1V67A

Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferripyochelin binding protein
publication title Observation of a calcium-binding site in the gamma-class carbonic anhydrase from Pyrococcus horikoshii.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 65
structure length 173
sequence length 173
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1v67A00
1KHRA 4E75A 3FS8A 1V67A 3ST8A 3VBIA 3BSWA 1KK5A 2ICYA 3DHOA 2AQ9A 2GGQA 3KWDA 4J18A 3R5AA 3GUEA 4M9CA 3FTTA 3EH0A 2FKOA 2IU9A 2RIJA 4HURA 2V0JA 2I5KA 5DG3A 3R0SA 4FCEA 1MR7A 3BSSA 1QREA 4HCQA 1G95A 2OEGA 3NZ2A 4G3SA 2W0VA 3FSYA 3PMOA 1XATA 4HZCA 4KNXA 1SSMA 3KWCA 1S80A 2ICXA 1SSTA 4G3PA 1MRLA 3Q1XA 2TDTA 2JF3A 5ADXU 2V0HA 3T57A 3IGJA 3OW5A 3VBJA 4AC3A 1KRRA 1THJA 3DK5A 4KPZA 3MQGA 3TV0A 1KQAA 3KWEA 4M28A 3P1BA 3D98A 3R2WA 1YP2A 4M2AA 2QIAA 3VNPA 4AA7A 1KK6A 1YP3A 3GOSA 4MYOA 1FXJA 4EAAA 1YP4A 2WLFA 4EABA 3R1WA 3R5DA 1QRMA 4K6RA 4N6BA 5AFUV 3TWDA 3V4EA 3VBKA 2OI5A 4N69A 2VHEA 3R3IA 3FSBA 2JF2A 5DEMA 3JQYA 4H7OA 1HM8A 3BXYA 2IU8A 2WLCA 2OI6A 3TISA 3D8VA 2NPOA 3HJJA 1KGTA 3DJ4A 3VBLA 4EA8A 2W0WA 1HM9A 3F1XA 4EA7A 3R3RA 3HSQA 2V0LA 4R37A 4IHGA 4G87A 1TDTA 2Q4JA 1QRGA 1QRFA 2IC7A 1J2ZA 3EG4A 4EQYA 5ADXV 3IXCA 1Z90A 2WLGA 1KK4A 2WLDA 3ECTA 1V3WA 4KQLA 3TDTA 3I3AA 4AAWA 4N6AA 1MR9A 5AFUU 2P2OA 1HV9A 3GVDA 3VBMA 5L6VA 3OUPA 3P47A 4EA9A 4HUSA 2V0KA 5E3RA 1FWYA 2OEFA 2XATA 4R7PA 3MQHA 1KGQA 4R36A 3R5BA 4N27A 2OI7A 2VD4A 4EGGA 4G3QA 3OTZA 1QQ0A 4KPXA 4KNRA 4HZDA 4ISXA 3MC4A 4IHFA 3CJ8A 3R5CA 4M98A 3OU9A 3VBPA 4DCLA 2GGOA 4E79A 1HM0A 2V0IA 2QIVX 2QKXA 3BSYA 1KRVA 3C8VA 3I3XA 1T3DA 1XHDA 5F42A 5E3PA 3SRTA 3TIOA 4MFGA 3BRKX 3FOQA 3VBNA 3SPTA 4E6UA 3FWWA 4M2BA 3TK8A 1QRLA 4M99A 4MZUA 4E1KA 3EEVA 4E6TA 5DEPA 5L6SA 3R8YA 5U2KA 4J09A 3FSCA 3OTMA 1OCXA 5E3QA 4IHHA 3BFPA 1SSQA 1LXAA 3FSXA 1KRUA 2WLEA 1G97A 2IUAA
chains in the Genus database with same CATH superfamily
