3EEVA

Crystal structure of chloramphenicol acetyltransferase vca0300 from vibrio cholerae o1 biovar eltor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
NFFTSPFSGIPLDQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYQDNDNFADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWWNWPESWLKESMQSLCSSDIEGLYLNWQSKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chloramphenicol acetyltransferase
publication title Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 65
structure length 207
sequence length 207
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eevA00
4M9CA 1MRLA 3P47A 3V4EA 5AFUU 2V0KA 2V0LA 1SSMA 1KK6A 3FS8A 2OI5A 3OTZA 4MYOA 1KGQA 2XATA 3MQGA 3GVDA 4HURA 3IGJA 1YP2A 4IHFA 3KWEA 3FSBA 1SSTA 2TDTA 3MQHA 2IC7A 2IU8A 4AAWA 2W0VA 4J09A 1KK4A 1LXAA 3R3IA 3TV0A 4IHHA 3BFPA 4EA7A 1YP3A 3CJ8A 4EAAA 3R5CA 3ECTA 1XATA 2ICXA 1TDTA 4K6RA 2VHEA 3NZ2A 4EABA 3EG4A 4HZDA 2OEGA 2RIJA 1HM8A 5DEPA 3T57A 1T3DA 1V3WA 3SPTA 3BSSA 2QKXA 1QRGA 1THJA 2WLDA 1QRFA 3R5AA 2QIVX 2WLCA 3R5BA 3C8VA 4R7PA 4KNXA 4G3QA 5AFUV 4R36A 1HV9A 1KQAA 3SRTA 2IU9A 3Q1XA 3VBNA 5E3PA 1KRRA 2Q4JA 3I3XA 1QRLA 1YP4A 3OTMA 4N6BA 5ADXV 1SSQA 4IHGA 5U2KA 3DK5A 3VBIA 1V67A 1KK5A 3KWDA 3DJ4A 2I5KA 5DEMA 5L6VA 1FWYA 3OU9A 3R8YA 2FKOA 3VNPA 4HUSA 4MZUA 2ICYA 3HSQA 3I3AA 3R3RA 3R1WA 1KGTA 4G3PA 4M2AA 1G95A 2V0IA 4H7OA 5L6SA 3TK8A 1HM0A 4KPXA 3D8VA 4G3SA 3F1XA 4G87A 4AA7A 2JF3A 3FSXA 3VBMA 4E6UA 3MC4A 4N6AA 1KRVA 2OI6A 4FCEA 4E6TA 4HZCA 4M28A 1KHRA 3JQYA 3FSCA 2IUAA 1MR7A 1S80A 1OCXA 3EH0A 1Z90A 4KNRA 3KWCA 3R5DA 3OW5A 4EA9A 3FSYA 3TIOA 3FTTA 3IXCA 3VBPA 1G97A 3TISA 4EQYA 4KPZA 2GGOA 4MFGA 1MR9A 3D98A 3DHOA 4M98A 2OI7A 3TWDA 3GOSA 4M99A 3R2WA 3TDTA 3OUPA 4E79A 1QRMA 1KRUA 4HCQA 4R37A 4KQLA 2WLEA 4ISXA 3R0SA 4DCLA 5E3QA 2V0HA 2NPOA 2WLFA 3BXYA 1QREA 5ADXU 4N27A 3BRKX 3FOQA 3BSYA 3GUEA 2VD4A 1FXJA 2WLGA 3ST8A 3VBLA 4AC3A 3PMOA 3BSWA 3VBJA 1QQ0A 4N69A 3VBKA 4EA8A 4M2BA 2GGQA 2JF2A 3EEVA 4J18A 2V0JA 2W0WA 2AQ9A 4EGGA 2OEFA 1J2ZA 1XHDA 5F42A 5DG3A 4E1KA 5E3RA 3P1BA 1HM9A 2P2OA 4E75A 2QIAA 3HJJA 3FWWA
