TZFA 5FYEA 5FU8A 3DUVA 3CKNA 4D0TA 4FRPA 5CMJA 3OH4A 5C1HA 3JTJA 3OAMA 3SXBA 5EJ1A 2IC7A 3IXCA 1NF5B 2RIJA 4EGGA 5C47A 3U0YA 1JVDA 1JVGA 3ST8A 1G3LA 1V83A 1GWWA 4FRDA 1QREA 2D7IA 1W55A 4EEMA 1V3WA 3VBNA 3PMOA 4N69A 2IUAA 4KPXA 3OGZA 4FCEA 1LVWA 1VGWA 2YQJA 3OW5A 1MC3A 2FFVA 3MQHA 2X5ZA 3V0MA 4KQLA 3ZGFA 1SSQA 2ZU9A 2QKXA 3POLA 4Y6NA 3I0IX 3SXEA 2PA4A 4D11A 4HZDA 1YP2A 5AFUU 4R36A 3KIAA 1OQMB 1QRLA 1HJJA 3CKVA 1QRMA 3O3PA 3SXDA 2AE7A 4M4KA 3K8EA 3OH1A 3I3XA 5DDVA 1KGTA 4G3PA 5C8RA 1ZCYA 1O0RA 1VZUA 1WT2A 1VGTA 4KC2A 4FRBA 4HO8A 5FTSA 4EEOA 1QGSA 4HO4A 4ARWA 2ZU8A 2C0NA 4HURA 3V0QA 1FO9A 2Y4KA 4Y7GA 1O7QA 4Y64A 3GUEA 1OCXA 1FXOA 5FTVA 5JQQA 1OMXA 2XWLA 5FU0A 1XHBA 1H7LA 1VH1A 2JCLA 2ICYA 2V0LA 3T7NA 4IRQA 1G23A 2PGYA 4MNDA 1XZ6A 1QRFA 3PKQA 4B42A 5IDSA 3FOQA 3EE5A 3I0LA 2APCA 4FCUA 4MYOA 1Z2FA 3FSXA 1EWWA 3FSYA 1HV9A 4EEGA 2AGDA 1KHRA 1XATA 4B2WA 1H7QA 5CQNX 3Q4SA 4IHGA 3C8VA 2X5SA 2VS3A 3EG4A 3SX8A 1SS9A 3RMWA 4J18A 4M28A 3I0GA 5DG3A 2A8UA 2WAWA 1O23B 3IOIA 3BFPA 2I7BA 5L6VA 1V67A 1VM8A 2P2OA 2BO6A 2Y6PA 3JQYA 2AM3A 1VZXA 1ZJOA 3CU0A 2JF3A 4B3UA 5J49A 1HM8A 1MR7A 3FSCA 2AM4A 3GOSA 4B4MA 3OH0A 4G87A 3TIOA 4AA7A 3CGXA 4KNRA 4NAKA 4MYBA 1T3DA 3V8ZA 2P72A 1SSTA 3VBKA 4Y63A 1H5RA 3V8YA 1O7OA 5C4DA 4HZCA 3QVBA 2NPOA 5C4CA 4Y7VA 1I52A 3FS8A 2NXVA 2OI5A 4JISA 1OMZA 2QH5A 3USRA 1M8NA 1ZJ0A 2I5KA 1ZJPA 5C3AA 3R3RA 2RIYA 4E6TA 2ICXA 1GQCA 5CQMX 1H4EA 5IFYA 3GVDA 2J0AA 1WSZA 4P00A 1YROB 2QGIA 1PZYB 1QWJA 2RJ5A 2D0JA 2VSHA 1MR9A 2RIXA 5AFUV 2V0KA 3BRKX 2WVMA 4LW6A 2BO4A 4FQWA 1MRLA 4CJ8A 1GWVA 2D7RA 4J09A 1IINA 2OI6A 2FYDB 3FWWA 1HJLA 3Q7UA 3I0KA 5HS2A 5FV9A 4DCLA 3ZLKA 3TWDA 4EE3A 1W77A 4D11C 1LZ0A 2AESA 4E1KA 3JUKA 2XWNA 2CU2A 4ECMA 2AH9A 3TK8A 4JD0A 4K6RA 1H5TB 2FYBA 3FTTA 4HO0A 1H7TA 1MP4A 2WLFA 5F42A 2FKOA 4KRVA 4FRHA 1KGQA 2VK9A 1XHDA 4HOCA 3N9WA 3RMVA 1W57A 3DK5A 3V4EA 4L41C 1KK5A 1H7HA 4EA7A 1NHEB 5C48A 4MZUA 1GA8A 3PKPA 4G3QA 1ZI3A 1S80A 3R3IA 3OH3A 5CMHA 4EEAA 1FOAA 1R7XA 1HM9A 2O1HA 4AC3A 4LW3A 1FWYA 2XMHA 1QRGA 2YC5A 3ECTA 2GGOA 3HL3A 4EABA 1G93A 1FXJA 1ZIZA 5C4BA 1YP4A 1NMMB 1V82A 3V0PA 2Y4JA 2WGZA 3CKOA 2XATA 2Z87A 4AYJA 2Y4MA 4BMAA 3T7MA 1Z90A 3Q1XA 2MZBA 3KWCA 5E3PA 5C3DA 1H4CA 2RJ7A 1V84A 2WLEA 3GQAA 3KWDA 3T57A 4E79A 4ASYA 3OH2A 4EQYA 1G9RA 4Y6UA 1S4PA 4FREA 5C4EA 5CMFX 1EZIA 1GX0A 4ASJA 3SX7A 4NALA 1H5SB 2WVLA 1VGUA 4B2XA 1VICA 1LZJA 1WT1A 4N6AA 2FYAA 2XMEA 5CQPA 4YS8A 2P6WA 1LL3A 5C3BA 1PZTA 4IHHA 3TV0A 1ZCUA 2YC3A 4GBPA 2VS4A 5EIYA 3U2WA 4HUSA 1R80A 1VPAA 3DHOA 4NANA 1KWSA 3R1WA 2UX8A 3OC9A 2GGQA 3F1XA 4HG6A 1TW1A 1HM0A 4ISXA 1LL0A 1H7GA 3D5NA 3CJ8A 3SXAA 4D48A 2V0JA 1KQAA 5C38A 1K4VA 1MP5A 1FRWA 4FIXA 3EH0A 1S4OA 5CQOA 1FO8A 4EE5A 4EA8A 1S4NA 1R7YA 2PX7A 3PNNA 1WT3A 2FY7A 2WLDA 4H7OA 2BO8A 5AJOA 3P1BA 1WVCA 3OKRA 2YESA 2A8WA 3I0DA 1KK6A 1ZJ1A 3BXYA 4M2AA 1VH3A 2V0HA 5C49A 2Y4LA 3ZF8A 5DEMA 3BCVA 3USQA 4HO3A 3TQDA 4AAWA 5ADXU 4Y62A 4M9CA 3GQ9A 2JCKA 1INIA 2RJ0A 5CQLX 5C1LA 2I5EA 4HCQA 3VBJA 3ZGGA 4M98A 2Z86A 3VBLA 3D98A 1ZJ3A 4MFGA 2RJ6A 4E75A 4FRMA 3R5BA 1ZHJA 3BSWA 3DJ4A 1KRUA 1THJA 2YQSA 1R82A 3OTMA 1ZI1A 1ZI5A 3V91A 3CKQA 3OUPA 3GQ7A 2JCJA 2JF2A 3R5DA 1IIMA 1E5KA 1JV3A 2VS5A 3I0EA 2RJ9A 4EAAA 3E26A 3R8YA 2FYCB 3E25A 3NGWA 3SX3A 3I0JA 5C4FA 3F1YA 4N27A 3RSBA 3T7OA 3MQGA 5DDTA 3TISA 3I0FA 2Y7AA 3SX5A 2XWMA 1ZDFA 3HSQA 2BO7A 3I0CA 4XWIA 3SUCA 1QGQA 2WEEA 4M2BA 2OEFA 4KNXA 4P02A 2X65A 1TVYA 3VBMA 2DPWA 3TDTA 3SRTA 1NKHB 1VGZA 1JV1A 5L6SA 4CJBA 4N6BA 4FRQA 4FROA 2WE9A 2FFUA 1EYRA 2WLCA 4EA9A 3BSYA 2RJ8A 1G97A 2IU9A 4E6UA 3U2UA 3IGJA 1LXAA 2YCMA 4KC1A 5BXCA 3KWEA 2JCOA 2IU8A 3R0SA 2VXMA 4HO9A 4KT7A
chains in the Genus database with same CATH topology