1KHRA 4E75A 3FS8A 1V67A 3ST8A 3VBIA 3BSWA 1KK5A 2ICYA 3DHOA 2AQ9A 2GGQA 3KWDA 4J18A 3R5AA 3GUEA 4M9CA 3FTTA 3EH0A 2FKOA 2IU9A 2RIJA 4HURA 3GQ8A 2V0JA 1N4IA 2I5KA 5DG3A 3R0SA 4FCEA 1MR7A 3BSSA 1QREA 4HCQA 1G95A 3OH3A 3OH0A 2OEGA 3NZ2A 4G3SA 2W0VA 3FSYA 3PMOA 1XATA 4HZCA 4KNXA 1SSMA 3SUCA 3KWCA 1S80A 2ICXA 1SSTA 4G3PA 1MRLA 3Q1XA 2TDTA 2JF3A 5ADXU 2V0HA 3T57A 3IGJA 3OW5A 3VBJA 4AC3A 1KRRA 1THJA 1Z2FA 3DK5A 3MQGA 4KPZA 3TV0A 1KQAA 3KWEA 4M28A 3P1BA 3D98A 3R2WA 1YP2A 4M2AA 2QIAA 3GQ7A 3VNPA 4AA7A 1KK6A 1YP3A 3GOSA 4MYOA 1FXJA 4EAAA 1YP4A 2WLFA 4EABA 3R1WA 3R5DA 1QRMA 4K6RA 4N6BA 5AFUV 3TWDA 3V4EA 3VBKA 2OI5A 4N69A 2VHEA 3R3IA 3FSBA 2JF2A 5DEMA 3JQYA 4H7OA 1HM8A 3BXYA 2IU8A 2WLCA 2OI6A 3TISA 3D8VA 2NPOA 3HJJA 1KGTA 3DJ4A 3VBLA 4EA8A 2W0WA 1HM9A 3F1XA 4EA7A 3R3RA 3HSQA 2V0LA 3GQ9A 4R37A 4IHGA 4G87A 1TDTA 2Q4JA 1QRGA 1QRFA 2IC7A 1J2ZA 3EG4A 4EQYA 5ADXV 3IXCA 1EWWA 1Z90A 2WLGA 1KK4A 2WLDA 3ECTA 1V3WA 4KQLA 3TDTA 3I3AA 4AAWA 4N6AA 1MR9A 5AFUU 2P2OA 3OH4A 3GVDA 3VBMA 1HV9A 5L6VA 3OUPA 3P47A 4EA9A 4HUSA 2V0KA 5E3RA 1FWYA 2OEFA 2XATA 3OH2A 4R7PA 3MQHA 1KGQA 4R36A 3R5BA 4N27A 2OI7A 2VD4A 4EGGA 4G3QA 3OTZA 1QQ0A 4KPXA 4KNRA 4HZDA 4ISXA 3MC4A 1L0SA 4IHFA 3CJ8A 3R5CA 4M98A 3OU9A 3VBPA 4DCLA 2GGOA 4E79A 1HM0A 2V0IA 2QIVX 2QKXA 3BSYA 1KRVA 3C8VA 3I3XA 1T3DA 1XHDA 5F42A 5E3PA 3SRTA 3TIOA 4MFGA 3BRKX 3FOQA 3VBNA 3SPTA 4E6UA 3FWWA 4M2BA 3TK8A 1QRLA 4M99A 3OH1A 4MZUA 4E1KA 3EEVA 4E6TA 5DEPA 5L6SA 3OGZA 3R8YA 5U2KA 4J09A 3FSCA 1M8NA 3OTMA 1OCXA 5E3QA 4IHHA 3BFPA 1SSQA 1LXAA 3FSXA 1KRUA 2WLEA 3GQAA 1G97A 2IUAA
chains in the Genus database with same CATH topology
1KHRA 4E75A 3FS8A 1V67A 3ST8A 3VBIA 3BSWA 1KK5A 2ICYA 3DHOA 2AQ9A 2GGQA 3KWDA 4J18A 3R5AA 3GUEA 4M9CA 3FTTA 3EH0A 2FKOA 2IU9A 2RIJA 4HURA 2V0JA 2I5KA 5DG3A 3R0SA 4FCEA 1MR7A 3BSSA 1QREA 4HCQA 1G95A 2OEGA 3NZ2A 4G3SA 2W0VA 3FSYA 3PMOA 1XATA 4HZCA 4KNXA 1SSMA 3KWCA 1S80A 2ICXA 1SSTA 4G3PA 1MRLA 3Q1XA 2TDTA 2JF3A 5ADXU 2V0HA 3T57A 3IGJA 3OW5A 3VBJA 4AC3A 1KRRA 1THJA 3DK5A 4KPZA 3MQGA 3TV0A 1KQAA 3KWEA 4M28A 3P1BA 3D98A 3R2WA 1YP2A 4M2AA 2QIAA 