4G3PA

Crystal structure of glmu from mycobacterium tuberculosis snapshot 3
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
469
structure length
462
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Bifunctional protein GlmU
publication title Structural Snapshots of Glmu from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 166
structure length 462
sequence length 469
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4g3pA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4g3pA01
3PKQA 1KWSA 1O7QA 2X60A 5C4CA 4B3UA 3USQA 1FXJA 4P02A 1LL3A 1LXAA 2YQHA 3V8YA 2IC7A 4EGGA 3V0OA 3EH0A 1FGGA 3T7OA 1R80A 4Y7TA 3OGZA 4Y9XA 4LW3A 3BSWA 3R5DA 4HG6A 3U2WA 1G0RA 3CU0A 5IDTA 1HM0A 3SX5A 1TW5A 2RIJA 3SX8A 1S4OA 1R7YA 3I0GA 1VM8A 2GGOA 3ZGGA 1W77A 2VSIA 3CJ8A 3Q1XA 2W0VA 2FKOA 1OCXA 4FRPA 4Y7UA 4FRQA 3HJJA 1VZUA 5EIYA 1TDTA 2P2OA 2V0HA 5BXCA 2Y6PA 5CMIA 1H4DA 2WVMA 4KC4A 3TV0A 2Z86A 4M9CA 4DE7A 3D98A 2WEEA 4LW6A 3VBPA 2AM4A 4M98A 4FRBA 3HSQA 1G95A 3DUVA 3ZGFA 3FWWA 1VICA 3F1YA 4AYLA 3JQYA 3P1BA 1FGXA 4AA7A 4HO2A 4J18A 1OMXA 2I7BA 3BXYA 1YP3A 1HV9A 1QG8A 1NMMB 4IRQA 1NQIB 1PZYB 1V84A 4ZDQA 4HO5A 4E6UA 1ZCYA 2JF3A 2NXVA 4G3QA 5AJPA 4CJ8A 2ZU9A 1HM9A 4FCEA 2WGZA 3RSBA 1TW1A 2VXMA 4KNRA 4EA7A 2PGYA 5DG3A 1VPAA 1WVCA 1IINA 1H5RB 4EE4A 3TZTA 3DJ4A 3Q4SA 2Y4KA 5CQLX 5C48A 2YESA 4DCLA 3I0LA 4Y7FA 5FTVA 4D11C 2XATA 3TK8A 1FR9A 1ZDGA 1R7XA 1ZI5A 2P6WA 4MYOA 1VGZA 4G3PA 4Y6UA 3VNPA 2IUAA 4HURA 4FRLA 4HOCA 2RITA 1JYKA 1YP2A 3NZ2A 1JV1A 2FYDB 2X5ZA 4HO6A 1H4CA 1TVYA 4HO0A 3D5NA 3KWCA 5E3RA 5E3QA 4ARWA 1GX4A 1SSMA 4N6BA 2FY7A 3Q7UA 4YS8A 1H7QA 4B2XA 2TDTA 4E79A 1WSZA 1W55A 1VGWA 1G2VA 4UEGA 3E25A 3K8EA 2QIAA 2XWNA 5EJZA 1KK5A 2V0JA 5CQOA 3CKOA 3JUKA 3SXEA 5F42A 2AQ9A 3OAMA 1LZ0A 1MR9A 2BO4A 3LW6A 3TQDA 2I5EA 4MFGA 3ZLKA 1MP3A 4K6RA 2FYCB 4IHHA 1FWYA 1NHEB 4EE3A 1XZ6A 4FRHA 3OKRA 2DPWA 3OH0A 1E5KA 4JISA 1O0RA 4KC2A 2VHEA 2RJ8A 3CKJA 2E8BA 1JV3A 4IRPA 2IU9A 3U2VA 2QKXA 1ZJ2A 2JCOA 3V90A 2FYAA 2ICXA 5AJOA 1JVDA 1HM8A 4E6TA 4EEOA 2PX7A 1GWWA 1H7HA 2NPOA 5CMGX 5C4FA 1R7UA 4HZCA 4D48A 2OI6A 1GX0A 4EEAA 1QWJA 3R1WA 1FXOA 1V3WA 4HO8A 2Y4MA 4R37A 1H5TB 5FTSA 4KT7A 3CKQA 2YC5A 3MC4A 1ON6A 3MQGA 1SSTA 2RJ4A 5C36A 1ON8A 1G8OA 1K4VA 2X5SA 5L6SA 3IOJA 1MRLA 1H4EA 2RJ5A 2FYBA 2V0IA 3BCVA 1ZJPA 3NGWA 1TZFA 3U0YA 1QRLA 1H7LA 2AM5A 1WT0A 2Y7AA 4EVWA 1NWGB 1KQAA 2UX8A 4XWIA 3R0SA 2VSHA 4FRDA 4B4BA 2ZU8A 4B2WA 1QRMA 1VGTA 3BFPA 4FROA 2Q4JA 3R5AA 1WT3A 2AESA 1H5TA 1XHDA 4NAIA 3OTZA 1G97A 1THJA 3RMWA 2RIYA 3CKNA 2RJ7A 3SXAA 5C1LA 4HUSA 4NALA 4Y7GA 1G93A 3GUEA 4Y6NA 2JCKA 1QREA 1SSQA 1ZJ1A 3TIOA 1PZTA 5CQNX 5C47A 4ISXA 3MQHA 2V0KA 2Z87A 5IFYA 1EYRA 1H5SC 1QGQA 5CQPA 3I3AA 4EA8A 4HO9A 4H7OA 3OH3A 3V0LA 2RIZA 1FO8A 2AH9A 2VS4A 2WLEA 1QRFA 2E3DA 3V0QA 3U0XA 2XMEA 3USRA 3U2TA 2A8UA 2BO6A 1ZJ3A 4BQHA 4N6AA 2WVKA 3KWEA 3R8YA 1H3MA 2YQCA 1YP4A 3SPTA 2O1GA 1NF5B 1O23B 4N27A 3CKVA 2MZBA 3CGXA 1ZJ0A 4D0ZA 1FOAA 1ZI3A 3EEVA 1H5RA 4EAAA 4M2AA 3D8VA 3DK5A 1H7FA 3GOSA 1ZI1A 4FRMA 2FFUA 1KK4A 4KQLA 4HCQA 4EA9A 4L41C 4DECA 2WLFA 4Y7VA 1HJLA 3F1CA 3R3IA 1H5SB 1JYLA 3FSCA 1OQMB 3R5CA 4R7PA 4FREA 4C2SA 3TWDA 2QH5A 1G9RA 2YQSA 2AGDA 5C38A 1GQCA 5C4BA 3POLA 3U2XA 2JCLA 1FO9A 4Y64A 4M2BA 3VBLA 4AYJA 1INIA 5U2KA 2ICYA 3T7NA 3R5BA 3V4EA 3SX3A 4CVHA 4Y63A 3VBMA 4HO4A 3BRKX 2OI5A 2AECA 1YROB 2CU2A 1S4NA 4E75A 4KXOA 1LL2A 3V91A 2RJ0A 3T57A 1V82A 1LVWA 3I0JA 1QQ0A 3IXCA 3FOQA 4EABA 5CMHA 1IIMA 3I0FA 4NAKA 5C3DA 3I0KA 2VFZA 3QVBA 5IDSA 2BO8A 3FS8A 3BSSA 3DHOA 5JQQA 3R2WA 1H5SA 5C1GA 1KHRA 2PGVA 4D11A 1VZTA 5C1HA 2VS3A 3T7MA 1VH3A 5ADXV 2YQJA 2WVLA 5AFUV 3SXDA 3GVDA 3FSYA 5DDTA 3V0MA 4KRVA 3ST8A 5DEPA 1H7EA 4KC1A 2WAWA 2XMHA 3I0HA 3OH2A 5FUHA 1JVGA 3KWDA 1ZHJA 1R7VA 3FSXA 2XWMA 3R3RA 1MP4A 2APCA 3K8DA 2QGIA 4G87A 1FR8A 1R7TA 1ZCVA 2JCJA 4FRAA 4M99A 2W0WA 5C49A 3EG4A 1WT2A 2D0JA 4IHGA 3KIAA 2RJ9A 1H7GA 1R82A 3RMVA 4EEMA 3C8VA 2VD4A 3VBJA 5ADXU 2Y4JA 2BO7A 5AFUU 3EE5A 4M4KA 5I1FA 4NANA 4AC3A 3PMOA 1V67A 3FTTA 3I0CA 5CMFX 4HO3A 4KNXA 5DEMA 1KK6A 1ZCUA 4ASJA 4AAWA 2AE7A 5EJ1A 5HS2A 3SX7A 4HZDA 4KPXA 3VBIA 4ASYA 4M28A 3VBNA 5FV9A 4FCUA 2O1HA 2WLGA 4G3SA 4EE5A 3E26A 4R36A 1MR7A 1S80A 2D7RA 3SRTA 2JF2A 4EQYA 3FSBA 1MP5A 2YCMA 2I5KA 5FU8A 3P47A 4GBPA 3OH1A 1ZI4A 1GA8A 1WT1A 3F1XA 3OH4A 3Q80A 3VBKA 3V8ZA 3OTMA 5AJNA 2OEFA 2GGQA 1LZJA 2OI7A 1OMZA 2X65A 4B4GA 5C8RA 4B42A 2V0LA 2O1FA 3ECTA 4D0TA 1KRUA 1LZ7A 2YC3A 3V0NA 2XWLA 1I52A 3I3XA 4MNDA 3SXCA 3TISA 1MC3A 2OEGA 1KGTA 2PA4A 4CJCA 1INJA 1Z90A 4P00A 3HL3A 4J09A 4E1KA 4N69A 1LL0A 2FFVA 2WLCA 5DDVA 2RIXA 3ZLLA 1GWVA 1VGUA 1J2ZA 2P73A 4DDZA 4MZUA 1H7TA 1KGQA 1VH1A 1GQ9A 3PKPA 3I0IX 1G3LA 2ZU7A 2Y4LA 5CQMX 1QGSA 1W57A 5FU0A 1G23A 3JUJA 3IOIA 3O3PA 3BSYA 3N9WA 1KRVA 1LZIA 3I0DA 3V0PA 5FYEA 1QRGA 4CJBA 5C4DA 5C4EA 2VS5A 3OC9A 1FRWA 4Y62A 2WLDA 1NKHB 4KPZA 4IHFA 2RJ6A 3IOHA 3OU9A 1FZWA 5C3BA 1ZJOA 2QIVX 1XHBA 3SXGA 1O7OA 3I0EA 2VXLA 1FG5N 4B5BA 1SS9A 4MYBA 4ECMA 2A8WA 2RJ1A 1XATA 5C3AA 5CMJA 5L6VA 3PNNA 2WE9A 2D7IA 3OW5A 1VZXA 3ZF8A 4B4MA 4BMAA 5E3PA 2P72A 1KRRA 2IU8A 2AM3A 3U2UA 3SXBA 4JD0A 1ZDFA 1S4PA 1T3DA 4EEGA 1G1LA 3TDTA 5J49A 3IGJA 1HJJA 1H5SD 1R81A 4FQWA 1ZIZA 3OUPA 1ZCTA 1EZIA 1V83A 3JTJA