2AECA 2E3DA 5D92A 1H3MA 5FUHA 3OTZA 3VBIA 5AJPA 3ZLLA 1KRVA 3VBPA 2OEGA 1KK4A 3Q80A 4HO2A 4D0ZA 2YQCA 3V90A 4Y7UA 2QIVX 1H5TA 2VFZA 2QIAA 3MC4A 3JUJA 4KXOA 4NAIA 1G8OA 5AJNA 3P47A 5EJZA 2X60A 4AYLA 2TDTA 4IRPA 1QQ0A 3U2XA 5ADXV 4M99A 4B4GA 2AQ9A 1ZI4A 1NWGB 1FR8A 2WVKA 2Q4JA 1GX4A 4EE4A 4HO5A 2VHEA 2ZU7A 2WLGA 1G0RA 1H4DA 3EEVA 1H5SD 4C2SA 1H5RB 1VZTA 1ZJ2A 4CVHA 4KC4A 5IDTA 1SSMA 4ZDQA 5CMIA 5D91A 4O6MA 3D8VA 1R7VA 1LZIA 3CKJA 1QG8A 2VXLA 1MP3A 3U2TA 1H5SC 3U2VA 1ON6A 1GQ9A 3K8DA 1ZDGA 4CJCA 2J0BA 2OI7A 1FGGA 4Y7TA 1R81A 3SXCA 3I0HA 2RJ1A 4IHFA 2E8BA 2RJ4A 1R7TA 4DDZA 3V0NA 2RITA 1R7UA 3LW6A 3VNPA 2AM5A 1ZCVA 4MIXA 5E3RA 1ZCTA 1JYKA 3F1CA 1H5SA 3V0LA 3R2WA 4FRLA 4HO6A 1H7FA 1G2VA 4O6NA 2P73A 3IOHA 4EVWA 3OU9A 1FZWA 3R5CA 1FG5N 2O1GA 3FSBA 4FIYA 3IOJA 4R7PA 2V0IA 4DECA 3TZTA 4UEGA 1G95A 3R5AA 4G3SA 1G1LA 2VD4A 1NQIB 1TDTA 3SPTA 2YQHA 1H7EA 4KPZA 1INJA 1ON8A 1WT0A 4B4BA 4B5BA 2RIZA 5C1GA 3V0OA 4BQHA 2PGVA 1FGXA 5C36A 1LZ7A 4Y7FA 2O1FA 1TW5A 4FRAA 3HJJA 1FR9A 2W0VA 3NZ2A 1YP3A 1JYLA 1LL2A 4Q7CA 5CMGX 2VSIA 5E3QA 2W0WA 3U0XA 3SXGA 4DE7A 5U2KA 1J2ZA 4Y9XA 5DEPA 3BSSA 4R37A 1KRRA 5I1FA 3I3AA 1TZFA 5FYEA 5FU8A 3DUVA 3CKNA 4D0TA 4FRPA 5CMJA 3OH4A 5C1HA 3JTJA 3OAMA 3SXBA 5EJ1A 2IC7A 3IXCA 1NF5B 2RIJA 4EGGA 5C47A 3U0YA 1JVDA 1JVGA 3ST8A 1G3LA 1V83A 1GWWA 4FRDA 1QREA 2D7IA 1W55A 4EEMA 1V3WA 3VBNA 3PMOA 4N69A 2IUAA 4KPXA 3OGZA 4FCEA 1LVWA 1VGWA 2YQJA 3OW5A 1MC3A 2FFVA 3MQHA 2X5ZA 3V0MA 4KQLA 3ZGFA 1SSQA 2ZU9A 2QKXA 3POLA 4Y6NA 3I0IX 3SXEA 2PA4A 4D11A 4HZDA 1YP2A 5AFUU 4R36A 3KIAA 1OQMB 1QRLA 1HJJA 3CKVA 1QRMA 3O3PA 3SXDA 2AE7A 4M4KA 3K8EA 3OH1A 3I3XA 5DDVA 1KGTA 4G3PA 5C8RA 1ZCYA 1O0RA 1VZUA 1WT2A 1VGTA 4KC2A 4FRBA 4HO8A 5FTSA 4EEOA 1QGSA 4HO4A 4ARWA 2ZU8A 2C0NA 4HURA 3V0QA 1FO9A 2Y4KA 4Y7GA 1O7QA 4Y64A 3GUEA 1OCXA 1FXOA 5FTVA 5JQQA 1OMXA 2XWLA 5FU0A 1XHBA 1H7LA 1VH1A 2JCLA 2ICYA 2V0LA 3T7NA 4IRQA 1G23A 2PGYA 4MNDA 1XZ6A 1QRFA 3PKQA 4B42A 5IDSA 3FOQA 3EE5A 3I0LA 2APCA 4FCUA 4MYOA 3FSXA 3FSYA 1HV9A 4EEGA 2AGDA 1KHRA 1XATA 4B2WA 1H7QA 5CQNX 3Q4SA 4IHGA 3C8VA 2X5SA 2VS3A 3EG4A 3SX8A 1SS9A 3RMWA 4J18A 4M28A 3I0GA 5DG3A 2A8UA 2WAWA 1O23B 3IOIA 3BFPA 2I7BA 5L6VA 1V67A 1VM8A 2P2OA 2BO6A 2Y6PA 3JQYA 2AM3A 1VZXA 1ZJOA 3CU0A 2JF3A 4B3UA 5J49A 1HM8A 1MR7A 3FSCA 2AM4A 3GOSA 4B4MA 4G87A 4AA7A 3TIOA 3OH0A 3CGXA 4KNRA 4NAKA 4MYBA 1T3DA 3V8ZA 2P72A 1SSTA 3VBKA 4Y63A 1H5RA 3V8YA 1O7OA 5C4DA 4HZCA 3QVBA 2NPOA 5C4CA 4Y7VA 1I52A 3FS8A 2NXVA 2OI5A 4JISA 1OMZA 2QH5A 3USRA 1ZJ0A 5C3AA 2I5KA 1ZJPA 3R3RA 2RIYA 4E6TA 2ICXA 1GQCA 5CQMX 1H4EA 5IFYA 3GVDA 2J0AA 1WSZA 4P00A 1YROB 2QGIA 1PZYB 1QWJA 2RJ5A 2D0JA 2VSHA 1MR9A 2RIXA 5AFUV 2V0KA 3BRKX 2WVMA 4LW6A 2BO4A 4FQWA 1MRLA 4CJ8A 1GWVA 2D7RA 4J09A 1IINA 2OI6A 2FYDB 3FWWA 1HJLA 3Q7UA 3I0KA 5HS2A 5FV9A 4DCLA 3ZLKA 3TWDA 4EE3A 1W77A 4D11C 1LZ0A 2AESA 4E1KA 3JUKA 2XWNA 2CU2A 4ECMA 2AH9A 3TK8A 4JD0A 4K6RA 1H5TB 2FYBA 3FTTA 4HO0A 1H7TA 1MP4A 2WLFA 5F42A 2FKOA 4KRVA 4FRHA 1KGQA 2VK9A 1XHDA 4HOCA 3N9WA 3RMVA 1W57A 3DK5A 3V4EA 4L41C 1KK5A 1H7HA 4EA7A 1NHEB 5C48A 4MZUA 1GA8A 3PKPA 4G3QA 1ZI3A 1S80A 3R3IA 3OH3A 5CMHA 4EEAA 1FOAA 1R7XA 1HM9A 2O1HA 4AC3A 4LW3A 1FWYA 2XMHA 1QRGA 2YC5A 3ECTA 2GGOA 3HL3A 4EABA 1G93A 1FXJA 1ZIZA 5C4BA 1YP4A 1NMMB 1V82A 3V0PA 2Y4JA 2WGZA 3CKOA 2XATA 2Z87A 4AYJA 2Y4MA 4BMAA 3T7MA 1Z90A 3Q1XA 2MZBA 3KWCA 5E3PA 5C3DA 1H4CA 2RJ7A 1V84A 2WLEA 3KWDA 3T57A 4E79A 4ASYA 4EQYA 3OH2A 1G9RA 4Y6UA 1S4PA 4FREA 5C4EA 5CMFX 1EZIA 1GX0A 4ASJA 3SX7A 4NALA 1H5SB 2WVLA 1VGUA 4B2XA 1VICA 1LZJA 1WT1A 4N6AA 2FYAA 2XMEA 5CQPA 4YS8A 2P6WA 1LL3A 5C3BA 1PZTA 4IHHA 3TV0A 1ZCUA 2YC3A 4GBPA 2VS4A 5EIYA 3U2WA 4HUSA 1R80A 1VPAA 3DHOA 4NANA 1KWSA 3R1WA 2UX8A 3OC9A 2GGQA 3F1XA 4HG6A 1TW1A 1HM0A 4ISXA 1LL0A 1H7GA 3D5NA 3CJ8A 3SXAA 4D48A 2V0JA 1KQAA 5C38A 1K4VA 1MP5A 1FRWA 4FIXA 