chains in the Genus database with same CATH superfamily
4M9CA 1MRLA 3P47A 3OH0A 3V4EA 2V0KA 5AFUU 2V0LA 1SSMA 1KK6A 3FS8A 2OI5A 3GQAA 3OTZA 4MYOA 1KGQA 2XATA 3MQGA 3GVDA 4HURA 3IGJA 1YP2A 4IHFA 3KWEA 3FSBA 1SSTA 2TDTA 3MQHA 2IC7A 2IU8A 4AAWA 2W0VA 4J09A 1KK4A 1LXAA 3R3IA 3TV0A 4IHHA 3BFPA 4EA7A 1YP3A 3CJ8A 4EAAA 3R5CA 3ECTA 1XATA 2ICXA 1TDTA 4K6RA 2VHEA 3NZ2A 4EABA 3EG4A 4HZDA 2OEGA 2RIJA 3OGZA 1HM8A 5DEPA 3T57A 1T3DA 1V3WA 3SPTA 1M8NA 3BSSA 2QKXA 1QRGA 1THJA 2WLDA 1QRFA 3R5AA 2QIVX 2WLCA 3GQ8A 3R5BA 3C8VA 4R7PA 3GQ9A 4KNXA 4G3QA 5AFUV 4R36A 1HV9A 3OH3A 3OH1A 1KQAA 3SRTA 2IU9A 3Q1XA 3VBNA 5E3PA 1KRRA 2Q4JA 3I3XA 1QRLA 1YP4A 3OTMA 4N6BA 5ADXV 1SSQA 4IHGA 5U2KA 3DK5A 3VBIA 1V67A 1KK5A 3KWDA 3DJ4A 2I5KA 1N4IA 5DEMA 5L6VA 1FWYA 3OU9A 3R8YA 2FKOA 3VNPA 4HUSA 4MZUA 2ICYA 3HSQA 3I3AA 3R3RA 3R1WA 1KGTA 4G3PA 4M2AA 1G95A 2V0IA 4H7OA 5L6SA 3TK8A 1HM0A 4KPXA 3D8VA 4G3SA 3F1XA 4G87A 4AA7A 2JF3A 3FSXA 3VBMA 4E6UA 3MC4A 4N6AA 1KRVA 2OI6A 4FCEA 4E6TA 4HZCA 4M28A 1KHRA 3JQYA 3FSCA 2IUAA 1MR7A 1S80A 1OCXA 3EH0A 1Z90A 4KNRA 3KWCA 3R5DA 3OW5A 4EA9A 1Z2FA 3FSYA 3TIOA 3FTTA 3IXCA 3VBPA 1G97A 3TISA 4EQYA 4KPZA 2GGOA 4MFGA 1MR9A 3D98A 3DHOA 4M98A 2OI7A 3TWDA 3GOSA 4M99A 3R2WA 3TDTA 3OUPA 4E79A 1QRMA 1KRUA 4HCQA 4R37A 4KQLA 2WLEA 4ISXA 3R0SA 4DCLA 5E3QA 2V0HA 2NPOA 2WLFA 3BXYA 1QREA 3OH4A 5ADXU 4N27A 3BRKX 3FOQA 3BSYA 3GUEA 2VD4A 1FXJA 2WLGA 3ST8A 3VBLA 4AC3A 3PMOA 3BSWA 3VBJA 1QQ0A 3GQ7A 4N69A 3SUCA 3VBKA 3OH2A 1EWWA 4EA8A 4M2BA 2GGQA 2JF2A 3EEVA 4J18A 2V0JA 2W0WA 2AQ9A 4EGGA 2OEFA 1J2ZA 1XHDA 5F42A 5DG3A 4E1KA 1L0SA 5E3RA 3P1BA 1HM9A 2P2OA 4E75A 2QIAA 3HJJA 3FWWA
chains in the Genus database with same CATH topology
4M9CA 1MRLA 3P47A 3V4EA 5AFUU 2V0KA 2V0LA 1SSMA 1KK6A 3FS8A 2OI5A 3OTZA 4MYOA 1KGQA 2XATA 3MQGA 3GVDA 4HURA 3IGJA 1YP2A 4IHFA 3KWEA 3FSBA 1SSTA 2TDTA 3MQHA 2IC7A 2IU8A 4AAWA 2W0VA 4J09A 1KK4A 1LXAA 3R3IA 3TV0A 4IHHA 3BFPA 4EA7A 1YP3A 3CJ8A 4EAAA 3R5CA 3ECTA 1XATA 2ICXA 1TDTA 4K6RA 2VHEA 3NZ2A 4EABA 