chains in the Genus database with same CATH superfamily
3PKQA 1KWSA 1O7QA 2X60A 5C4CA 4B3UA 3USQA 1FXJA 4P02A 1LL3A 1LXAA 2YQHA 3V8YA 2IC7A 4EGGA 3V0OA 3EH0A 1FGGA 3T7OA 1R80A 4Y7TA 3OGZA 4Y9XA 4LW3A 3BSWA 3R5DA 3GQ8A 4HG6A 3U2WA 1G0RA 3CU0A 5IDTA 1HM0A 3SX5A 1TW5A 2RIJA 3SX8A 1S4OA 1R7YA 3I0GA 1VM8A 2GGOA 3ZGGA 1W77A 2VSIA 3CJ8A 3Q1XA 2J0BA 2W0VA 2FKOA 1OCXA 4FRPA 4Y7UA 4FRQA 3HJJA 1VZUA 5EIYA 1TDTA 2P2OA 2V0HA 5BXCA 2Y6PA 5CMIA 1H4DA 2WVMA 4KC4A 3TV0A 2Z86A 4M9CA 4DE7A 3D98A 2WEEA 4LW6A 3VBPA 2AM4A 4M98A 2VK9A 4FRBA 3HSQA 1G95A 3DUVA 3ZGFA 3FWWA 1VICA 3F1YA 4AYLA 3JQYA 3P1BA 1FGXA 4AA7A 4HO2A 4J18A 1OMXA 2I7BA 3BXYA 1YP3A 1HV9A 1QG8A 1NMMB 4IRQA 1NQIB 1PZYB 1V84A 4ZDQA 4HO5A 4E6UA 1ZCYA 2JF3A 2NXVA 4G3QA 5AJPA 4CJ8A 1M8NA 2ZU9A 1HM9A 4FCEA 2WGZA 3RSBA 1TW1A 2VXMA 4KNRA 4EA7A 3GQAA 4O6MA 2PGYA 5DG3A 1VPAA 1WVCA 1IINA 1H5RB 4EE4A 3TZTA 3DJ4A 3Q4SA 2Y4KA 5CQLX 5C48A 2YESA 4DCLA 3I0LA 4Y7FA 3SUCA 5FTVA 4D11C 2XATA 3TK8A 1FR9A 1ZDGA 1R7XA 1ZI5A 2P6WA 4MYOA 1VGZA 4G3PA 4Y6UA 3VNPA 2IUAA 4HURA 4FRLA 4Q7CA 4HOCA 2RITA 1JYKA 1YP2A 3NZ2A 1JV1A 2FYDB 2X5ZA 4HO6A 1H4CA 1TVYA 4HO0A 3D5NA 3KWCA 5E3RA 2C0NA 5E3QA 4ARWA 1GX4A 1SSMA 4N6BA 2FY7A 4MIXA 3Q7UA 4YS8A 3GQ9A 1H7QA 4B2XA 2TDTA 4E79A 1WSZA 1W55A 1VGWA 1G2VA 4UEGA 3E25A 3K8EA 2QIAA 2XWNA 5EJZA 1KK5A 2V0JA 5CQOA 3CKOA 3JUKA 5D92A 3SXEA 5F42A 1Z2FA 2AQ9A 3OAMA 1LZ0A 1MR9A 2BO4A 3LW6A 3TQDA 2I5EA 4MFGA 3ZLKA 1MP3A 4K6RA 2FYCB 4IHHA 1FWYA 1NHEB 4EE3A 1XZ6A 4FRHA 3OKRA 2DPWA 3OH0A 1E5KA 4JISA 1O0RA 4KC2A 2VHEA 2RJ8A 3CKJA 2E8BA 1JV3A 4IRPA 2IU9A 3U2VA 2QKXA 1ZJ2A 2JCOA 3V90A 2FYAA 2ICXA 5AJOA 1JVDA 1HM8A 4E6TA 4EEOA 2PX7A 1GWWA 1H7HA 2NPOA 5CMGX 5C4FA 1R7UA 4HZCA 4D48A 2OI6A 1GX0A 4EEAA 1QWJA 3R1WA 1FXOA 1V3WA 4HO8A 2Y4MA 4R37A 1H5TB 5FTSA 4KT7A 3CKQA 2YC5A 3MC4A 1ON6A 3MQGA 1SSTA 2RJ4A 5C36A 1ON8A 1G8OA 1K4VA 2X5SA 5L6SA 3IOJA 1MRLA 1H4EA 2RJ5A 2FYBA 2V0IA 3BCVA 1ZJPA 3NGWA 1TZFA 3U0YA 1QRLA 1H7LA 2AM5A 1WT0A 2Y7AA 4EVWA 1NWGB 1KQAA 2UX8A 4XWIA 3R0SA 2VSHA 4FRDA 4B4BA 2ZU8A 4B2WA 1QRMA 1VGTA 3BFPA 4FROA 2Q4JA 3R5AA 1WT3A 2AESA 1H5TA 1XHDA 4NAIA 3OTZA 1G97A 1THJA 3RMWA 2RIYA 3CKNA 2RJ7A 3SXAA 5C1LA 4HUSA 1EWWA 4NALA 4Y7GA 1G93A 3GUEA 4Y6NA 2JCKA 1QREA 1SSQA 1ZJ1A 3TIOA 1PZTA 5CQNX 5C47A 4ISXA 3MQHA 2V0KA 2Z87A 5IFYA 1EYRA 1H5SC 1QGQA 5CQPA 3I3AA 4EA8A 4HO9A 4H7OA 3OH3A 3V0LA 2RIZA 1FO8A 2AH9A 2VS4A 2WLEA 1QRFA 2E3DA 3V0QA 3U0XA 2XMEA 3USRA 3U2TA 2A8UA 2BO6A 1ZJ3A 4BQHA 4N6AA 2WVKA 3KWEA 3R8YA 1H3MA 2YQCA 1YP4A 3SPTA 2O1GA 1NF5B 1O23B 4N27A 3CKVA 2MZBA 3CGXA 1ZJ0A 4D0ZA 1FOAA 1ZI3A 4FIYA 3EEVA 1H5RA 4EAAA 4M2AA 3D8VA 3DK5A 1H7FA 3GOSA 1ZI1A 4FRMA 2FFUA 1KK4A 4KQLA 4HCQA 4EA9A 4L41C 4DECA 2WLFA 4Y7VA 1HJLA 3F1CA 2J0AA 3R3IA 1H5SB 1JYLA 3FSCA 3GQ7A 1OQMB 3R5CA 4R7PA 4FREA 1N4IA 4C2SA 3TWDA 2QH5A 1G9RA 2YQSA 2AGDA 5C38A 1GQCA 5C4BA 3POLA 3U2XA 2JCLA 1FO9A 4Y64A 4M2BA 3VBLA 4AYJA 1INIA 5U2KA 2ICYA 3T7NA 3R5BA 3V4EA 3SX3A 4CVHA 4Y63A 3VBMA 4HO4A 3BRKX 2OI5A 2AECA 1YROB 2CU2A 1S4NA 4E75A 4KXOA 1LL2A 3V91A 2RJ0A 3T57A 1V82A 1LVWA 3I0JA 1QQ0A 3IXCA 3FOQA 4EABA 5CMHA 1IIMA 3I0FA 4NAKA 5C3DA 3I0KA 2VFZA 3QVBA 5IDSA 2BO8A 3FS8A 3BSSA 3DHOA 5JQQA 3R2WA 1H5SA 5C1GA 1KHRA 2PGVA 4D11A 1VZTA 5C1HA 2VS3A 3T7MA 1VH3A 5ADXV 2YQJA 2WVLA 5AFUV 3SXDA 3GVDA 3FSYA 5DDTA 3V0MA 4KRVA 3ST8A 5DEPA 1H7EA 4KC1A 2WAWA 2XMHA 3I0HA 3OH2A 5FUHA 1JVGA 3KWDA 1ZHJA 1R7VA 3FSXA 2XWMA 3R3RA 1MP4A 2APCA 3K8DA 2QGIA 4G87A 1FR8A 1R7TA 1ZCVA 2JCJA 4FRAA 4M99A 4O6NA 2W0WA 5C49A 3EG4A 1WT2A 2D0JA 4IHGA 3KIAA 2RJ9A 1H7GA 1R82A 3RMVA 4EEMA 3C8VA 2VD4A 3VBJA 5ADXU 2Y4JA 2BO7A 5AFUU 3EE5A 4M4KA 5I1FA 4NANA 4AC3A 3PMOA 1V67A 3FTTA 3I0CA 5CMFX 4HO3A 4KNXA 5DEMA 1KK6A 1ZCUA 4ASJA 4AAWA 2AE7A 5EJ1A 5HS2A 3SX7A 4HZDA 4KPXA 3VBIA 4ASYA 4M28A 3VBNA 5FV9A 4FCUA 2O1HA 2WLGA 4G3SA 4EE5A 3E26A 4R36A 1MR7A 1S80A 2D7RA 3SRTA 2JF2A 4EQYA 3FSBA 1MP5A 2YCMA 2I5KA 5FU8A 3P47A 4GBPA 3OH1A 