3EH0A 1S4OA 5CQOA 1FO8A 4EE5A 4EA8A 1S4NA 1R7YA 2PX7A 3PNNA 1WT3A 2FY7A 2WLDA 4H7OA 2BO8A 5AJOA 3P1BA 1WVCA 3OKRA 2YESA 2A8WA 3I0DA 1KK6A 1ZJ1A 3BXYA 4M2AA 1VH3A 2V0HA 5C49A 2Y4LA 3ZF8A 5DEMA 3BCVA 3USQA 4HO3A 3TQDA 4AAWA 5ADXU 4Y62A 4M9CA 2JCKA 1INIA 2RJ0A 5CQLX 5C1LA 2I5EA 4HCQA 3VBJA 3ZGGA 4M98A 2Z86A 3VBLA 3D98A 1ZJ3A 4MFGA 2RJ6A 4E75A 4FRMA 3R5BA 1ZHJA 3BSWA 3DJ4A 1KRUA 1THJA 2YQSA 1R82A 3OTMA 1ZI1A 1ZI5A 3V91A 3CKQA 3OUPA 2JCJA 2JF2A 3R5DA 1IIMA 1E5KA 1JV3A 2VS5A 3I0EA 2RJ9A 4EAAA 3E26A 3R8YA 2FYCB 3E25A 3NGWA 3SX3A 3I0JA 5C4FA 3F1YA 4N27A 3RSBA 3T7OA 3MQGA 5DDTA 3TISA 3I0FA 2Y7AA 3SX5A 2XWMA 1ZDFA 3HSQA 2BO7A 3I0CA 4XWIA 1QGQA 2WEEA 4M2BA 2OEFA 4KNXA 4P02A 2X65A 1TVYA 3VBMA 2DPWA 3TDTA 3SRTA 1NKHB 1VGZA 1JV1A 5L6SA 4CJBA 4N6BA 4FRQA 4FROA 2WE9A 2FFUA 1EYRA 2WLCA 4EA9A 3BSYA 2RJ8A 1G97A 2IU9A 4E6UA 3U2UA 3IGJA 1LXAA 2YCMA 4KC1A 5BXCA 3KWEA 2JCOA 2IU8A 3R0SA 2VXMA 4HO9A 4KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEC A;  2E3D A;  1H3M A;  5FUH A;  3OTZ A;  3VBI A;  5AJP A;  3ZLL A;  1KRV A;  3VBP A;  2OEG A;  1KK4 A;  3Q80 A;  4HO2 A;  4D0Z A;  2YQC A;  3V90 A;  4Y7U A;  2QIV X;  1H5T A;  2VFZ A;  2QIA A;  3MC4 A;  3JUJ A;  4KXO A;  4NAI A;  1G8O A;  5AJN A;  3P47 A;  5EJZ A;  2X60 A;  4AYL A;  2TDT A;  4IRP A;  1QQ0 A;  3U2X A;  5ADX V;  4M99 A;  4B4G A;  2AQ9 A;  1ZI4 A;  1NWG B;  1FR8 A;  2WVK A;  2Q4J A;  1GX4 A;  4EE4 A;  4HO5 A;  2VHE A;  2ZU7 A;  2WLG A;  1G0R A;  1H4D A;  3EEV A;  1H5S D;  4C2S A;  1H5R B;  1VZT A;  1ZJ2 A;  4CVH A;  4KC4 A;  5IDT A;  1SSM A;  4ZDQ A;  5CMI A;  3D8V A;  1R7V A;  1LZI A;  3CKJ A;  1QG8 A;  2VXL A;  1MP3 A;  3U2T A;  1H5S C;  3U2V A;  1ON6 A;  1GQ9 A;  3K8D A;  1ZDG A;  4CJC A;  2OI7 A;  1FGG A;  4Y7T A;  1R81 A;  3SXC A;  3I0H A;  2RJ1 A;  4IHF A;  2E8B A;  2RJ4 A;  1R7T A;  4DDZ A;  3V0N A;  2RIT A;  1R7U A;  3LW6 A;  3VNP A;  2AM5 A;  1ZCV A;  5E3R A;  1ZCT A;  1JYK A;  3F1C A;  1H5S A;  3V0L A;  3R2W A;  4FRL A;  4HO6 A;  1H7F A;  1G2V A;  2P73 A;  3IOH A;  4EVW A;  3OU9 A;  1FZW A;  3R5C A;  1FG5 N;  2O1G A;  3FSB A;  3IOJ A;  4R7P A;  2V0I A;  4DEC A;  3TZT A;  4UEG A;  1G95 A;  3R5A A;  4G3S A;  1G1L A;  2VD4 A;  1NQI B;  1TDT A;  3SPT A;  2YQH A;  1H7E A;  4KPZ A;  1INJ A;  1ON8 A;  1WT0 A;  4B4B A;  4B5B A;  2RIZ A;  5C1G A;  3V0O A;  4BQH A;  2PGV A;  1FGX A;  5C36 A;  1LZ7 A;  4Y7F A;  2O1F A;  1TW5 A;  4FRA A;  3HJJ A;  1FR9 A;  2W0V A;  3NZ2 A;  1YP3 A;  1JYL A;  1LL2 A;  5CMG X;  2VSI A;  5E3Q A;  2W0W A;  3U0X A;  3SXG A;  4DE7 A;  5U2K A;  1J2Z A;  4Y9X A;  5DEP A;  3BSS A;  4R37 A;  1KRR A;  5I1F A;  3I3A A;  1TZF A;  5FYE A;  5FU8 A;  3DUV A;  3CKN A;  4D0T A;  4FRP A;  5CMJ A;  3OH4 A;  5C1H A;  3JTJ A;  3OAM A;  3SXB A;  5EJ1 A;  2IC7 A;  3IXC A;  1NF5 B;  2RIJ A;  4EGG A;  5C47 A;  3U0Y A;  1JVD A;  1JVG A;  3ST8 A;  1G3L A;  1V83 A;  1GWW A;  4FRD A;  1QRE A;  2D7I A;  1W55 A;  4EEM A;  1V3W A;  3VBN A;  3PMO A;  4N69 A;  2IUA A;  4KPX A;  3OGZ A;  4FCE A;  1LVW A;  1VGW A;  2YQJ A;  3OW5 A;  1MC3 A;  2FFV A;  3MQH A;  2X5Z A;  3V0M A;  4KQL A;  3ZGF A;  1SSQ A;  2ZU9 A;  2QKX A;  3POL A;  4Y6N A;  3I0I X;  3SXE A;  2PA4 A;  4D11 A;  4HZD A;  1YP2 A;  5AFU U;  4R36 A;  3KIA A;  1OQM B;  1QRL A;  1HJJ A;  3CKV A;  1QRM A;  3O3P A;  3SXD A;  2AE7 A;  4M4K A;  3K8E A;  3OH1 A;  3I3X A;  5DDV A;  1KGT A;  4G3P A;  5C8R A;  1ZCY A;  1O0R A;  1VZU A;  1WT2 A;  1VGT A;  4KC2 A;  4FRB A;  4HO8 A;  5FTS A;  4EEO A;  1QGS A;  4HO4 A;  4ARW A;  2ZU8 A;  4HUR A;  3V0Q A;  1FO9 A;  2Y4K A;  4Y7G A;  1O7Q A;  4Y64 A;  3GUE A;  1OCX A;  1FXO A;  5FTV A;  5JQQ A;  1OMX A;  2XWL A;  5FU0 A;  1XHB A;  1H7L A;  1VH1 A;  2JCL A;  2ICY A;  2V0L A;  3T7N A;  