3EG4A 4HZDA 2OEGA 2RIJA 1HM8A 5DEPA 3T57A 1T3DA 1V3WA 3SPTA 3BSSA 2QKXA 1QRGA 1THJA 2WLDA 1QRFA 3R5AA 2QIVX 2WLCA 3R5BA 3C8VA 4R7PA 4KNXA 4G3QA 5AFUV 4R36A 1HV9A 1KQAA 3SRTA 2IU9A 3Q1XA 3VBNA 5E3PA 1KRRA 2Q4JA 3I3XA 1QRLA 1YP4A 3OTMA 4N6BA 5ADXV 1SSQA 4IHGA 5U2KA 3DK5A 3VBIA 1V67A 1KK5A 3KWDA 3DJ4A 2I5KA 5DEMA 5L6VA 1FWYA 3OU9A 3R8YA 2FKOA 3VNPA 4HUSA 4MZUA 2ICYA 3HSQA 3I3AA 3R3RA 3R1WA 1KGTA 4G3PA 4M2AA 1G95A 2V0IA 4H7OA 5L6SA 3TK8A 1HM0A 4KPXA 3D8VA 4G3SA 3F1XA 4G87A 4AA7A 2JF3A 3FSXA 3VBMA 4E6UA 3MC4A 4N6AA 1KRVA 2OI6A 4FCEA 4E6TA 4HZCA 4M28A 1KHRA 3JQYA 3FSCA 2IUAA 1MR7A 1S80A 1OCXA 3EH0A 1Z90A 4KNRA 3KWCA 3R5DA 3OW5A 4EA9A 3FSYA 3TIOA 3FTTA 3IXCA 3VBPA 1G97A 3TISA 4EQYA 4KPZA 2GGOA 4MFGA 1MR9A 3D98A 3DHOA 4M98A 2OI7A 3TWDA 3GOSA 4M99A 3R2WA 3TDTA 3OUPA 4E79A 1QRMA 1KRUA 4HCQA 4R37A 4KQLA 2WLEA 4ISXA 3R0SA 4DCLA 5E3QA 2V0HA 2NPOA 2WLFA 3BXYA 1QREA 5ADXU 4N27A 3BRKX 3FOQA 3BSYA 3GUEA 2VD4A 1FXJA 2WLGA 3ST8A 3VBLA 4AC3A 3PMOA 3BSWA 3VBJA 1QQ0A 4N69A 3VBKA 4EA8A 4M2BA 2GGQA 2JF2A 3EEVA 4J18A 2V0JA 2W0WA 2AQ9A 4EGGA 2OEFA 1J2ZA 1XHDA 5F42A 5DG3A 4E1KA 5E3RA 3P1BA 1HM9A 2P2OA 4E75A 2QIAA 3HJJA 3FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9C A;  1MRL A;  3P47 A;  3V4E A;  5AFU U;  2V0K A;  2V0L A;  1SSM A;  1KK6 A;  3FS8 A;  2OI5 A;  3OTZ A;  4MYO A;  1KGQ A;  2XAT A;  3MQG A;  3GVD A;  4HUR A;  3IGJ A;  1YP2 A;  4IHF A;  3KWE A;  3FSB A;  1SST A;  2TDT A;  3MQH A;  2IC7 A;  2IU8 A;  4AAW A;  2W0V A;  4J09 A;  1KK4 A;  1LXA A;  3R3I A;  3TV0 A;  4IHH A;  3BFP A;  4EA7 A;  1YP3 A;  3CJ8 A;  4EAA A;  3R5C A;  3ECT A;  1XAT A;  2ICX A;  1TDT A;  4K6R A;  2VHE A;  3NZ2 A;  4EAB A;  3EG4 A;  4HZD A;  2OEG A;  2RIJ A;  1HM8 A;  5DEP A;  3T57 A;  1T3D A;  1V3W A;  3SPT A;  3BSS A;  2QKX A;  1QRG A;  1THJ A;  2WLD A;  1QRF A;  3R5A A;  2QIV X;  2WLC A;  3R5B A;  3C8V A;  4R7P A;  4KNX A;  4G3Q A;  5AFU V;  4R36 A;  1HV9 A;  1KQA A;  3SRT A;  2IU9 A;  3Q1X A;  3VBN A;  5E3P A;  1KRR A;  2Q4J A;  3I3X A;  1QRL A;  1YP4 A;  3OTM