3VNPA 4AA7A 1KK6A 1YP3A 3GOSA 4MYOA 1FXJA 4EAAA 1YP4A 2WLFA 4EABA 3R1WA 3R5DA 1QRMA 4K6RA 4N6BA 5AFUV 3TWDA 3V4EA 3VBKA 2OI5A 4N69A 2VHEA 3R3IA 3FSBA 2JF2A 5DEMA 3JQYA 4H7OA 1HM8A 3BXYA 2IU8A 2WLCA 2OI6A 3TISA 3D8VA 2NPOA 3HJJA 1KGTA 3DJ4A 3VBLA 4EA8A 2W0WA 1HM9A 3F1XA 4EA7A 3R3RA 3HSQA 2V0LA 4R37A 4IHGA 4G87A 1TDTA 2Q4JA 1QRGA 1QRFA 2IC7A 1J2ZA 3EG4A 4EQYA 5ADXV 3IXCA 1Z90A 2WLGA 1KK4A 2WLDA 3ECTA 1V3WA 4KQLA 3TDTA 3I3AA 4AAWA 4N6AA 1MR9A 5AFUU 2P2OA 1HV9A 3GVDA 3VBMA 5L6VA 3OUPA 3P47A 4EA9A 4HUSA 2V0KA 5E3RA 1FWYA 2OEFA 2XATA 4R7PA 3MQHA 1KGQA 4R36A 3R5BA 4N27A 2OI7A 2VD4A 4EGGA 4G3QA 3OTZA 1QQ0A 4KPXA 4KNRA 4HZDA 4ISXA 3MC4A 4IHFA 3CJ8A 3R5CA 4M98A 3OU9A 3VBPA 4DCLA 2GGOA 4E79A 1HM0A 2V0IA 2QIVX 2QKXA 3BSYA 1KRVA 3C8VA 3I3XA 1T3DA 1XHDA 5F42A 5E3PA 3SRTA 3TIOA 4MFGA 3BRKX 3FOQA 3VBNA 3SPTA 4E6UA 3FWWA 4M2BA 3TK8A 1QRLA 4M99A 4MZUA 4E1KA 3EEVA 4E6TA 5DEPA 5L6SA 3R8YA 5U2KA 4J09A 3FSCA 3OTMA 1OCXA 5E3QA 4IHHA 3BFPA 1SSQA 1LXAA 3FSXA 1KRUA 2WLEA 1G97A 2IUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHR A;  4E75 A;  3FS8 A;  1V67 A;  3ST8 A;  3VBI A;  3BSW A;  1KK5 A;  2ICY A;  3DHO A;  2AQ9 A;  2GGQ A;  3KWD A;  4J18 A;  3R5A A;  3GUE A;  4M9C A;  3FTT A;  3EH0 A;  2FKO A;  2IU9 A;  2RIJ A;  4HUR A;  2V0J A;  2I5K A;  5DG3 A;  3R0S A;  4FCE A;  1MR7 A;  3BSS A;  1QRE A;  4HCQ A;  1G95 A;  2OEG A;  3NZ2 A;  4G3S A;  2W0V A;  3FSY A;  3PMO A;  1XAT A;  4HZC A;  4KNX A;  1SSM A;  3KWC A;  1S80 A;  2ICX A;  1SST A;  4G3P A;  1MRL A;  3Q1X A;  2TDT A;  2JF3 A;  5ADX U;  2V0H A;  3T57 A;  3IGJ A;  3OW5 A;  3VBJ A;  4AC3 A;  1KRR A;  1THJ A;  3DK5 A;  4KPZ A;  3MQG A;  3TV0 A;  1KQA A;  3KWE A;  4M28 A;  3P1B A;  3D98 A;  3R2W A;  1YP2 A;  4M2A A;  2QIA A;  3VNP A;  4AA7 A;  1KK6 A;  1YP3 A;  3GOS A;  4MYO A;  1FXJ A;  4EAA A;  1YP4 A;  2WLF A;  4EAB A;  3R1W A;  3R5D A;  1QRM A;  4K6R A;  4N6B A;  5AFU V;  3TWD A;  3V4E A;  3VBK A;  2OI5 A;  4N69 A;  2VHE A;  3R3I A;  3FSB A;  2JF2 A;  