1ZI4A 1GA8A 1WT1A 3F1XA 3OH4A 3Q80A 3VBKA 3V8ZA 3OTMA 5AJNA 2OEFA 2GGQA 1LZJA 2OI7A 1OMZA 2X65A 4B4GA 5C8RA 4B42A 2V0LA 2O1FA 3ECTA 4D0TA 1KRUA 1LZ7A 2YC3A 3V0NA 2XWLA 1I52A 3I3XA 4MNDA 1L0SA 3SXCA 3TISA 1MC3A 2OEGA 1KGTA 2PA4A 4CJCA 1INJA 1Z90A 4P00A 3HL3A 4J09A 4E1KA 4N69A 1LL0A 2FFVA 2WLCA 5DDVA 2RIXA 3ZLLA 1GWVA 1VGUA 1J2ZA 2P73A 4DDZA 4MZUA 1H7TA 1KGQA 1VH1A 4FIXA 1GQ9A 5D91A 3PKPA 3I0IX 1G3LA 2ZU7A 2Y4LA 5CQMX 1QGSA 1W57A 5FU0A 1G23A 3JUJA 3IOIA 3O3PA 3BSYA 3N9WA 1KRVA 1LZIA 3I0DA 3V0PA 5FYEA 1QRGA 4CJBA 5C4DA 5C4EA 2VS5A 3OC9A 1FRWA 4Y62A 2WLDA 1NKHB 4KPZA 4IHFA 2RJ6A 3IOHA 3OU9A 1FZWA 5C3BA 1ZJOA 2QIVX 1XHBA 3SXGA 1O7OA 3I0EA 2VXLA 1FG5N 4B5BA 1SS9A 4MYBA 4ECMA 2A8WA 2RJ1A 1XATA 5C3AA 5CMJA 5L6VA 3PNNA 2WE9A 2D7IA 3OW5A 1VZXA 3ZF8A 4B4MA 4BMAA 5E3PA 2P72A 1KRRA 2IU8A 2AM3A 3U2UA 3SXBA 4JD0A 1ZDFA 1S4PA 1T3DA 4EEGA 1G1LA 3TDTA 5J49A 3IGJA 1HJJA 1H5SD 1R81A 4FQWA 1ZIZA 3OUPA 1ZCTA 1EZIA 1V83A 3JTJA
chains in the Genus database with same CATH topology
3PKQA 1KWSA 1O7QA 2X60A 5C4CA 4B3UA 3USQA 1FXJA 4P02A 1LL3A 1LXAA 2YQHA 3V8YA 2IC7A 4EGGA 3V0OA 3EH0A 1FGGA 3T7OA 1R80A 4Y7TA 3OGZA 4Y9XA 4LW3A 3BSWA 3R5DA 4HG6A 3U2WA 1G0RA 3CU0A 5IDTA 1HM0A 3SX5A 1TW5A 2RIJA 3SX8A 1S4OA 1R7YA 3I0GA 1VM8A 2GGOA 3ZGGA 1W77A 2VSIA 3CJ8A 3Q1XA 2J0BA 2W0VA 2FKOA 1OCXA 4FRPA 4Y7UA 4FRQA 3HJJA 1VZUA 5EIYA 1TDTA 2P2OA 2V0HA 5BXCA 2Y6PA 5CMIA 1H4DA 2WVMA 4KC4A 3TV0A 2Z86A 4M9CA 4DE7A 3D98A 2WEEA 4LW6A 3VBPA 2AM4A 4M98A 2VK9A 4FRBA 3HSQA 1G95A 3DUVA 3ZGFA 3FWWA 1VICA 3F1YA 4AYLA 3JQYA 3P1BA 1FGXA 4AA7A 4HO2A 4J18A 1OMXA 2I7BA 3BXYA 1YP3A 1HV9A 1QG8A 1NMMB 4IRQA 1NQIB 1PZYB 1V84A 4ZDQA 4HO5A 4E6UA 1ZCYA 2JF3A 2NXVA 4G3QA 5AJPA 4CJ8A 2ZU9A 1HM9A 4FCEA 2WGZA 3RSBA 1TW1A 2VXMA 4KNRA 4EA7A 4O6MA 2PGYA 5DG3A 1VPAA 1WVCA 1IINA 1H5RB 4EE4A 3TZTA 3DJ4A 3Q4SA 2Y4KA 5CQLX 5C48A 2YESA 4DCLA 3I0LA 4Y7FA 5FTVA 4D11C 2XATA 3TK8A 1FR9A 1ZDGA 1R7XA 1ZI5A 2P6WA 4MYOA 1VGZA 4G3PA 4Y6UA 3VNPA 2IUAA 4HURA 4FRLA 4Q7CA 4HOCA 2RITA 1JYKA 1YP2A 3NZ2A 1JV1A 2FYDB 2X5ZA 4HO6A 1H4CA 1TVYA 4HO0A 3D5NA 3KWCA 5E3RA 2C0NA 5E3QA 4ARWA 1GX4A 1SSMA 4N6BA 2FY7A 4MIXA 3Q7UA 4YS8A 1H7QA 4B2XA 2TDTA 4E79A 1WSZA 1W55A 1VGWA 1G2VA 4UEGA 3E25A 3K8EA 2QIAA 2XWNA 5EJZA 1KK5A 2V0JA 5CQOA 3CKOA 3JUKA 5D92A 3SXEA 5F42A 2AQ9A 3OAMA 1LZ0A 1MR9A 2BO4A 3LW6A 3TQDA 2I5EA 4MFGA 3ZLKA 1MP3A 4K6RA 2FYCB 4IHHA 1FWYA 1NHEB 4EE3A 1XZ6A 4FRHA 3OKRA 2DPWA 3OH0A 1E5KA 4JISA 1O0RA 4KC2A 2VHEA 2RJ8A 3CKJA 2E8BA 1JV3A 4IRPA 2IU9A 3U2VA 2QKXA 1ZJ2A 2JCOA 3V90A 2FYAA 2ICXA 5AJOA 1JVDA 1HM8A 4E6TA 4EEOA 2PX7A 1GWWA 1H7HA 2NPOA 5CMGX 5C4FA 1R7UA 4HZCA 4D48A 2OI6A 1GX0A 4EEAA 1QWJA 3R1WA 1FXOA 1V3WA 4HO8A 2Y4MA 4R37A 1H5TB 5FTSA 4KT7A 3CKQA 2YC5A 3MC4A 1ON6A 3MQGA 1SSTA 2RJ4A 5C36A 1ON8A 1G8OA 1K4VA 2X5SA 5L6SA 3IOJA 1MRLA 1H4EA 2RJ5A 2FYBA 2V0IA 3BCVA 1ZJPA 3NGWA 1TZFA 3U0YA 1QRLA 1H7LA 2AM5A 1WT0A 2Y7AA 4EVWA 1NWGB 1KQAA 2UX8A 4XWIA 3R0SA 2VSHA 4FRDA 4B4BA 2ZU8A 4B2WA 1QRMA 1VGTA 3BFPA 4FROA 2Q4JA 3R5AA 1WT3A 2AESA 1H5TA 1XHDA 4NAIA 3OTZA 1G97A 1THJA 3RMWA 2RIYA 3CKNA 2RJ7A 3SXAA 5C1LA 4HUSA 4NALA 4Y7GA 1G93A 3GUEA 4Y6NA 2JCKA 1QREA 1SSQA 1ZJ1A 3TIOA 1PZTA 5CQNX 5C47A 4ISXA 3MQHA 2V0KA 2Z87A 5IFYA 1EYRA 1H5SC 1QGQA 5CQPA 3I3AA 4EA8A 4HO9A 4H7OA 3OH3A 3V0LA 2RIZA 1FO8A 2AH9A 2VS4A 2WLEA 1QRFA 2E3DA 3V0QA 3U0XA 2XMEA 3USRA 3U2TA 2A8UA 2BO6A 1ZJ3A 4BQHA 4N6AA 2WVKA 3KWEA 3R8YA 1H3MA 2YQCA 1YP4A 3SPTA 2O1GA 1NF5B 1O23B 4N27A 3CKVA 2MZBA 3CGXA 1ZJ0A 4D0ZA 1FOAA 1ZI3A 4FIYA 3EEVA 1H5RA 4EAAA 4M2AA 3D8VA 3DK5A 1H7FA 3GOSA 1ZI1A 4FRMA 2FFUA 1KK4A 4KQLA 4HCQA 4EA9A 4L41C 4DECA 2WLFA 4Y7VA 1HJLA 3F1CA 2J0AA 3R3IA 1H5SB 1JYLA 3FSCA 1OQMB 3R5CA 4R7PA 4FREA 4C2SA 3TWDA 2QH5A 1G9RA 2YQSA 2AGDA 5C38A 1GQCA 5C4BA 3POLA 3U2XA 2JCLA 1FO9A 4Y64A 4M2BA 3VBLA 4AYJA 1INIA 5U2KA 2ICYA 3T7NA 3R5BA 3V4EA 3SX3A 4CVHA 4Y63A 3VBMA 4HO4A 3BRKX 2OI5A 2AECA 1YROB 2CU2A 1S4NA 4E75A 4KXOA 1LL2A 3V91A 2RJ0A 3T57A 1V82A 1LVWA 3I0JA 1QQ0A 3IXCA 3FOQA 4EABA 5CMHA 1IIMA 3I0FA 4NAKA 5C3DA 3I0KA 2VFZA 3QVBA 5IDSA 2BO8A 3FS8A 3BSSA 3DHOA 5JQQA 3R2WA 1H5SA 5C1GA 1KHRA 2PGVA 4D11A 1VZTA 5C1HA 2VS3A 3T7MA 1VH3A 5ADXV 2YQJA 2WVLA 5AFUV 3SXDA 3GVDA 3FSYA 5DDTA 3V0MA 4KRVA 3ST8A 5DEPA 1H7EA 4KC1A 2WAWA 2XMHA 3I0HA 3OH2A 5FUHA 1JVGA 3KWDA 1ZHJA 1R7VA 3FSXA 2XWMA 3R3RA 1MP4A 2APCA 3K8DA 2QGIA 4G87A 1FR8A 1R7TA 1ZCVA 2JCJA 4FRAA 4M99A 4O6NA 2W0WA 5C49A 3EG4A 1WT2A 2D0JA 4IHGA 3KIAA 2RJ9A 1H7GA 1R82A 3RMVA 4EEMA 3C8VA 2VD4A 3VBJA 5ADXU 2Y4JA 2BO7A 5AFUU 3EE5A 4M4KA 5I1FA 4NANA 4AC3A 3PMOA 1V67A 3FTTA 3I0CA 