A;  4N6B A;  5ADX V;  1SSQ A;  4IHG A;  5U2K A;  3DK5 A;  3VBI A;  1V67 A;  1KK5 A;  3KWD A;  3DJ4 A;  2I5K A;  5DEM A;  5L6V A;  1FWY A;  3OU9 A;  3R8Y A;  2FKO A;  3VNP A;  4HUS A;  4MZU A;  2ICY A;  3HSQ A;  3I3A A;  3R3R A;  3R1W A;  1KGT A;  4G3P A;  4M2A A;  1G95 A;  2V0I A;  4H7O A;  5L6S A;  3TK8 A;  1HM0 A;  4KPX A;  3D8V A;  4G3S A;  3F1X A;  4G87 A;  4AA7 A;  2JF3 A;  3FSX A;  3VBM A;  4E6U A;  3MC4 A;  4N6A A;  1KRV A;  2OI6 A;  4FCE A;  4E6T A;  4HZC A;  4M28 A;  1KHR A;  3JQY A;  3FSC A;  2IUA A;  1MR7 A;  1S80 A;  1OCX A;  3EH0 A;  1Z90 A;  4KNR A;  3KWC A;  3R5D A;  3OW5 A;  4EA9 A;  3FSY A;  3TIO A;  3FTT A;  3IXC A;  3VBP A;  1G97 A;  3TIS A;  4EQY A;  4KPZ A;  2GGO A;  4MFG A;  1MR9 A;  3D98 A;  3DHO A;  4M98 A;  2OI7 A;  3TWD A;  3GOS A;  4M99 A;  3R2W A;  3TDT A;  3OUP A;  4E79 A;  1QRM A;  1KRU A;  4HCQ A;  4R37 A;  4KQL A;  2WLE A;  4ISX A;  3R0S A;  4DCL A;  5E3Q A;  2V0H A;  2NPO A;  2WLF A;  3BXY A;  1QRE A;  5ADX U;  4N27 A;  3BRK X;  3FOQ A;  3BSY A;  3GUE A;  2VD4 A;  1FXJ A;  2WLG A;  3ST8 A;  3VBL A;  4AC3 A;  3PMO A;  3BSW A;  3VBJ A;  1QQ0 A;  4N69 A;  3VBK A;  4EA8 A;  4M2B A;  2GGQ A;  2JF2 A;  3EEV A;  4J18 A;  2V0J A;  2W0W A;  2AQ9 A;  4EGG A;  2OEF A;  1J2Z A;  1XHD A;  5F42 A;  5DG3 A;  4E1K A;  5E3R A;  3P1B A;  1HM9 A;  2P2O A;  4E75 A;  2QIA A;  3HJJ A;  3FWW A; 
#chains in the Genus database with same CATH topology
 4M9C A;  1MRL A;  3P47 A;  3OH0 A;  3V4E A;  2V0K A;  5AFU U;  2V0L A;  1SSM A;  1KK6 A;  3FS8 A;  2OI5 A;  3GQA A;  3OTZ A;  4MYO A;  1KGQ A;  2XAT A;  3MQG A;  3GVD A;  4HUR A;  3IGJ A;  1YP2 A;  4IHF A;  3KWE A;  3FSB A;  1SST A;  2TDT A;  3MQH A;  2IC7 A;  2IU8 A;  4AAW A;  2W0V A;  4J09 A;  1KK4 A;  1LXA A;  3R3I A;  3TV0 A;  4IHH A;  3BFP A;  4EA7 A;  1YP3 A;  3CJ8 A;  4EAA A;  3R5C A;  3ECT A;  1XAT A;  2ICX A;  1TDT A;  4K6R A;  2VHE A;  3NZ2 A;  4EAB A;  3EG4 A;  4HZD A;  2OEG A;  2RIJ A;  3OGZ A;  1HM8 A;  5DEP A;  3T57 A;  1T3D A;  1V3W A;  3SPT A;  1M8N A;  