5DEM A;  3JQY A;  4H7O A;  1HM8 A;  3BXY A;  2IU8 A;  2WLC A;  2OI6 A;  3TIS A;  3D8V A;  2NPO A;  3HJJ A;  1KGT A;  3DJ4 A;  3VBL A;  4EA8 A;  2W0W A;  1HM9 A;  3F1X A;  4EA7 A;  3R3R A;  3HSQ A;  2V0L A;  4R37 A;  4IHG A;  4G87 A;  1TDT A;  2Q4J A;  1QRG A;  1QRF A;  2IC7 A;  1J2Z A;  3EG4 A;  4EQY A;  5ADX V;  3IXC A;  1Z90 A;  2WLG A;  1KK4 A;  2WLD A;  3ECT A;  1V3W A;  4KQL A;  3TDT A;  3I3A A;  4AAW A;  4N6A A;  1MR9 A;  5AFU U;  2P2O A;  1HV9 A;  3GVD A;  3VBM A;  5L6V A;  3OUP A;  3P47 A;  4EA9 A;  4HUS A;  2V0K A;  5E3R A;  1FWY A;  2OEF A;  2XAT A;  4R7P A;  3MQH A;  1KGQ A;  4R36 A;  3R5B A;  4N27 A;  2OI7 A;  2VD4 A;  4EGG A;  4G3Q A;  3OTZ A;  1QQ0 A;  4KPX A;  4KNR A;  4HZD A;  4ISX A;  3MC4 A;  4IHF A;  3CJ8 A;  3R5C A;  4M98 A;  3OU9 A;  3VBP A;  4DCL A;  2GGO A;  4E79 A;  1HM0 A;  2V0I A;  2QIV X;  2QKX A;  3BSY A;  1KRV A;  3C8V A;  3I3X A;  1T3D A;  1XHD A;  5F42 A;  5E3P A;  3SRT A;  3TIO A;  4MFG A;  3BRK X;  3FOQ A;  3VBN A;  3SPT A;  4E6U A;  3FWW A;  4M2B A;  3TK8 A;  1QRL A;  4M99 A;  4MZU A;  4E1K A;  3EEV A;  4E6T A;  5DEP A;  5L6S A;  3R8Y A;  5U2K A;  4J09 A;  3FSC A;  3OTM A;  1OCX A;  5E3Q A;  4IHH A;  3BFP A;  1SSQ A;  1LXA A;  3FSX A;  1KRU A;  2WLE A;  1G97 A;  2IUA A; 
#chains in the Genus database with same CATH topology
 1KHR A;  4E75 A;  3FS8 A;  1V67 A;  3ST8 A;  3VBI A;  3BSW A;  1KK5 A;  2ICY A;  3DHO A;  2AQ9 A;  2GGQ A;  3KWD A;  4J18 A;  3R5A A;  3GUE A;  4M9C A;  3FTT A;  3EH0 A;  2FKO A;  2IU9 A;  2RIJ A;  4HUR A;  3GQ8 A;  2V0J A;  1N4I A;  2I5K A;  5DG3 A;  3R0S A;  4FCE A;  1MR7 A;  3BSS A;  1QRE A;  4HCQ A;  1G95 A;  3OH3 A;  3OH0 A;  2OEG A;  3NZ2 A;  4G3S A;  2W0V A;  3FSY A;  3PMO A;  1XAT A;  4HZC A;  4KNX A;  1SSM A;  3SUC A;  3KWC A;  1S80 A;  2ICX A;  1SST A;  4G3P A;  1MRL A;  3Q1X A;  2TDT A;  2JF3 A;  5ADX U;  2V0H A;  3T57 A;  3IGJ A;  3OW5 A;  3VBJ A;  4AC3 A;  1KRR A;  1THJ A;  1Z2F A;  3DK5 A;  3MQG A;  4KPZ A;  3TV0 A;  1KQA A;  