5CMFX 4HO3A 4KNXA 5DEMA 1KK6A 1ZCUA 4ASJA 4AAWA 2AE7A 5EJ1A 5HS2A 3SX7A 4HZDA 4KPXA 3VBIA 4ASYA 4M28A 3VBNA 5FV9A 4FCUA 2O1HA 2WLGA 4G3SA 4EE5A 3E26A 4R36A 1MR7A 1S80A 2D7RA 3SRTA 2JF2A 4EQYA 3FSBA 1MP5A 2YCMA 2I5KA 5FU8A 3P47A 4GBPA 3OH1A 1ZI4A 1GA8A 1WT1A 3F1XA 3OH4A 3Q80A 3VBKA 3V8ZA 3OTMA 5AJNA 2OEFA 2GGQA 1LZJA 2OI7A 1OMZA 2X65A 4B4GA 5C8RA 4B42A 2V0LA 2O1FA 3ECTA 4D0TA 1KRUA 1LZ7A 2YC3A 3V0NA 2XWLA 1I52A 3I3XA 4MNDA 3SXCA 3TISA 1MC3A 2OEGA 1KGTA 2PA4A 4CJCA 1INJA 1Z90A 4P00A 3HL3A 4J09A 4E1KA 4N69A 1LL0A 2FFVA 2WLCA 5DDVA 2RIXA 3ZLLA 1GWVA 1VGUA 1J2ZA 2P73A 4DDZA 4MZUA 1H7TA 1KGQA 1VH1A 4FIXA 1GQ9A 5D91A 3PKPA 3I0IX 1G3LA 2ZU7A 2Y4LA 5CQMX 1QGSA 1W57A 5FU0A 1G23A 3JUJA 3IOIA 3O3PA 3BSYA 3N9WA 1KRVA 1LZIA 3I0DA 3V0PA 5FYEA 1QRGA 4CJBA 5C4DA 5C4EA 2VS5A 3OC9A 1FRWA 4Y62A 2WLDA 1NKHB 4KPZA 4IHFA 2RJ6A 3IOHA 3OU9A 1FZWA 5C3BA 1ZJOA 2QIVX 1XHBA 3SXGA 1O7OA 3I0EA 2VXLA 1FG5N 4B5BA 1SS9A 4MYBA 4ECMA 2A8WA 2RJ1A 1XATA 5C3AA 5CMJA 5L6VA 3PNNA 2WE9A 2D7IA 3OW5A 1VZXA 3ZF8A 4B4MA 4BMAA 5E3PA 2P72A 1KRRA 2IU8A 2AM3A 3U2UA 3SXBA 4JD0A 1ZDFA 1S4PA 1T3DA 4EEGA 1G1LA 3TDTA 5J49A 3IGJA 1HJJA 1H5SD 1R81A 4FQWA 1ZIZA 3OUPA 1ZCTA 1EZIA 1V83A 3JTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKQ A;  1KWS A;  1O7Q A;  2X60 A;  5C4C A;  4B3U A;  3USQ A;  1FXJ A;  4P02 A;  1LL3 A;  1LXA A;  2YQH A;  3V8Y A;  2IC7 A;  4EGG A;  3V0O A;  3EH0 A;  1FGG A;  3T7O A;  1R80 A;  4Y7T A;  3OGZ A;  4Y9X A;  4LW3 A;  3BSW A;  3R5D A;  4HG6 A;  3U2W A;  1G0R A;  3CU0 A;  5IDT A;  1HM0 A;  3SX5 A;  1TW5 A;  2RIJ A;  3SX8 A;  1S4O A;  1R7Y A;  3I0G A;  1VM8 A;  2GGO A;  3ZGG A;  1W77 A;  2VSI A;  3CJ8 A;  3Q1X A;  2W0V A;  2FKO A;  1OCX A;  4FRP A;  4Y7U A;  4FRQ A;  3HJJ A;  1VZU A;  5EIY A;  1TDT A;  2P2O A;  2V0H A;  5BXC A;  2Y6P A;  5CMI A;  1H4D A;  2WVM A;  4KC4 A;  3TV0 A;  2Z86 A;  4M9C A;  4DE7 A;  3D98 A;  2WEE A;  4LW6 A;  3VBP A;  2AM4 A;  4M98 A;  4FRB A;  3HSQ A;  1G95 A;  3DUV A;  3ZGF A;  3FWW A;  1VIC A;  3F1Y A;  4AYL A;  3JQY A;  3P1B A;  1FGX A;  4AA7 A;  4HO2 A;  4J18 A;  1OMX A;  2I7B A;  3BXY A;  1YP3 A;  1HV9 A;  1QG8 A;  1NMM B;  4IRQ A;  1NQI B;  1PZY B;  1V84 A;  4ZDQ A;  4HO5 A;  4E6U A;  1ZCY A;  2JF3 A;  2NXV A;  4G3Q A;  5AJP A;  4CJ8 A;  2ZU9 A;  1HM9 A;  4FCE A;  2WGZ A;  3RSB A;  1TW1 A;  2VXM A;  4KNR A;  4EA7 A;  2PGY A;  5DG3 A;  1VPA A;  1WVC A;  1IIN A;  1H5R B;  4EE4 A;  3TZT A;  3DJ4 A;  3Q4S A;  2Y4K A;  5CQL X;  5C48 A;  2YES A;  4DCL A;  3I0L A;  4Y7F A;  5FTV A;  4D11 C;  2XAT A;  3TK8 A;  1FR9 A;  1ZDG A;  1R7X A;  1ZI5 A;  2P6W A;  4MYO A;  1VGZ A;  4G3P A;  4Y6U A;  3VNP A;  2IUA A;  4HUR A;  4FRL A;  4HOC A;  2RIT A;  1JYK A;  1YP2 A;  3NZ2 A;  1JV1 A;  2FYD B;  2X5Z A;  4HO6 A;  1H4C A;  1TVY A;  4HO0 A;  3D5N A;  3KWC A;  5E3R A;  5E3Q A;  4ARW A;  1GX4 A;  1SSM A;  4N6B A;  2FY7 A;  3Q7U A;  4YS8 A;  1H7Q A;  4B2X A;  2TDT A;  4E79 A;  1WSZ A;  1W55 A;  1VGW A;  1G2V A;  4UEG A;  3E25 A;  3K8E A;  2QIA A;  2XWN A;  5EJZ A;  1KK5 A;  2V0J A;  5CQO A;  3CKO A;  3JUK A;  3SXE A;  5F42 A;  2AQ9 A;  3OAM A;  1LZ0 A;  1MR9 A;  2BO4 A;  3LW6 A;  3TQD A;  2I5E A;  4MFG A;  3ZLK A;  1MP3 A;  4K6R A;  2FYC B;  4IHH A;  1FWY A;  1NHE B;  4EE3 A;  1XZ6 A;  4FRH A;  3OKR A;  2DPW A;  3OH0 A;  1E5K A;  4JIS A;  1O0R A;  4KC2 A;  2VHE A;  2RJ8 A;  3CKJ A;  2E8B A;  1JV3 A;  4IRP A;  2IU9 A;  3U2V A;  2QKX A;  1ZJ2 A;  2JCO A;  3V90 A;  2FYA A;  2ICX A;  5AJO A;  1JVD A;  1HM8 A;  4E6T A;  4EEO A;  2PX7 A;  1GWW A;  1H7H A;  2NPO A;  5CMG X;  5C4F A;  1R7U A;  4HZC A;  4D48 A;  2OI6 A;  1GX0 A;  4EEA A;  1QWJ A;  3R1W A;  1FXO A;  1V3W A;  4HO8 A;  2Y4M A;  4R37 A;  1H5T B;  5FTS A;  4KT7 A;  3CKQ A;  2YC5 A;  3MC4 A;  1ON6 A;  3MQG A;  1SST A;  2RJ4 A;  5C36 A;  1ON8 A;  1G8O A;  1K4V A;  2X5S A;  5L6S A;  3IOJ A;  1MRL A;  1H4E A;  2RJ5 A;  2FYB A;  2V0I A;  3BCV A;  1ZJP A;  3NGW A;  1TZF A;  3U0Y A;  1QRL A;  1H7L A;  2AM5 A;  1WT0 A;  2Y7A A;  4EVW A;  1NWG B;  1KQA A;  2UX8 A;  4XWI A;  3R0S A;  2VSH A;  4FRD A;  4B4B A;  2ZU8 A;  4B2W A;  1QRM A;  1VGT A;  3BFP A;  4FRO A;  2Q4J A;  3R5A A;  1WT3 A;  2AES A;  1H5T A;  1XHD A;  4NAI A;  3OTZ A;  1G97 A;  1THJ A;  3RMW A;  2RIY A;  3CKN A;  2RJ7 A;  3SXA A;  5C1L A;  4HUS A;  4NAL A;  4Y7G A;  1G93 A;  3GUE A;  4Y6N A;  2JCK A;  1QRE A;  1SSQ A;  1ZJ1 A;  3TIO A;  1PZT A;  5CQN X;  5C47 A;  4ISX A;  3MQH A;  2V0K A;  2Z87 A;  5IFY A;  1EYR A;  1H5S C;  1QGQ A;  5CQP A;  3I3A A;  4EA8 A;  4HO9 A;  4H7O