4IRQ A;  1G23 A;  2PGY A;  4MND A;  1XZ6 A;  1QRF A;  3PKQ A;  4B42 A;  5IDS A;  3FOQ A;  3EE5 A;  3I0L A;  2APC A;  4FCU A;  4MYO A;  3FSX A;  3FSY A;  1HV9 A;  4EEG A;  2AGD A;  1KHR A;  1XAT A;  4B2W A;  1H7Q A;  5CQN X;  3Q4S A;  4IHG A;  3C8V A;  2X5S A;  2VS3 A;  3EG4 A;  3SX8 A;  1SS9 A;  3RMW A;  4J18 A;  4M28 A;  3I0G A;  5DG3 A;  2A8U A;  2WAW A;  1O23 B;  3IOI A;  3BFP A;  2I7B A;  5L6V A;  1V67 A;  1VM8 A;  2P2O A;  2BO6 A;  2Y6P A;  3JQY A;  2AM3 A;  1VZX A;  1ZJO A;  3CU0 A;  2JF3 A;  4B3U A;  5J49 A;  1HM8 A;  1MR7 A;  3FSC A;  2AM4 A;  3GOS A;  4B4M A;  4G87 A;  4AA7 A;  3TIO A;  3OH0 A;  3CGX A;  4KNR A;  4NAK A;  4MYB A;  1T3D A;  3V8Z A;  2P72 A;  1SST A;  3VBK A;  4Y63 A;  1H5R A;  3V8Y A;  1O7O A;  5C4D A;  4HZC A;  3QVB A;  2NPO A;  5C4C A;  4Y7V A;  1I52 A;  3FS8 A;  2NXV A;  2OI5 A;  4JIS A;  1OMZ A;  2QH5 A;  3USR A;  1ZJ0 A;  5C3A A;  2I5K A;  1ZJP A;  3R3R A;  2RIY A;  4E6T A;  2ICX A;  1GQC A;  5CQM X;  1H4E A;  5IFY A;  3GVD A;  1WSZ A;  4P00 A;  1YRO B;  2QGI A;  1PZY B;  1QWJ A;  2RJ5 A;  2D0J A;  2VSH A;  1MR9 A;  2RIX A;  5AFU V;  2V0K A;  3BRK X;  2WVM A;  4LW6 A;  2BO4 A;  4FQW A;  1MRL A;  4CJ8 A;  1GWV A;  2D7R A;  4J09 A;  1IIN A;  2OI6 A;  2FYD B;  3FWW A;  1HJL A;  3Q7U A;  3I0K A;  5HS2 A;  5FV9 A;  4DCL A;  3ZLK A;  3TWD A;  4EE3 A;  1W77 A;  4D11 C;  1LZ0 A;  2AES A;  4E1K A;  3JUK A;  2XWN A;  2CU2 A;  4ECM A;  2AH9 A;  3TK8 A;  4JD0 A;  4K6R A;  1H5T B;  2FYB A;  3FTT A;  4HO0 A;  1H7T A;  1MP4 A;  2WLF A;  5F42 A;  2FKO A;  4KRV A;  4FRH A;  1KGQ A;  1XHD A;  4HOC A;  3N9W A;  3RMV A;  1W57 A;  3DK5 A;  3V4E A;  4L41 C;  1KK5 A;  1H7H A;  4EA7 A;  1NHE B;  5C48 A;  4MZU A;  1GA8 A;  3PKP A;  4G3Q A;  1ZI3 A;  1S80 A;  3R3I A;  3OH3 A;  5CMH A;  4EEA A;  1FOA A;  1R7X A;  1HM9 A;  2O1H A;  4AC3 A;  4LW3 A;  1FWY A;  2XMH A;  1QRG A;  2YC5 A;  3ECT A;  2GGO A;  3HL3 A;  4EAB A;  1G93 A;  1FXJ A;  1ZIZ A;  5C4B A;  1YP4 A;  1NMM B;  1V82 A;  3V0P A;  2Y4J A;  2WGZ A;  3CKO A;  2XAT A;  2Z87 A;  4AYJ A;  2Y4M A;  4BMA A;  3T7M A;  1Z90 A;  3Q1X A;  2MZB A;  3KWC A;  5E3P A;  5C3D A;  1H4C A;  2RJ7 A;  1V84 A;  2WLE A;  3KWD A;  3T57 A;  4E79 A;  4ASY A;  4EQY A;  3OH2 A;  1G9R A;  4Y6U A;  1S4P A;  4FRE A;  5C4E A;  5CMF X;  1EZI A;  1GX0 A;  4ASJ A;  3SX7 A;  4NAL A;  1H5S B;  2WVL A;  1VGU A;  4B2X A;  1VIC A;  1LZJ A;  1WT1 A;  4N6A A;  2FYA A;  2XME A;  5CQP A;  4YS8 A;  2P6W A;  1LL3 A;  5C3B A;  1PZT A;  4IHH A;  3TV0 A;  1ZCU A;  2YC3 A;  4GBP A;  2VS4 A;  5EIY A;  3U2W A;  4HUS A;  1R80 A;  1VPA A;  3DHO A;  4NAN A;  1KWS A;  3R1W A;  2UX8 A;  3OC9 A;  2GGQ A;  3F1X A;  4HG6 A;  1TW1 A;  1HM0 A;  4ISX A;  1LL0 A;  1H7G A;  3D5N A;  3CJ8 A;  3SXA A;  4D48 A;  2V0J A;  1KQA A;  5C38 A;  1K4V A;  1MP5 A;  1FRW A;  3EH0 A;  1S4O A;  5CQO A;  1FO8 A;  4EE5 A;  4EA8 A;  1S4N A;  1R7Y A;  2PX7 A;  3PNN A;  1WT3 A;  2FY7 A;  2WLD A;  4H7O A;  2BO8 A;  5AJO A;  3P1B A;  1WVC A;  3OKR A;  2YES A;  2A8W A;  3I0D A;  1KK6 A;  1ZJ1 A;  3BXY A;  4M2A A;  1VH3 A;  2V0H A;  5C49 A;  2Y4L A;  3ZF8 A;  5DEM A;  3BCV A;  3USQ A;  4HO3 A;  3TQD A;  4AAW A;  5ADX U;  4Y62 A;  4M9C A;  2JCK A;  1INI A;  2RJ0 A;  5CQL X;  5C1L A;  2I5E A;  4HCQ A;  3VBJ A;  3ZGG A;  4M98 A;  2Z86 A;  3VBL A;  3D98 A;  1ZJ3 A;  4MFG A;  2RJ6 A;  4E75 A;  4FRM A;  3R5B A;  1ZHJ A;  3BSW A;  3DJ4 A;  1KRU A;  1THJ A;  2YQS A;  1R82 A;  3OTM A;  1ZI1 A;  1ZI5 A;  3V91 A;  3CKQ A;  3OUP A;  2JCJ A;  2JF2 A;  3R5D A;  1IIM A;  1E5K A;  1JV3 A;  2VS5 A;  3I0E A;  2RJ9 A;  4EAA A;  3E26 A;  3R8Y A;  2FYC B;  3E25 A;  3NGW A;  3SX3 A;  3I0J A;  5C4F A;  3F1Y A;  4N27 A;  3RSB A;  3T7O A;  3MQG A;  5DDT A;  3TIS A;  3I0F A;  2Y7A A;  3SX5 A;  2XWM A;  1ZDF A;  3HSQ A;  2BO7 A;  3I0C A;  4XWI A;  1QGQ A;  2WEE A;  4M2B A;  2OEF A;  4KNX A;  4P02 A;  2X65 A;  1TVY A;  3VBM A;  2DPW A;  3TDT A;  3SRT A;  1NKH B;  1VGZ A;  1JV1 A;  5L6S A;  4CJB A;  4N6B A;  4FRQ A;  4FRO A;  2WE9 A;  2FFU A;  1EYR A;  2WLC A;  4EA9 A;  3BSY A;  2RJ8 A;  1G97 A;  2IU9 A;  4E6U A;  3U2U A;  3IGJ A;  1LXA A;  2YCM A;  4KC1 A;  5BXC A;  3KWE A;  2JCO A;  2IU8 A;  3R0S A;  2VXM A;  4HO9 A;  4KT7 A; 