3KWE A;  4M28 A;  3P1B A;  3D98 A;  3R2W A;  1YP2 A;  4M2A A;  2QIA A;  3GQ7 A;  3VNP A;  4AA7 A;  1KK6 A;  1YP3 A;  3GOS A;  4MYO A;  1FXJ A;  4EAA A;  1YP4 A;  2WLF A;  4EAB A;  3R1W A;  3R5D A;  1QRM A;  4K6R A;  4N6B A;  5AFU V;  3TWD A;  3V4E A;  3VBK A;  2OI5 A;  4N69 A;  2VHE A;  3R3I A;  3FSB A;  2JF2 A;  5DEM A;  3JQY A;  4H7O A;  1HM8 A;  3BXY A;  2IU8 A;  2WLC A;  2OI6 A;  3TIS A;  3D8V A;  2NPO A;  3HJJ A;  1KGT A;  3DJ4 A;  3VBL A;  4EA8 A;  2W0W A;  1HM9 A;  3F1X A;  4EA7 A;  3R3R A;  3HSQ A;  2V0L A;  3GQ9 A;  4R37 A;  4IHG A;  4G87 A;  1TDT A;  2Q4J A;  1QRG A;  1QRF A;  2IC7 A;  1J2Z A;  3EG4 A;  4EQY A;  5ADX V;  3IXC A;  1EWW A;  1Z90 A;  2WLG A;  1KK4 A;  2WLD A;  3ECT A;  1V3W A;  4KQL A;  3TDT A;  3I3A A;  4AAW A;  4N6A A;  1MR9 A;  5AFU U;  2P2O A;  3OH4 A;  3GVD A;  3VBM A;  1HV9 A;  5L6V A;  3OUP A;  3P47 A;  4EA9 A;  4HUS A;  2V0K A;  5E3R A;  1FWY A;  2OEF A;  2XAT A;  3OH2 A;  4R7P A;  3MQH A;  1KGQ A;  4R36 A;  3R5B A;  4N27 A;  2OI7 A;  2VD4 A;  4EGG A;  4G3Q A;  3OTZ A;  1QQ0 A;  4KPX A;  4KNR A;  4HZD A;  4ISX A;  3MC4 A;  1L0S A;  4IHF A;  3CJ8 A;  3R5C A;  4M98 A;  3OU9 A;  3VBP A;  4DCL A;  2GGO A;  4E79 A;  1HM0 A;  2V0I A;  2QIV X;  2QKX A;  3BSY A;  1KRV A;  3C8V A;  3I3X A;  1T3D A;  1XHD A;  5F42 A;  5E3P A;  3SRT A;  3TIO A;  4MFG A;  3BRK X;  3FOQ A;  3VBN A;  3SPT A;  4E6U A;  3FWW A;  4M2B A;  3TK8 A;  1QRL A;  4M99 A;  3OH1 A;  4MZU A;  4E1K A;  3EEV A;  4E6T A;  5DEP A;  5L6S A;  3OGZ A;  3R8Y A;  5U2K A;  4J09 A;  3FSC A;  1M8N A;  3OTM A;  1OCX A;  5E3Q A;  4IHH A;  3BFP A;  1SSQ A;  1LXA A;  3FSX A;  1KRU A;  2WLE A;  3GQA A;  1G97 A;  2IUA A; 
#chains in the Genus database with same CATH homology