A;  3OH3 A;  3V0L A;  2RIZ A;  1FO8 A;  2AH9 A;  2VS4 A;  2WLE A;  1QRF A;  2E3D A;  3V0Q A;  3U0X A;  2XME A;  3USR A;  3U2T A;  2A8U A;  2BO6 A;  1ZJ3 A;  4BQH A;  4N6A A;  2WVK A;  3KWE A;  3R8Y A;  1H3M A;  2YQC A;  1YP4 A;  3SPT A;  2O1G A;  1NF5 B;  1O23 B;  4N27 A;  3CKV A;  2MZB A;  3CGX A;  1ZJ0 A;  4D0Z A;  1FOA A;  1ZI3 A;  3EEV A;  1H5R A;  4EAA A;  4M2A A;  3D8V A;  3DK5 A;  1H7F A;  3GOS A;  1ZI1 A;  4FRM A;  2FFU A;  1KK4 A;  4KQL A;  4HCQ A;  4EA9 A;  4L41 C;  4DEC A;  2WLF A;  4Y7V A;  1HJL A;  3F1C A;  3R3I A;  1H5S B;  1JYL A;  3FSC A;  1OQM B;  3R5C A;  4R7P A;  4FRE A;  4C2S A;  3TWD A;  2QH5 A;  1G9R A;  2YQS A;  2AGD A;  5C38 A;  1GQC A;  5C4B A;  3POL A;  3U2X A;  2JCL A;  1FO9 A;  4Y64 A;  4M2B A;  3VBL A;  4AYJ A;  1INI A;  5U2K A;  2ICY A;  3T7N A;  3R5B A;  3V4E A;  3SX3 A;  4CVH A;  4Y63 A;  3VBM A;  4HO4 A;  3BRK X;  2OI5 A;  2AEC A;  1YRO B;  2CU2 A;  1S4N A;  4E75 A;  4KXO A;  1LL2 A;  3V91 A;  2RJ0 A;  3T57 A;  1V82 A;  1LVW A;  3I0J A;  1QQ0 A;  3IXC A;  3FOQ A;  4EAB A;  5CMH A;  1IIM A;  3I0F A;  4NAK A;  5C3D A;  3I0K A;  2VFZ A;  3QVB A;  5IDS A;  2BO8 A;  3FS8 A;  3BSS A;  3DHO A;  5JQQ A;  3R2W A;  1H5S A;  5C1G A;  1KHR A;  2PGV A;  4D11 A;  1VZT A;  5C1H A;  2VS3 A;  3T7M A;  1VH3 A;  5ADX V;  2YQJ A;  2WVL A;  5AFU V;  3SXD A;  3GVD A;  3FSY A;  5DDT A;  3V0M A;  4KRV A;  3ST8 A;  5DEP A;  1H7E A;  4KC1 A;  2WAW A;  2XMH A;  3I0H A;  3OH2 A;  5FUH A;  1JVG A;  3KWD A;  1ZHJ A;  1R7V A;  3FSX A;  2XWM A;  3R3R A;  1MP4 A;  2APC A;  3K8D A;  2QGI A;  4G87 A;  1FR8 A;  1R7T A;  1ZCV A;  2JCJ A;  4FRA A;  4M99 A;  2W0W A;  5C49 A;  3EG4 A;  1WT2 A;  2D0J A;  4IHG A;  3KIA A;  2RJ9 A;  1H7G A;  1R82 A;  3RMV A;  4EEM A;  3C8V A;  2VD4 A;  3VBJ A;  5ADX U;  2Y4J A;  2BO7 A;  5AFU U;  3EE5 A;  4M4K A;  5I1F A;  4NAN A;  4AC3 A;  3PMO A;  1V67 A;  3FTT A;  3I0C A;  5CMF X;  4HO3 A;  4KNX A;  5DEM A;  1KK6 A;  1ZCU A;  4ASJ A;  4AAW A;  2AE7 A;  5EJ1 A;  5HS2 A;  3SX7 A;  4HZD A;  4KPX A;  3VBI A;  4ASY A;  4M28 A;  3VBN A;  5FV9 A;  4FCU A;  2O1H A;  2WLG A;  4G3S A;  4EE5 A;  3E26 A;  4R36 A;  1MR7 A;  1S80 A;  2D7R A;  3SRT A;  2JF2 A;  4EQY A;  3FSB A;  1MP5 A;  2YCM A;  2I5K A;  5FU8 A;  3P47 A;  4GBP A;  3OH1 A;  1ZI4 A;  1GA8 A;  1WT1 A;  3F1X A;  3OH4 A;  3Q80 A;  3VBK A;  3V8Z A;  3OTM A;  5AJN A;  2OEF A;  2GGQ A;  1LZJ A;  2OI7 A;  1OMZ A;  2X65 A;  4B4G A;  5C8R A;  4B42 A;  2V0L A;  2O1F A;  3ECT A;  4D0T A;  1KRU A;  1LZ7 A;  2YC3 A;  3V0N A;  2XWL A;  1I52 A;  3I3X A;  4MND A;  3SXC A;  3TIS A;  1MC3 A;  2OEG A;  1KGT A;  2PA4 A;  4CJC A;  1INJ A;  1Z90 A;  4P00 A;  3HL3 A;  4J09 A;  4E1K A;  4N69 A;  1LL0 A;  2FFV A;  2WLC A;  5DDV A;  2RIX A;  3ZLL A;  1GWV A;  1VGU A;  1J2Z A;  2P73 A;  4DDZ A;  4MZU A;  1H7T A;  1KGQ A;  1VH1 A;  1GQ9 A;  3PKP A;  3I0I X;  1G3L A;  2ZU7 A;  2Y4L A;  5CQM X;  1QGS A;  1W57 A;  5FU0 A;  1G23 A;  3JUJ A;  3IOI A;  3O3P A;  3BSY A;  3N9W A;  1KRV A;  1LZI A;  3I0D A;  3V0P A;  5FYE A;  1QRG A;  4CJB A;  5C4D A;  5C4E A;  2VS5 A;  3OC9 A;  1FRW A;  4Y62 A;  2WLD A;  1NKH B;  4KPZ A;  4IHF A;  2RJ6 A;  3IOH A;  3OU9 A;  1FZW A;  5C3B A;  1ZJO A;  2QIV X;  1XHB A;  3SXG A;  1O7O A;  3I0E A;  2VXL A;  1FG5 N;  4B5B A;  1SS9 A;  4MYB A;  4ECM A;  2A8W A;  2RJ1 A;  1XAT A;  5C3A A;  5CMJ A;  5L6V A;  3PNN A;  2WE9 A;  2D7I A;  3OW5 A;  1VZX A;  3ZF8 A;  4B4M A;  4BMA A;  5E3P A;  2P72 A;  1KRR A;  2IU8 A;  2AM3 A;  3U2U A;  3SXB A;  4JD0 A;  1ZDF A;  1S4P A;  1T3D A;  4EEG A;  1G1L A;  3TDT A;  5J49 A;  3IGJ A;  1HJJ A;  1H5S D;  1R81 A;  4FQW A;  1ZIZ A;  3OUP A;  1ZCT A;  1EZI A;  1V83 A;  3JTJ A; 
#chains in the Genus database with same CATH topology
 3PKQ A;  1KWS A;  1O7Q A;  2X60 A;  5C4C A;  4B3U A;  3USQ A;  1FXJ A;  4P02 A;  1LL3 A;  1LXA A;  2YQH A;  3V8Y A;  2IC7 A;  4EGG A;  3V0O A;  3EH0 A;  1FGG A;  3T7O A;  1R80 A;  4Y7T A;  3OGZ A;  4Y9X A;  4LW3 A;  3BSW A;  3R5D A;  3GQ8 A;  4HG6 A;  3U2W A;  1G0R A;  3CU0 A;  5IDT A;  1HM0 A;  3SX5 A;  1TW5 A;  2RIJ A;  3SX8 A;  1S4O A;  1R7Y A;  3I0G A;  1VM8 A;  2GGO A;  3ZGG A;  1W77 A;  2VSI A;  3CJ8 A;  3Q1X A;  2J0B A;  2W0V A;  2FKO A;  1OCX A;  4FRP A;  4Y7U A;  4FRQ A;  3HJJ A;  1VZU A;  5EIY A;  1TDT A;  2P2O A;  2V0H A;  5BXC A;  2Y6P A;  5CMI A;  1H4D A;  2WVM A;  4KC4 A;  3TV0 A;  2Z86 A;  4M9C A;  4DE7 A;  3D98 A;  2WEE A;  4LW6 A;  3VBP A;  2AM4 A;  4M98 A;  2VK9 A;  4FRB A;  3HSQ A;  1G95 A;  3DUV A;  3ZGF A;  3FWW A;  