#chains in the Genus database with same CATH topology
 2AEC A;  2E3D A;  5D92 A;  1H3M A;  5FUH A;  3OTZ A;  3VBI A;  5AJP A;  3ZLL A;  1KRV A;  3VBP A;  2OEG A;  1KK4 A;  3Q80 A;  4HO2 A;  4D0Z A;  2YQC A;  3V90 A;  4Y7U A;  2QIV X;  1H5T A;  2VFZ A;  2QIA A;  3MC4 A;  3JUJ A;  4KXO A;  4NAI A;  1G8O A;  5AJN A;  3P47 A;  5EJZ A;  2X60 A;  4AYL A;  2TDT A;  4IRP A;  1QQ0 A;  3U2X A;  5ADX V;  4M99 A;  4B4G A;  2AQ9 A;  1ZI4 A;  1NWG B;  1FR8 A;  2WVK A;  2Q4J A;  1GX4 A;  4EE4 A;  4HO5 A;  2VHE A;  2ZU7 A;  2WLG A;  1G0R A;  1H4D A;  3EEV A;  1H5S D;  4C2S A;  1H5R B;  1VZT A;  1ZJ2 A;  4CVH A;  4KC4 A;  5IDT A;  1SSM A;  4ZDQ A;  5CMI A;  5D91 A;  4O6M A;  3D8V A;  1R7V A;  1LZI A;  3CKJ A;  1QG8 A;  2VXL A;  1MP3 A;  3U2T A;  1H5S C;  3U2V A;  1ON6 A;  1GQ9 A;  3K8D A;  1ZDG A;  4CJC A;  2J0B A;  2OI7 A;  1FGG A;  4Y7T A;  1R81 A;  3SXC A;  3I0H A;  2RJ1 A;  4IHF A;  2E8B A;  2RJ4 A;  1R7T A;  4DDZ A;  3V0N A;  2RIT A;  1R7U A;  3LW6 A;  1N4I A;  3VNP A;  2AM5 A;  1ZCV A;  4MIX A;  5E3R A;  1ZCT A;  1JYK A;  3F1C A;  1H5S A;  3V0L A;  3R2W A;  4FRL A;  4HO6 A;  1H7F A;  1G2V A;  4O6N A;  2P73 A;  3IOH A;  4EVW A;  3OU9 A;  1L0S A;  1FZW A;  3R5C A;  1FG5 N;  2O1G A;  3FSB A;  4FIY A;  3IOJ A;  4R7P A;  2V0I A;  4DEC A;  3TZT A;  4UEG A;  1G95 A;  3R5A A;  4G3S A;  1G1L A;  2VD4 A;  1NQI B;  1TDT A;  3SPT A;  2YQH A;  1H7E A;  4KPZ A;  1INJ A;  1ON8 A;  1WT0 A;  4B4B A;  4B5B A;  2RIZ A;  5C1G A;  3V0O A;  4BQH A;  2PGV A;  1FGX A;  5C36 A;  1LZ7 A;  4Y7F A;  2O1F A;  1TW5 A;  4FRA A;  3HJJ A;  1FR9 A;  2W0V A;  3NZ2 A;  1YP3 A;  1JYL A;  1LL2 A;  4Q7C A;  5CMG X;  2VSI A;  5E3Q A;  3GQ8 A;  2W0W A;  3U0X A;  3SXG A;  4DE7 A;  5U2K A;  1J2Z A;  4Y9X A;  5DEP A;  3BSS A;  4R37 A;  1KRR A;  5I1F A;  3I3A A;  1TZF A;  5FYE A;  5FU8 A;  3DUV A;  3CKN A;  4D0T A;  4FRP A;  5CMJ A;  3OH4 A;  5C1H A;  3JTJ A;  3OAM A;  3SXB A;  5EJ1 A;  2IC7 A;  3IXC A;  1NF5 B;  2RIJ A;  4EGG A;  5C47 A;  3U0Y A;  1JVD A;  1JVG A;  3ST8 A;  1G3L A;  1V83 A;  1GWW A;  4FRD A;  1QRE A;  2D7I A;  1W55 A;  4EEM A;  1V3W A;  3VBN A;  3PMO A;  4N69 A;  2IUA A;  4KPX A;  3OGZ A;  4FCE A;  1LVW A;  1VGW A;  2YQJ A;  3OW5 A;  1MC3 A;  2FFV A;  3MQH A;  2X5Z A;  3V0M A;  4KQL A;  3ZGF A;  1SSQ A;  2ZU9 A;  2QKX A;  3POL A;  4Y6N A;  3I0I X;  3SXE A;  2PA4 A;  4D11 A;  4HZD A;  1YP2 A;  5AFU U;  4R36 A;  3KIA A;  1OQM B;  1QRL A;  1HJJ A;  3CKV A;  1QRM A;  3O3P A;  3SXD A;  2AE7 A;  4M4K A;  3K8E A;  3OH1 A;  3I3X A;  5DDV A;  1KGT A;  4G3P A;  5C8R A;  1ZCY A;  1O0R A;  1VZU A;  1WT2 A;  1VGT A;  4KC2 A;  4FRB A;  4HO8 A;  5FTS A;  4EEO A;  1QGS A;  4HO4 A;  4ARW A;  2ZU8 A;  2C0N A;  4HUR A;  3V0Q A;  1FO9 A;  2Y4K A;  4Y7G A;  1O7Q A;  4Y64 A;  3GUE A;  1OCX A;  1FXO A;  5FTV A;  5JQQ A;  1OMX A;  2XWL A;  5FU0 A;  1XHB A;  1H7L A;  1VH1 A;  2JCL A;  2ICY A;  2V0L A;  3T7N A;  4IRQ A;  1G23 A;  2PGY A;  4MND A;  1XZ6 A;  1QRF A;  3PKQ A;  4B42 A;  5IDS A;  3FOQ A;  3EE5 A;  3I0L A;  2APC A;  4FCU A;  4MYO A;  1Z2F A;  3FSX A;  1EWW A;  3FSY A;  1HV9 A;  4EEG A;  2AGD A;  1KHR A;  1XAT A;  4B2W A;  1H7Q A;  5CQN X;  3Q4S A;  4IHG A;  3C8V A;  2X5S A;  2VS3 A;  3EG4 A;  3SX8 A;  