3BSS A;  2QKX A;  1QRG A;  1THJ A;  2WLD A;  1QRF A;  3R5A A;  2QIV X;  2WLC A;  3GQ8 A;  3R5B A;  3C8V A;  4R7P A;  3GQ9 A;  4KNX A;  4G3Q A;  5AFU V;  4R36 A;  1HV9 A;  3OH3 A;  3OH1 A;  1KQA A;  3SRT A;  2IU9 A;  3Q1X A;  3VBN A;  5E3P A;  1KRR A;  2Q4J A;  3I3X A;  1QRL A;  1YP4 A;  3OTM A;  4N6B A;  5ADX V;  1SSQ A;  4IHG A;  5U2K A;  3DK5 A;  3VBI A;  1V67 A;  1KK5 A;  3KWD A;  3DJ4 A;  2I5K A;  1N4I A;  5DEM A;  5L6V A;  1FWY A;  3OU9 A;  3R8Y A;  2FKO A;  3VNP A;  4HUS A;  4MZU A;  2ICY A;  3HSQ A;  3I3A A;  3R3R A;  3R1W A;  1KGT A;  4G3P A;  4M2A A;  1G95 A;  2V0I A;  4H7O A;  5L6S A;  3TK8 A;  1HM0 A;  4KPX A;  3D8V A;  4G3S A;  3F1X A;  4G87 A;  4AA7 A;  2JF3 A;  3FSX A;  3VBM A;  4E6U A;  3MC4 A;  4N6A A;  1KRV A;  2OI6 A;  4FCE A;  4E6T A;  4HZC A;  4M28 A;  1KHR A;  3JQY A;  3FSC A;  2IUA A;  1MR7 A;  1S80 A;  1OCX A;  3EH0 A;  1Z90 A;  4KNR A;  3KWC A;  3R5D A;  3OW5 A;  4EA9 A;  1Z2F A;  3FSY A;  3TIO A;  3FTT A;  3IXC A;  3VBP A;  1G97 A;  3TIS A;  4EQY A;  4KPZ A;  2GGO A;  4MFG A;  1MR9 A;  3D98 A;  3DHO A;  4M98 A;  2OI7 A;  3TWD A;  3GOS A;  4M99 A;  3R2W A;  3TDT A;  3OUP A;  4E79 A;  1QRM A;  1KRU A;  4HCQ A;  4R37 A;  4KQL A;  2WLE A;  4ISX A;  3R0S A;  4DCL A;  5E3Q A;  2V0H A;  2NPO A;  2WLF A;  3BXY A;  1QRE A;  3OH4 A;  5ADX U;  4N27 A;  3BRK X;  3FOQ A;  3BSY A;  3GUE A;  2VD4 A;  1FXJ A;  2WLG A;  3ST8 A;  3VBL A;  4AC3 A;  3PMO A;  3BSW A;  3VBJ A;  1QQ0 A;  3GQ7 A;  4N69 A;  3SUC A;  3VBK A;  3OH2 A;  1EWW A;  4EA8 A;  4M2B A;  2GGQ A;  2JF2 A;  3EEV A;  4J18 A;  2V0J A;  2W0W A;  2AQ9 A;  4EGG A;  2OEF A;  1J2Z A;  1XHD A;  5F42 A;  5DG3 A;  4E1K A;  1L0S A;  5E3R A;  3P1B A;  1HM9 A;  2P2O A;  4E75 A;  2QIA A;  3HJJ A;  3FWW A; 
#chains in the Genus database with same CATH homology