1VIC A;  3F1Y A;  4AYL A;  3JQY A;  3P1B A;  1FGX A;  4AA7 A;  4HO2 A;  4J18 A;  1OMX A;  2I7B A;  3BXY A;  1YP3 A;  1HV9 A;  1QG8 A;  1NMM B;  4IRQ A;  1NQI B;  1PZY B;  1V84 A;  4ZDQ A;  4HO5 A;  4E6U A;  1ZCY A;  2JF3 A;  2NXV A;  4G3Q A;  5AJP A;  4CJ8 A;  1M8N A;  2ZU9 A;  1HM9 A;  4FCE A;  2WGZ A;  3RSB A;  1TW1 A;  2VXM A;  4KNR A;  4EA7 A;  3GQA A;  4O6M A;  2PGY A;  5DG3 A;  1VPA A;  1WVC A;  1IIN A;  1H5R B;  4EE4 A;  3TZT A;  3DJ4 A;  3Q4S A;  2Y4K A;  5CQL X;  5C48 A;  2YES A;  4DCL A;  3I0L A;  4Y7F A;  3SUC A;  5FTV A;  4D11 C;  2XAT A;  3TK8 A;  1FR9 A;  1ZDG A;  1R7X A;  1ZI5 A;  2P6W A;  4MYO A;  1VGZ A;  4G3P A;  4Y6U A;  3VNP A;  2IUA A;  4HUR A;  4FRL A;  4Q7C A;  4HOC A;  2RIT A;  1JYK A;  1YP2 A;  3NZ2 A;  1JV1 A;  2FYD B;  2X5Z A;  4HO6 A;  1H4C A;  1TVY A;  4HO0 A;  3D5N A;  3KWC A;  5E3R A;  2C0N A;  5E3Q A;  4ARW A;  1GX4 A;  1SSM A;  4N6B A;  2FY7 A;  4MIX A;  3Q7U A;  4YS8 A;  3GQ9 A;  1H7Q A;  4B2X A;  2TDT A;  4E79 A;  1WSZ A;  1W55 A;  1VGW A;  1G2V A;  4UEG A;  3E25 A;  3K8E A;  2QIA A;  2XWN A;  5EJZ A;  1KK5 A;  2V0J A;  5CQO A;  3CKO A;  3JUK A;  5D92 A;  3SXE A;  5F42 A;  1Z2F A;  2AQ9 A;  3OAM A;  1LZ0 A;  1MR9 A;  2BO4 A;  3LW6 A;  3TQD A;  2I5E A;  4MFG A;  3ZLK A;  1MP3 A;  4K6R A;  2FYC B;  4IHH A;  1FWY A;  1NHE B;  4EE3 A;  1XZ6 A;  4FRH A;  3OKR A;  2DPW A;  3OH0 A;  1E5K A;  4JIS A;  1O0R A;  4KC2 A;  2VHE A;  2RJ8 A;  3CKJ A;  2E8B A;  1JV3 A;  4IRP A;  2IU9 A;  3U2V A;  2QKX A;  1ZJ2 A;  2JCO A;  3V90 A;  2FYA A;  2ICX A;  5AJO A;  1JVD A;  1HM8 A;  4E6T A;  4EEO A;  2PX7 A;  1GWW A;  1H7H A;  2NPO A;  5CMG X;  5C4F A;  1R7U A;  4HZC A;  4D48 A;  2OI6 A;  1GX0 A;  4EEA A;  1QWJ A;  3R1W A;  1FXO A;  1V3W A;  4HO8 A;  2Y4M A;  4R37 A;  1H5T B;  5FTS A;  4KT7 A;  3CKQ A;  2YC5 A;  3MC4 A;  1ON6 A;  3MQG A;  1SST A;  2RJ4 A;  5C36 A;  1ON8 A;  1G8O A;  1K4V A;  2X5S A;  5L6S A;  3IOJ A;  1MRL A;  1H4E A;  2RJ5 A;  2FYB A;  2V0I A;  3BCV A;  1ZJP A;  3NGW A;  1TZF A;  3U0Y A;  1QRL A;  1H7L A;  2AM5 A;  1WT0 A;  2Y7A A;  4EVW A;  1NWG B;  1KQA A;  2UX8 A;  4XWI A;  3R0S A;  2VSH A;  4FRD A;  4B4B A;  2ZU8 A;  4B2W A;  1QRM A;  1VGT A;  3BFP A;  4FRO A;  2Q4J A;  3R5A A;  1WT3 A;  2AES A;  1H5T A;  1XHD A;  4NAI A;  3OTZ A;  1G97 A;  1THJ A;  3RMW A;  2RIY A;  3CKN A;  2RJ7 A;  3SXA A;  5C1L A;  4HUS A;  1EWW A;  4NAL A;  4Y7G A;  1G93 A;  3GUE A;  4Y6N A;  2JCK A;  1QRE A;  1SSQ A;  1ZJ1 A;  3TIO A;  1PZT A;  5CQN X;  5C47 A;  4ISX A;  3MQH A;  2V0K A;  2Z87 A;  5IFY A;  1EYR A;  1H5S C;  1QGQ A;  5CQP A;  3I3A A;  4EA8 A;  4HO9 A;  4H7O A;  3OH3 A;  3V0L A;  2RIZ A;  1FO8 A;  2AH9 A;  2VS4 A;  2WLE A;  1QRF A;  2E3D A;  3V0Q A;  3U0X A;  2XME A;  3USR A;  3U2T A;  2A8U A;  2BO6 A;  1ZJ3 A;  4BQH A;  4N6A A;  2WVK A;  3KWE A;  3R8Y A;  1H3M A;  2YQC A;  1YP4 A;  3SPT A;  2O1G A;  1NF5 B;  1O23 B;  4N27 A;  3CKV A;  2MZB A;  3CGX A;  1ZJ0 A;  4D0Z A;  1FOA A;  1ZI3 A;  4FIY A;  3EEV A;  1H5R A;  4EAA A;  4M2A A;  3D8V A;  3DK5 A;  1H7F A;  3GOS A;  1ZI1 A;  4FRM A;  2FFU A;  1KK4 A;  4KQL A;  4HCQ A;  4EA9 A;  4L41 C;  4DEC A;  2WLF A;  4Y7V A;  1HJL A;  3F1C A;  2J0A A;  3R3I A;  1H5S B;  1JYL A;  3FSC A;  3GQ7 A;  1OQM B;  3R5C A;  4R7P A;  4FRE A;  1N4I A;  4C2S A;  3TWD A;  2QH5 A;  1G9R A;  2YQS A;  2AGD A;  5C38 A;  1GQC A;  5C4B A;  3POL A;  3U2X A;  2JCL A;  1FO9 A;  4Y64 A;  4M2B A;  3VBL A;  4AYJ A;  1INI A;  5U2K A;  2ICY A;  3T7N A;  3R5B A;  3V4E A;  3SX3 A;  4CVH A;  4Y63 A;  3VBM A;  4HO4 A;  3BRK X;  2OI5 A;  2AEC A;  1YRO B;  2CU2 A;  1S4N A;  4E75 A;  4KXO A;  1LL2 A;  3V91 A;  2RJ0 A;  3T57 A;  1V82 A;  1LVW A;  3I0J A;  1QQ0 A;  3IXC A;  3FOQ A;  4EAB A;  5CMH A;  1IIM A;  3I0F A;  4NAK A;  5C3D A;  3I0K A;  2VFZ A;  3QVB A;  5IDS A;  2BO8 A;  3FS8 A;  3BSS A;  3DHO A;  5JQQ A;  3R2W A;  1H5S A;  5C1G A;  1KHR A;  2PGV A;  4D11 A;  1VZT A;  5C1H A;  2VS3 A;  3T7M A;  1VH3 A;  5ADX V;  2YQJ A;  2WVL A;  5AFU V;  3SXD A;  3GVD A;  3FSY A;  5DDT A;  3V0M A;  4KRV A;  3ST8 A;  5DEP A;  1H7E A;  4KC1 A;  2WAW A;  2XMH A;  3I0H A;  3OH2 A;  5FUH A;  1JVG A;  3KWD A;  1ZHJ A;  1R7V A;  3FSX A;  2XWM A;  3R3R A;  1MP4 A;  2APC A;  3K8D A;  2QGI A;  4G87 A;  1FR8 A;  1R7T A;  1ZCV A;  2JCJ A;  4FRA A;  4M99 A;  4O6N A;  2W0W A;  5C49 A;  3EG4 A;  1WT2 A;  2D0J A;  4IHG A;  3KIA A;  2RJ9 A;  1H7G A;  1R82 A;  3RMV A;  4EEM A;  3C8V A;  2VD4 A;  3VBJ A;  5ADX U;  2Y4J A;  2BO7 A;  5AFU U;  3EE5 A;  4M4K A;  5I1F A;  