 1KHR A;  4E75 A;  3FS8 A;  1V67 A;  3ST8 A;  3VBI A;  3BSW A;  1KK5 A;  2ICY A;  3DHO A;  2AQ9 A;  2GGQ A;  3KWD A;  4J18 A;  3R5A A;  3GUE A;  4M9C A;  3FTT A;  3EH0 A;  2FKO A;  2IU9 A;  2RIJ A;  4HUR A;  2V0J A;  2I5K A;  5DG3 A;  3R0S A;  4FCE A;  1MR7 A;  3BSS A;  1QRE A;  4HCQ A;  1G95 A;  2OEG A;  3NZ2 A;  4G3S A;  2W0V A;  3FSY A;  3PMO A;  1XAT A;  4HZC A;  4KNX A;  1SSM A;  3KWC A;  1S80 A;  2ICX A;  1SST A;  4G3P A;  1MRL A;  3Q1X A;  2TDT A;  2JF3 A;  5ADX U;  2V0H A;  3T57 A;  3IGJ A;  3OW5 A;  3VBJ A;  4AC3 A;  1KRR A;  1THJ A;  3DK5 A;  4KPZ A;  3MQG A;  3TV0 A;  1KQA A;  3KWE A;  4M28 A;  3P1B A;  3D98 A;  3R2W A;  1YP2 A;  4M2A A;  2QIA A;  3VNP A;  4AA7 A;  1KK6 A;  1YP3 A;  3GOS A;  4MYO A;  1FXJ A;  4EAA A;  1YP4 A;  2WLF A;  4EAB A;  3R1W A;  3R5D A;  1QRM A;  4K6R A;  4N6B A;  5AFU V;  3TWD A;  3V4E A;  3VBK A;  2OI5 A;  4N69 A;  2VHE A;  3R3I A;  3FSB A;  2JF2 A;  5DEM A;  3JQY A;  4H7O A;  1HM8 A;  3BXY A;  2IU8 A;  2WLC A;  2OI6 A;  3TIS A;  3D8V A;  2NPO A;  3HJJ A;  1KGT A;  3DJ4 A;  3VBL A;  4EA8 A;  2W0W A;  1HM9 A;  3F1X A;  4EA7 A;  3R3R A;  3HSQ A;  2V0L A;  4R37 A;  4IHG A;  4G87 A;  1TDT A;  2Q4J A;  1QRG A;  1QRF A;  2IC7 A;  1J2Z A;  3EG4 A;  4EQY A;  5ADX V;  3IXC A;  1Z90 A;  2WLG A;  1KK4 A;  2WLD A;  3ECT A;  1V3W A;  4KQL A;  3TDT A;  3I3A A;  4AAW A;  4N6A A;  1MR9 A;  5AFU U;  2P2O A;  1HV9 A;  3GVD A;  3VBM A;  5L6V A;  3OUP A;  3P47 A;  4EA9 A;  4HUS A;  2V0K A;  5E3R A;  1FWY A;  2OEF A;  2XAT A;  4R7P A;  3MQH A;  1KGQ A;  4R36 A;  3R5B A;  4N27 A;  2OI7 A;  2VD4 A;  4EGG A;  4G3Q A;  3OTZ A;  1QQ0 A;  4KPX A;  4KNR A;  4HZD A;  4ISX A;  3MC4 A;  4IHF A;  3CJ8 A;  3R5C A;  4M98 A;  3OU9 A;  3VBP A;  4DCL A;  2GGO A;  4E79 A;  1HM0 A;  2V0I A;  2QIV X;  2QKX A;  3BSY A;  1KRV A;  3C8V A;  3I3X A;  1T3D A;  1XHD A;  5F42 A;  5E3P A;  3SRT A;  3TIO A;  4MFG A;  3BRK X;  3FOQ A;  3VBN A;  3SPT A;  4E6U A;  3FWW A;  4M2B A;  3TK8 A;  1QRL A;  4M99 A;  4MZU A;  4E1K A;  3EEV A;  4E6T A;  5DEP A;  5L6S A;  3R8Y A;  5U2K A;  4J09 A;  3FSC A;  3OTM A;  1OCX A;  5E3Q A;  4IHH A;  3BFP A;  1SSQ A;  1LXA A;  3FSX A;  1KRU A;  2WLE A;  1G97 A;  2IUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...