1SS9 A;  3RMW A;  4J18 A;  4M28 A;  3I0G A;  5DG3 A;  2A8U A;  2WAW A;  1O23 B;  3IOI A;  3BFP A;  2I7B A;  5L6V A;  1V67 A;  1VM8 A;  2P2O A;  2BO6 A;  2Y6P A;  3JQY A;  2AM3 A;  1VZX A;  1ZJO A;  3CU0 A;  2JF3 A;  4B3U A;  5J49 A;  1HM8 A;  1MR7 A;  3FSC A;  2AM4 A;  3GOS A;  4B4M A;  3OH0 A;  4G87 A;  3TIO A;  4AA7 A;  3CGX A;  4KNR A;  4NAK A;  4MYB A;  1T3D A;  3V8Z A;  2P72 A;  1SST A;  3VBK A;  4Y63 A;  1H5R A;  3V8Y A;  1O7O A;  5C4D A;  4HZC A;  3QVB A;  2NPO A;  5C4C A;  4Y7V A;  1I52 A;  3FS8 A;  2NXV A;  2OI5 A;  4JIS A;  1OMZ A;  2QH5 A;  3USR A;  1M8N A;  1ZJ0 A;  2I5K A;  1ZJP A;  5C3A A;  3R3R A;  2RIY A;  4E6T A;  2ICX A;  1GQC A;  5CQM X;  1H4E A;  5IFY A;  3GVD A;  2J0A A;  1WSZ A;  4P00 A;  1YRO B;  2QGI A;  1PZY B;  1QWJ A;  2RJ5 A;  2D0J A;  2VSH A;  1MR9 A;  2RIX A;  5AFU V;  2V0K A;  3BRK X;  2WVM A;  4LW6 A;  2BO4 A;  4FQW A;  1MRL A;  4CJ8 A;  1GWV A;  2D7R A;  4J09 A;  1IIN A;  2OI6 A;  2FYD B;  3FWW A;  1HJL A;  3Q7U A;  3I0K A;  5HS2 A;  5FV9 A;  4DCL A;  3ZLK A;  3TWD A;  4EE3 A;  1W77 A;  4D11 C;  1LZ0 A;  2AES A;  4E1K A;  3JUK A;  2XWN A;  2CU2 A;  4ECM A;  2AH9 A;  3TK8 A;  4JD0 A;  4K6R A;  1H5T B;  2FYB A;  3FTT A;  4HO0 A;  1H7T A;  1MP4 A;  2WLF A;  5F42 A;  2FKO A;  4KRV A;  4FRH A;  1KGQ A;  2VK9 A;  1XHD A;  4HOC A;  3N9W A;  3RMV A;  1W57 A;  3DK5 A;  3V4E A;  4L41 C;  1KK5 A;  1H7H A;  4EA7 A;  1NHE B;  5C48 A;  4MZU A;  1GA8 A;  3PKP A;  4G3Q A;  1ZI3 A;  1S80 A;  3R3I A;  3OH3 A;  5CMH A;  4EEA A;  1FOA A;  1R7X A;  1HM9 A;  2O1H A;  4AC3 A;  4LW3 A;  1FWY A;  2XMH A;  1QRG A;  2YC5 A;  3ECT A;  2GGO A;  3HL3 A;  4EAB A;  1G93 A;  1FXJ A;  1ZIZ A;  5C4B A;  1YP4 A;  1NMM B;  1V82 A;  3V0P A;  2Y4J A;  2WGZ A;  3CKO A;  2XAT A;  2Z87 A;  4AYJ A;  2Y4M A;  4BMA A;  3T7M A;  1Z90 A;  3Q1X A;  2MZB A;  3KWC A;  5E3P A;  5C3D A;  1H4C A;  2RJ7 A;  1V84 A;  2WLE A;  3GQA A;  3KWD A;  3T57 A;  4E79 A;  4ASY A;  3OH2 A;  4EQY A;  1G9R A;  4Y6U A;  1S4P A;  4FRE A;  5C4E A;  5CMF X;  1EZI A;  1GX0 A;  4ASJ A;  3SX7 A;  4NAL A;  1H5S B;  2WVL A;  1VGU A;  4B2X A;  1VIC A;  1LZJ A;  1WT1 A;  4N6A A;  2FYA A;  2XME A;  5CQP A;  4YS8 A;  2P6W A;  1LL3 A;  5C3B A;  1PZT A;  4IHH A;  3TV0 A;  1ZCU A;  2YC3 A;  4GBP A;  2VS4 A;  5EIY A;  3U2W A;  4HUS A;  1R80 A;  1VPA A;  3DHO A;  4NAN A;  1KWS A;  3R1W A;  2UX8 A;  3OC9 A;  2GGQ A;  3F1X A;  4HG6 A;  1TW1 A;  1HM0 A;  4ISX A;  1LL0 A;  1H7G A;  3D5N A;  3CJ8 A;  3SXA A;  4D48 A;  2V0J A;  1KQA A;  5C38 A;  1K4V A;  1MP5 A;  1FRW A;  4FIX A;  3EH0 A;  1S4O A;  5CQO A;  1FO8 A;  4EE5 A;  4EA8 A;  1S4N A;  1R7Y A;  2PX7 A;  3PNN A;  1WT3 A;  2FY7 A;  2WLD A;  4H7O A;  2BO8 A;  5AJO A;  3P1B A;  1WVC A;  3OKR A;  2YES A;  2A8W A;  3I0D A;  1KK6 A;  1ZJ1 A;  3BXY A;  4M2A A;  1VH3 A;  2V0H A;  5C49 A;  2Y4L A;  3ZF8 A;  5DEM A;  3BCV A;  3USQ A;  4HO3 A;  3TQD A;  4AAW A;  5ADX U;  4Y62 A;  4M9C A;  3GQ9 A;  2JCK A;  1INI A;  2RJ0 A;  5CQL X;  5C1L A;  2I5E A;  4HCQ A;  3VBJ A;  3ZGG A;  4M98 A;  2Z86 A;  3VBL A;  3D98 A;  1ZJ3 A;  4MFG A;  2RJ6 A;  4E75 A;  4FRM A;  3R5B A;  1ZHJ A;  3BSW A;  3DJ4 A;  1KRU A;  1THJ A;  2YQS A;  1R82 A;  3OTM A;  1ZI1 A;  1ZI5 A;  3V91 A;  3CKQ A;  3OUP A;  3GQ7 A;  2JCJ A;  2JF2 A;  3R5D A;  1IIM A;  1E5K A;  1JV3 A;  2VS5 A;  3I0E A;  2RJ9 A;  4EAA A;  3E26 A;  3R8Y A;  2FYC B;  3E25 A;  3NGW A;  3SX3 A;  3I0J A;  5C4F A;  3F1Y A;  4N27 A;  3RSB A;  3T7O A;  3MQG A;  5DDT A;  3TIS A;  3I0F A;  2Y7A A;  3SX5 A;  2XWM A;  1ZDF A;  3HSQ A;  2BO7 A;  3I0C A;  4XWI A;  3SUC A;  1QGQ A;  2WEE A;  4M2B A;  2OEF A;  4KNX A;  4P02 A;  2X65 A;  1TVY A;  3VBM A;  2DPW A;  3TDT A;  3SRT A;  1NKH B;  1VGZ A;  1JV1 A;  5L6S A;  4CJB A;  4N6B A;  4FRQ A;  4FRO A;  2WE9 A;  2FFU A;  1EYR A;  2WLC A;  4EA9 A;  3BSY A;  2RJ8 A;  1G97 A;  2IU9 A;  4E6U A;  3U2U A;  3IGJ A;  1LXA A;  2YCM A;  4KC1 A;  5BXC A;  3KWE A;  2JCO A;  2IU8 A;  3R0S A;  2VXM A;  4HO9 A;  4KT7 A; 