4NAN A;  4AC3 A;  3PMO A;  1V67 A;  3FTT A;  3I0C A;  5CMF X;  4HO3 A;  4KNX A;  5DEM A;  1KK6 A;  1ZCU A;  4ASJ A;  4AAW A;  2AE7 A;  5EJ1 A;  5HS2 A;  3SX7 A;  4HZD A;  4KPX A;  3VBI A;  4ASY A;  4M28 A;  3VBN A;  5FV9 A;  4FCU A;  2O1H A;  2WLG A;  4G3S A;  4EE5 A;  3E26 A;  4R36 A;  1MR7 A;  1S80 A;  2D7R A;  3SRT A;  2JF2 A;  4EQY A;  3FSB A;  1MP5 A;  2YCM A;  2I5K A;  5FU8 A;  3P47 A;  4GBP A;  3OH1 A;  1ZI4 A;  1GA8 A;  1WT1 A;  3F1X A;  3OH4 A;  3Q80 A;  3VBK A;  3V8Z A;  3OTM A;  5AJN A;  2OEF A;  2GGQ A;  1LZJ A;  2OI7 A;  1OMZ A;  2X65 A;  4B4G A;  5C8R A;  4B42 A;  2V0L A;  2O1F A;  3ECT A;  4D0T A;  1KRU A;  1LZ7 A;  2YC3 A;  3V0N A;  2XWL A;  1I52 A;  3I3X A;  4MND A;  1L0S A;  3SXC A;  3TIS A;  1MC3 A;  2OEG A;  1KGT A;  2PA4 A;  4CJC A;  1INJ A;  1Z90 A;  4P00 A;  3HL3 A;  4J09 A;  4E1K A;  4N69 A;  1LL0 A;  2FFV A;  2WLC A;  5DDV A;  2RIX A;  3ZLL A;  1GWV A;  1VGU A;  1J2Z A;  2P73 A;  4DDZ A;  4MZU A;  1H7T A;  1KGQ A;  1VH1 A;  4FIX A;  1GQ9 A;  5D91 A;  3PKP A;  3I0I X;  1G3L A;  2ZU7 A;  2Y4L A;  5CQM X;  1QGS A;  1W57 A;  5FU0 A;  1G23 A;  3JUJ A;  3IOI A;  3O3P A;  3BSY A;  3N9W A;  1KRV A;  1LZI A;  3I0D A;  3V0P A;  5FYE A;  1QRG A;  4CJB A;  5C4D A;  5C4E A;  2VS5 A;  3OC9 A;  1FRW A;  4Y62 A;  2WLD A;  1NKH B;  4KPZ A;  4IHF A;  2RJ6 A;  3IOH A;  3OU9 A;  1FZW A;  5C3B A;  1ZJO A;  2QIV X;  1XHB A;  3SXG A;  1O7O A;  3I0E A;  2VXL A;  1FG5 N;  4B5B A;  1SS9 A;  4MYB A;  4ECM A;  2A8W A;  2RJ1 A;  1XAT A;  5C3A A;  5CMJ A;  5L6V A;  3PNN A;  2WE9 A;  2D7I A;  3OW5 A;  1VZX A;  3ZF8 A;  4B4M A;  4BMA A;  5E3P A;  2P72 A;  1KRR A;  2IU8 A;  2AM3 A;  3U2U A;  3SXB A;  4JD0 A;  1ZDF A;  1S4P A;  1T3D A;  4EEG A;  1G1L A;  3TDT A;  5J49 A;  3IGJ A;  1HJJ A;  1H5S D;  1R81 A;  4FQW A;  1ZIZ A;  3OUP A;  1ZCT A;  1EZI A;  1V83 A;  3JTJ A; 
#chains in the Genus database with same CATH homology
 3PKQ A;  1KWS A;  1O7Q A;  2X60 A;  5C4C A;  4B3U A;  3USQ A;  1FXJ A;  4P02 A;  1LL3 A;  1LXA A;  2YQH A;  3V8Y A;  2IC7 A;  4EGG A;  3V0O A;  3EH0 A;  1FGG A;  3T7O A;  1R80 A;  4Y7T A;  3OGZ A;  4Y9X A;  4LW3 A;  3BSW A;  3R5D A;  4HG6 A;  3U2W A;  1G0R A;  3CU0 A;  5IDT A;  1HM0 A;  3SX5 A;  1TW5 A;  2RIJ A;  3SX8 A;  1S4O A;  1R7Y A;  3I0G A;  1VM8 A;  2GGO A;  3ZGG A;  1W77 A;  2VSI A;  3CJ8 A;  3Q1X A;  2J0B A;  2W0V A;  2FKO A;  1OCX A;  4FRP A;  4Y7U A;  4FRQ A;  3HJJ A;  1VZU A;  5EIY A;  1TDT A;  2P2O A;  2V0H A;  5BXC A;  2Y6P A;  5CMI A;  1H4D A;  2WVM A;  4KC4 A;  3TV0 A;  2Z86 A;  4M9C A;  4DE7 A;  3D98 A;  2WEE A;  4LW6 A;  3VBP A;  2AM4 A;  4M98 A;  2VK9 A;  4FRB A;  3HSQ A;  1G95 A;  3DUV A;  3ZGF A;  3FWW A;  1VIC A;  3F1Y A;  4AYL A;  3JQY A;  3P1B A;  1FGX A;  4AA7 A;  4HO2 A;  4J18 A;  1OMX A;  2I7B A;  3BXY A;  1YP3 A;  1HV9 A;  1QG8 A;  1NMM B;  4IRQ A;  1NQI B;  1PZY B;  1V84 A;  4ZDQ A;  4HO5 A;  4E6U A;  1ZCY A;  2JF3 A;  2NXV A;  4G3Q A;  5AJP A;  4CJ8 A;  2ZU9 A;  1HM9 A;  4FCE A;  2WGZ A;  3RSB A;  1TW1 A;  2VXM A;  4KNR A;  4EA7 A;  4O6M A;  2PGY A;  5DG3 A;  1VPA A;  1WVC A;  1IIN A;  1H5R B;  4EE4 A;  3TZT A;  3DJ4 A;  3Q4S A;  2Y4K A;  5CQL X;  5C48 A;  2YES A;  4DCL A;  3I0L A;  4Y7F A;  5FTV A;  4D11 C;  2XAT A;  3TK8 A;  1FR9 A;  1ZDG A;  1R7X A;  1ZI5 A;  2P6W A;  4MYO A;  1VGZ A;  4G3P A;  4Y6U A;  3VNP A;  2IUA A;  4HUR A;  4FRL A;  4Q7C A;  4HOC A;  2RIT A;  1JYK A;  1YP2 A;  3NZ2 A;  1JV1 A;  2FYD B;  2X5Z A;  4HO6 A;  1H4C A;  1TVY A;  4HO0 A;  3D5N A;  3KWC A;  5E3R A;  2C0N A;  5E3Q A;  4ARW A;  1GX4 A;  1SSM A;  4N6B A;  2FY7 A;  4MIX A;  3Q7U A;  4YS8 A;  1H7Q A;  4B2X A;  2TDT A;  4E79 A;  1WSZ A;  1W55 A;  1VGW A;  1G2V A;  4UEG A;  3E25 A;  3K8E A;  2QIA A;  2XWN A;  5EJZ A;  1KK5 A;  2V0J A;  5CQO A;  3CKO A;  3JUK A;  5D92 A;  3SXE A;  5F42 A;  2AQ9 A;  3OAM A;  1LZ0 A;  1MR9 A;  2BO4 A;  3LW6 A;  3TQD A;  2I5E A;  4MFG A;  3ZLK A;  1MP3 A;  4K6R A;  2FYC B;  4IHH A;  1FWY A;  1NHE B;  4EE3 A;  1XZ6 A;  4FRH A;  3OKR A;  2DPW A;  3OH0 A;  1E5K A;  4JIS A;  1O0R A;  4KC2 A;  2VHE A;  2RJ8 A;  3CKJ A;  2E8B A;  1JV3 A;  4IRP A;  2IU9 A;  3U2V A;  2QKX A;  1ZJ2 A;  2JCO A;  3V90 A;  2FYA A;  2ICX A;  5AJO A;  1JVD A;  1HM8 A;  4E6T A;  4EEO A;  2PX7 A;  1GWW A;  1H7H A;  2NPO A;  5CMG X;  5C4F A;  1R7U A;  4HZC A;  4D48 A;  2OI6 A;  1GX0 A;  4EEA A;  1QWJ A;  3R1W A;  1FXO A;  1V3W A;  4HO8 A;  2Y4M A;  4R37 A;  1H5T B;  5FTS A;  4KT7 A;  3CKQ A;  2YC5 A;  3MC4 A;  1ON6 A;  3MQG A;  1SST A;  2RJ4 A;  5C36 