 4M9C A;  1MRL A;  3P47 A;  3V4E A;  5AFU U;  2V0K A;  2V0L A;  1SSM A;  1KK6 A;  3FS8 A;  2OI5 A;  3OTZ A;  4MYO A;  1KGQ A;  2XAT A;  3MQG A;  3GVD A;  4HUR A;  3IGJ A;  1YP2 A;  4IHF A;  3KWE A;  3FSB A;  1SST A;  2TDT A;  3MQH A;  2IC7 A;  2IU8 A;  4AAW A;  2W0V A;  4J09 A;  1KK4 A;  1LXA A;  3R3I A;  3TV0 A;  4IHH A;  3BFP A;  4EA7 A;  1YP3 A;  3CJ8 A;  4EAA A;  3R5C A;  3ECT A;  1XAT A;  2ICX A;  1TDT A;  4K6R A;  2VHE A;  3NZ2 A;  4EAB A;  3EG4 A;  4HZD A;  2OEG A;  2RIJ A;  1HM8 A;  5DEP A;  3T57 A;  1T3D A;  1V3W A;  3SPT A;  3BSS A;  2QKX A;  1QRG A;  1THJ A;  2WLD A;  1QRF A;  3R5A A;  2QIV X;  2WLC A;  3R5B A;  3C8V A;  4R7P A;  4KNX A;  4G3Q A;  5AFU V;  4R36 A;  1HV9 A;  1KQA A;  3SRT A;  2IU9 A;  3Q1X A;  3VBN A;  5E3P A;  1KRR A;  2Q4J A;  3I3X A;  1QRL A;  1YP4 A;  3OTM A;  4N6B A;  5ADX V;  1SSQ A;  4IHG A;  5U2K A;  3DK5 A;  3VBI A;  1V67 A;  1KK5 A;  3KWD A;  3DJ4 A;  2I5K A;  5DEM A;  5L6V A;  1FWY A;  3OU9 A;  3R8Y A;  2FKO A;  3VNP A;  4HUS A;  4MZU A;  2ICY A;  3HSQ A;  3I3A A;  3R3R A;  3R1W A;  1KGT A;  4G3P A;  4M2A A;  1G95 A;  2V0I A;  4H7O A;  5L6S A;  3TK8 A;  1HM0 A;  4KPX A;  3D8V A;  4G3S A;  3F1X A;  4G87 A;  4AA7 A;  2JF3 A;  3FSX A;  3VBM A;  4E6U A;  3MC4 A;  4N6A A;  1KRV A;  2OI6 A;  4FCE A;  4E6T A;  4HZC A;  4M28 A;  1KHR A;  3JQY A;  3FSC A;  2IUA A;  1MR7 A;  1S80 A;  1OCX A;  3EH0 A;  1Z90 A;  4KNR A;  3KWC A;  3R5D A;  3OW5 A;  4EA9 A;  3FSY A;  3TIO A;  3FTT A;  3IXC A;  3VBP A;  1G97 A;  3TIS A;  4EQY A;  4KPZ A;  2GGO A;  4MFG A;  1MR9 A;  3D98 A;  3DHO A;  4M98 A;  2OI7 A;  3TWD A;  3GOS A;  4M99 A;  3R2W A;  3TDT A;  3OUP A;  4E79 A;  1QRM A;  1KRU A;  4HCQ A;  4R37 A;  4KQL A;  2WLE A;  4ISX A;  3R0S A;  4DCL A;  5E3Q A;  2V0H A;  2NPO A;  2WLF A;  3BXY A;  1QRE A;  5ADX U;  4N27 A;  3BRK X;  3FOQ A;  3BSY A;  3GUE A;  2VD4 A;  1FXJ A;  2WLG A;  3ST8 A;  3VBL A;  4AC3 A;  3PMO A;  3BSW A;  3VBJ A;  1QQ0 A;  4N69 A;  3VBK A;  4EA8 A;  4M2B A;  2GGQ A;  2JF2 A;  3EEV A;  4J18 A;  2V0J A;  2W0W A;  2AQ9 A;  4EGG A;  2OEF A;  1J2Z A;  1XHD A;  5F42 A;  5DG3 A;  4E1K A;  5E3R A;  3P1B A;  1HM9 A;  2P2O A;  4E75 A;  2QIA A;  3HJJ A;  3FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...