#chains in the Genus database with same CATH homology
 2AEC A;  2E3D A;  5D92 A;  1H3M A;  5FUH A;  3OTZ A;  3VBI A;  5AJP A;  3ZLL A;  1KRV A;  3VBP A;  2OEG A;  1KK4 A;  3Q80 A;  4HO2 A;  4D0Z A;  2YQC A;  3V90 A;  4Y7U A;  2QIV X;  1H5T A;  2VFZ A;  2QIA A;  3MC4 A;  3JUJ A;  4KXO A;  4NAI A;  1G8O A;  5AJN A;  3P47 A;  5EJZ A;  2X60 A;  4AYL A;  2TDT A;  4IRP A;  1QQ0 A;  3U2X A;  5ADX V;  4M99 A;  4B4G A;  2AQ9 A;  1ZI4 A;  1NWG B;  1FR8 A;  2WVK A;  2Q4J A;  1GX4 A;  4EE4 A;  4HO5 A;  2VHE A;  2ZU7 A;  2WLG A;  1G0R A;  1H4D A;  3EEV A;  1H5S D;  4C2S A;  1H5R B;  1VZT A;  1ZJ2 A;  4CVH A;  4KC4 A;  5IDT A;  1SSM A;  4ZDQ A;  5CMI A;  5D91 A;  4O6M A;  3D8V A;  1R7V A;  1LZI A;  3CKJ A;  1QG8 A;  2VXL A;  1MP3 A;  3U2T A;  1H5S C;  3U2V A;  1ON6 A;  1GQ9 A;  3K8D A;  1ZDG A;  4CJC A;  2J0B A;  2OI7 A;  1FGG A;  4Y7T A;  1R81 A;  3SXC A;  3I0H A;  2RJ1 A;  4IHF A;  2E8B A;  2RJ4 A;  1R7T A;  4DDZ A;  3V0N A;  2RIT A;  1R7U A;  3LW6 A;  3VNP A;  2AM5 A;  1ZCV A;  4MIX A;  5E3R A;  1ZCT A;  1JYK A;  3F1C A;  1H5S A;  3V0L A;  3R2W A;  4FRL A;  4HO6 A;  1H7F A;  1G2V A;  4O6N A;  2P73 A;  3IOH A;  4EVW A;  3OU9 A;  1FZW A;  3R5C A;  1FG5 N;  2O1G A;  3FSB A;  4FIY A;  3IOJ A;  4R7P A;  2V0I A;  4DEC A;  3TZT A;  4UEG A;  1G95 A;  3R5A A;  4G3S A;  1G1L A;  2VD4 A;  1NQI B;  1TDT A;  3SPT A;  2YQH A;  1H7E A;  4KPZ A;  1INJ A;  1ON8 A;  1WT0 A;  4B4B A;  4B5B A;  2RIZ A;  5C1G A;  3V0O A;  4BQH A;  2PGV A;  1FGX A;  5C36 A;  1LZ7 A;  4Y7F A;  2O1F A;  1TW5 A;  4FRA A;  3HJJ A;  1FR9 A;  2W0V A;  3NZ2 A;  1YP3 A;  1JYL A;  1LL2 A;  4Q7C A;  5CMG X;  2VSI A;  5E3Q A;  2W0W A;  3U0X A;  3SXG A;  4DE7 A;  5U2K A;  1J2Z A;  4Y9X A;  5DEP A;  3BSS A;  4R37 A;  1KRR A;  5I1F A;  3I3A A;  1TZF A;  5FYE A;  5FU8 A;  3DUV A;  3CKN A;  4D0T A;  4FRP A;  5CMJ A;  3OH4 A;  5C1H A;  3JTJ A;  3OAM A;  3SXB A;  5EJ1 A;  2IC7 A;  3IXC A;  1NF5 B;  2RIJ A;  4EGG A;  5C47 A;  3U0Y A;  1JVD A;  1JVG A;  3ST8 A;  1G3L A;  1V83 A;  1GWW A;  4FRD A;  1QRE A;  2D7I A;  1W55 A;  4EEM A;  1V3W A;  3VBN A;  3PMO A;  4N69 A;  2IUA A;  4KPX A;  3OGZ A;  4FCE A;  1LVW A;  1VGW A;  2YQJ A;  3OW5 A;  1MC3 A;  2FFV A;  3MQH A;  2X5Z A;  3V0M A;  4KQL A;  3ZGF A;  1SSQ A;  2ZU9 A;  2QKX A;  3POL A;  4Y6N A;  3I0I X;  3SXE A;  2PA4 A;  4D11 A;  4HZD A;  1YP2 A;  5AFU U;  4R36 A;  3KIA A;  1OQM B;  1QRL A;  1HJJ A;  3CKV A;  1QRM A;  3O3P A;  3SXD A;  2AE7 A;  4M4K A;  3K8E A;  3OH1 A;  3I3X A;  5DDV A;  1KGT A;  4G3P A;  5C8R A;  1ZCY A;  1O0R A;  1VZU A;  1WT2 A;  1VGT A;  4KC2 A;  4FRB A;  4HO8 A;  5FTS A;  4EEO A;  1QGS A;  4HO4 A;  4ARW A;  2ZU8 A;  2C0N A;  4HUR A;  3V0Q A;  1FO9 A;  2Y4K A;  4Y7G A;  1O7Q A;  4Y64 A;  3GUE A;  1OCX A;  1FXO A;  5FTV A;  5JQQ A;  1OMX A;  2XWL A;  5FU0 A;  1XHB A;  1H7L A;  1VH1 A;  2JCL A;  2ICY A;  2V0L A;  3T7N A;  4IRQ A;  1G23 A;  2PGY A;  4MND A;  1XZ6 A;  1QRF A;  3PKQ A;  4B42 A;  5IDS A;  3FOQ A;  3EE5 A;  3I0L A;  2APC A;  4FCU A;  4MYO A;  3FSX A;  3FSY A;  1HV9 A;  4EEG A;  2AGD A;  1KHR A;  1XAT A;  4B2W A;  1H7Q A;  5CQN X;  3Q4S A;  4IHG A;  3C8V A;  2X5S A;  2VS3 A;  3EG4 A;  3SX8 A;  1SS9 A;  3RMW A;  4J18 A;  4M28 A;  3I0G A;  5DG3 A;  2A8U A;  2WAW A;  1O23 B;  3IOI A;  3BFP A;  2I7B A;  5L6V A;  1V67 A;  1VM8 A;  2P2O A;  2BO6 A;  2Y6P A;  3JQY A;  2AM3 A;  1VZX A;  1ZJO A;  3CU0 A;  2JF3 A;  4B3U A;  5J49 A;  1HM8 A;  1MR7 A;  3FSC A;  