A;  1ON8 A;  1G8O A;  1K4V A;  2X5S A;  5L6S A;  3IOJ A;  1MRL A;  1H4E A;  2RJ5 A;  2FYB A;  2V0I A;  3BCV A;  1ZJP A;  3NGW A;  1TZF A;  3U0Y A;  1QRL A;  1H7L A;  2AM5 A;  1WT0 A;  2Y7A A;  4EVW A;  1NWG B;  1KQA A;  2UX8 A;  4XWI A;  3R0S A;  2VSH A;  4FRD A;  4B4B A;  2ZU8 A;  4B2W A;  1QRM A;  1VGT A;  3BFP A;  4FRO A;  2Q4J A;  3R5A A;  1WT3 A;  2AES A;  1H5T A;  1XHD A;  4NAI A;  3OTZ A;  1G97 A;  1THJ A;  3RMW A;  2RIY A;  3CKN A;  2RJ7 A;  3SXA A;  5C1L A;  4HUS A;  4NAL A;  4Y7G A;  1G93 A;  3GUE A;  4Y6N A;  2JCK A;  1QRE A;  1SSQ A;  1ZJ1 A;  3TIO A;  1PZT A;  5CQN X;  5C47 A;  4ISX A;  3MQH A;  2V0K A;  2Z87 A;  5IFY A;  1EYR A;  1H5S C;  1QGQ A;  5CQP A;  3I3A A;  4EA8 A;  4HO9 A;  4H7O A;  3OH3 A;  3V0L A;  2RIZ A;  1FO8 A;  2AH9 A;  2VS4 A;  2WLE A;  1QRF A;  2E3D A;  3V0Q A;  3U0X A;  2XME A;  3USR A;  3U2T A;  2A8U A;  2BO6 A;  1ZJ3 A;  4BQH A;  4N6A A;  2WVK A;  3KWE A;  3R8Y A;  1H3M A;  2YQC A;  1YP4 A;  3SPT A;  2O1G A;  1NF5 B;  1O23 B;  4N27 A;  3CKV A;  2MZB A;  3CGX A;  1ZJ0 A;  4D0Z A;  1FOA A;  1ZI3 A;  4FIY A;  3EEV A;  1H5R A;  4EAA A;  4M2A A;  3D8V A;  3DK5 A;  1H7F A;  3GOS A;  1ZI1 A;  4FRM A;  2FFU A;  1KK4 A;  4KQL A;  4HCQ A;  4EA9 A;  4L41 C;  4DEC A;  2WLF A;  4Y7V A;  1HJL A;  3F1C A;  2J0A A;  3R3I A;  1H5S B;  1JYL A;  3FSC A;  1OQM B;  3R5C A;  4R7P A;  4FRE A;  4C2S A;  3TWD A;  2QH5 A;  1G9R A;  2YQS A;  2AGD A;  5C38 A;  1GQC A;  5C4B A;  3POL A;  3U2X A;  2JCL A;  1FO9 A;  4Y64 A;  4M2B A;  3VBL A;  4AYJ A;  1INI A;  5U2K A;  2ICY A;  3T7N A;  3R5B A;  3V4E A;  3SX3 A;  4CVH A;  4Y63 A;  3VBM A;  4HO4 A;  3BRK X;  2OI5 A;  2AEC A;  1YRO B;  2CU2 A;  1S4N A;  4E75 A;  4KXO A;  1LL2 A;  3V91 A;  2RJ0 A;  3T57 A;  1V82 A;  1LVW A;  3I0J A;  1QQ0 A;  3IXC A;  3FOQ A;  4EAB A;  5CMH A;  1IIM A;  3I0F A;  4NAK A;  5C3D A;  3I0K A;  2VFZ A;  3QVB A;  5IDS A;  2BO8 A;  3FS8 A;  3BSS A;  3DHO A;  5JQQ A;  3R2W A;  1H5S A;  5C1G A;  1KHR A;  2PGV A;  4D11 A;  1VZT A;  5C1H A;  2VS3 A;  3T7M A;  1VH3 A;  5ADX V;  2YQJ A;  2WVL A;  5AFU V;  3SXD A;  3GVD A;  3FSY A;  5DDT A;  3V0M A;  4KRV A;  3ST8 A;  5DEP A;  1H7E A;  4KC1 A;  2WAW A;  2XMH A;  3I0H A;  3OH2 A;  5FUH A;  1JVG A;  3KWD A;  1ZHJ A;  1R7V A;  3FSX A;  2XWM A;  3R3R A;  1MP4 A;  2APC A;  3K8D A;  2QGI A;  4G87 A;  1FR8 A;  1R7T A;  1ZCV A;  2JCJ A;  4FRA A;  4M99 A;  4O6N A;  2W0W A;  5C49 A;  3EG4 A;  1WT2 A;  2D0J A;  4IHG A;  3KIA A;  2RJ9 A;  1H7G A;  1R82 A;  3RMV A;  4EEM A;  3C8V A;  2VD4 A;  3VBJ A;  5ADX U;  2Y4J A;  2BO7 A;  5AFU U;  3EE5 A;  4M4K A;  5I1F A;  4NAN A;  4AC3 A;  3PMO A;  1V67 A;  3FTT A;  3I0C A;  5CMF X;  4HO3 A;  4KNX A;  5DEM A;  1KK6 A;  1ZCU A;  4ASJ A;  4AAW A;  2AE7 A;  5EJ1 A;  5HS2 A;  3SX7 A;  4HZD A;  4KPX A;  3VBI A;  4ASY A;  4M28 A;  3VBN A;  5FV9 A;  4FCU A;  2O1H A;  2WLG A;  4G3S A;  4EE5 A;  3E26 A;  4R36 A;  1MR7 A;  1S80 A;  2D7R A;  3SRT A;  2JF2 A;  4EQY A;  3FSB A;  1MP5 A;  2YCM A;  2I5K A;  5FU8 A;  3P47 A;  4GBP A;  3OH1 A;  1ZI4 A;  1GA8 A;  1WT1 A;  3F1X A;  3OH4 A;  3Q80 A;  3VBK A;  3V8Z A;  3OTM A;  5AJN A;  2OEF A;  2GGQ A;  1LZJ A;  2OI7 A;  1OMZ A;  2X65 A;  4B4G A;  5C8R A;  4B42 A;  2V0L A;  2O1F A;  3ECT A;  4D0T A;  1KRU A;  1LZ7 A;  2YC3 A;  3V0N A;  2XWL A;  1I52 A;  3I3X A;  4MND A;  3SXC A;  3TIS A;  1MC3 A;  2OEG A;  1KGT A;  2PA4 A;  4CJC A;  1INJ A;  1Z90 A;  4P00 A;  3HL3 A;  4J09 A;  4E1K A;  4N69 A;  1LL0 A;  2FFV A;  2WLC A;  5DDV A;  2RIX A;  3ZLL A;  1GWV A;  1VGU A;  1J2Z A;  2P73 A;  4DDZ A;  4MZU A;  1H7T A;  1KGQ A;  1VH1 A;  4FIX A;  1GQ9 A;  5D91 A;  3PKP A;  3I0I X;  1G3L A;  2ZU7 A;  2Y4L A;  5CQM X;  1QGS A;  1W57 A;  5FU0 A;  1G23 A;  3JUJ A;  3IOI A;  3O3P A;  3BSY A;  3N9W A;  1KRV A;  1LZI A;  3I0D A;  3V0P A;  5FYE A;  1QRG A;  4CJB A;  5C4D A;  5C4E A;  2VS5 A;  3OC9 A;  1FRW A;  4Y62 A;  2WLD A;  1NKH B;  4KPZ A;  4IHF A;  2RJ6 A;  3IOH A;  3OU9 A;  1FZW A;  5C3B A;  1ZJO A;  2QIV X;  1XHB A;  3SXG A;  1O7O A;  3I0E A;  2VXL A;  1FG5 N;  4B5B A;  1SS9 A;  4MYB A;  4ECM A;  2A8W A;  2RJ1 A;  1XAT A;  5C3A A;  5CMJ A;  5L6V A;  3PNN A;  2WE9 A;  2D7I A;  3OW5 A;  1VZX A;  3ZF8 A;  4B4M A;  4BMA A;  5E3P A;  2P72 A;  1KRR A;  2IU8 A;  2AM3 A;  3U2U A;  3SXB A;  4JD0 A;  1ZDF A;  1S4P A;  1T3D A;  4EEG A;  1G1L A;  3TDT A;  5J49 A;  3IGJ A;  1HJJ A;  1H5S D;  1R81 A;  4FQW A;  1ZIZ A;  3OUP A;  1ZCT A;  1EZI A;  1V83 A;  3JTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...