2AM4 A;  3GOS A;  4B4M A;  4G87 A;  4AA7 A;  3TIO A;  3OH0 A;  3CGX A;  4KNR A;  4NAK A;  4MYB A;  1T3D A;  3V8Z A;  2P72 A;  1SST A;  3VBK A;  4Y63 A;  1H5R A;  3V8Y A;  1O7O A;  5C4D A;  4HZC A;  3QVB A;  2NPO A;  5C4C A;  4Y7V A;  1I52 A;  3FS8 A;  2NXV A;  2OI5 A;  4JIS A;  1OMZ A;  2QH5 A;  3USR A;  1ZJ0 A;  5C3A A;  2I5K A;  1ZJP A;  3R3R A;  2RIY A;  4E6T A;  2ICX A;  1GQC A;  5CQM X;  1H4E A;  5IFY A;  3GVD A;  2J0A A;  1WSZ A;  4P00 A;  1YRO B;  2QGI A;  1PZY B;  1QWJ A;  2RJ5 A;  2D0J A;  2VSH A;  1MR9 A;  2RIX A;  5AFU V;  2V0K A;  3BRK X;  2WVM A;  4LW6 A;  2BO4 A;  4FQW A;  1MRL A;  4CJ8 A;  1GWV A;  2D7R A;  4J09 A;  1IIN A;  2OI6 A;  2FYD B;  3FWW A;  1HJL A;  3Q7U A;  3I0K A;  5HS2 A;  5FV9 A;  4DCL A;  3ZLK A;  3TWD A;  4EE3 A;  1W77 A;  4D11 C;  1LZ0 A;  2AES A;  4E1K A;  3JUK A;  2XWN A;  2CU2 A;  4ECM A;  2AH9 A;  3TK8 A;  4JD0 A;  4K6R A;  1H5T B;  2FYB A;  3FTT A;  4HO0 A;  1H7T A;  1MP4 A;  2WLF A;  5F42 A;  2FKO A;  4KRV A;  4FRH A;  1KGQ A;  2VK9 A;  1XHD A;  4HOC A;  3N9W A;  3RMV A;  1W57 A;  3DK5 A;  3V4E A;  4L41 C;  1KK5 A;  1H7H A;  4EA7 A;  1NHE B;  5C48 A;  4MZU A;  1GA8 A;  3PKP A;  4G3Q A;  1ZI3 A;  1S80 A;  3R3I A;  3OH3 A;  5CMH A;  4EEA A;  1FOA A;  1R7X A;  1HM9 A;  2O1H A;  4AC3 A;  4LW3 A;  1FWY A;  2XMH A;  1QRG A;  2YC5 A;  3ECT A;  2GGO A;  3HL3 A;  4EAB A;  1G93 A;  1FXJ A;  1ZIZ A;  5C4B A;  1YP4 A;  1NMM B;  1V82 A;  3V0P A;  2Y4J A;  2WGZ A;  3CKO A;  2XAT A;  2Z87 A;  4AYJ A;  2Y4M A;  4BMA A;  3T7M A;  1Z90 A;  3Q1X A;  2MZB A;  3KWC A;  5E3P A;  5C3D A;  1H4C A;  2RJ7 A;  1V84 A;  2WLE A;  3KWD A;  3T57 A;  4E79 A;  4ASY A;  4EQY A;  3OH2 A;  1G9R A;  4Y6U A;  1S4P A;  4FRE A;  5C4E A;  5CMF X;  1EZI A;  1GX0 A;  4ASJ A;  3SX7 A;  4NAL A;  1H5S B;  2WVL A;  1VGU A;  4B2X A;  1VIC A;  1LZJ A;  1WT1 A;  4N6A A;  2FYA A;  2XME A;  5CQP A;  4YS8 A;  2P6W A;  1LL3 A;  5C3B A;  1PZT A;  4IHH A;  3TV0 A;  1ZCU A;  2YC3 A;  4GBP A;  2VS4 A;  5EIY A;  3U2W A;  4HUS A;  1R80 A;  1VPA A;  3DHO A;  4NAN A;  1KWS A;  3R1W A;  2UX8 A;  3OC9 A;  2GGQ A;  3F1X A;  4HG6 A;  1TW1 A;  1HM0 A;  4ISX A;  1LL0 A;  1H7G A;  3D5N A;  3CJ8 A;  3SXA A;  4D48 A;  2V0J A;  1KQA A;  5C38 A;  1K4V A;  1MP5 A;  1FRW A;  4FIX A;  3EH0 A;  1S4O A;  5CQO A;  1FO8 A;  4EE5 A;  4EA8 A;  1S4N A;  1R7Y A;  2PX7 A;  3PNN A;  1WT3 A;  2FY7 A;  2WLD A;  4H7O A;  2BO8 A;  5AJO A;  3P1B A;  1WVC A;  3OKR A;  2YES A;  2A8W A;  3I0D A;  1KK6 A;  1ZJ1 A;  3BXY A;  4M2A A;  1VH3 A;  2V0H A;  5C49 A;  2Y4L A;  3ZF8 A;  5DEM A;  3BCV A;  3USQ A;  4HO3 A;  3TQD A;  4AAW A;  5ADX U;  4Y62 A;  4M9C A;  2JCK A;  1INI A;  2RJ0 A;  5CQL X;  5C1L A;  2I5E A;  4HCQ A;  3VBJ A;  3ZGG A;  4M98 A;  2Z86 A;  3VBL A;  3D98 A;  1ZJ3 A;  4MFG A;  2RJ6 A;  4E75 A;  4FRM A;  3R5B A;  1ZHJ A;  3BSW A;  3DJ4 A;  1KRU A;  1THJ A;  2YQS A;  1R82 A;  3OTM A;  1ZI1 A;  1ZI5 A;  3V91 A;  3CKQ A;  3OUP A;  2JCJ A;  2JF2 A;  3R5D A;  1IIM A;  1E5K A;  1JV3 A;  2VS5 A;  3I0E A;  2RJ9 A;  4EAA A;  3E26 A;  3R8Y A;  2FYC B;  3E25 A;  3NGW A;  3SX3 A;  3I0J A;  5C4F A;  3F1Y A;  4N27 A;  3RSB A;  3T7O A;  3MQG A;  5DDT A;  3TIS A;  3I0F A;  2Y7A A;  3SX5 A;  2XWM A;  1ZDF A;  3HSQ A;  2BO7 A;  3I0C A;  4XWI A;  1QGQ A;  2WEE A;  4M2B A;  2OEF A;  4KNX A;  4P02 A;  2X65 A;  1TVY A;  3VBM A;  2DPW A;  3TDT A;  3SRT A;  1NKH B;  1VGZ A;  1JV1 A;  5L6S A;  4CJB A;  4N6B A;  4FRQ A;  4FRO A;  2WE9 A;  2FFU A;  1EYR A;  2WLC A;  4EA9 A;  3BSY A;  2RJ8 A;  1G97 A;  2IU9 A;  4E6U A;  3U2U A;  3IGJ A;  1LXA A;  2YCM A;  4KC1 A;  5BXC A;  3KWE A;  2JCO A;  2IU8 A;  3R0S A;  2VXM A;  4HO9 A;  4KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...