3T57A

Activity and crystal structure of arabidopsis udp-n-acetylglucosamine acyltransferase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
288
structure length
288
Chain Sequence
LIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELYSVPAVSAMLQSIRDSFTESRRGICK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine O-acyltransferase domain-containing
publication title Activity and Crystal Structure of Arabidopsis thalianaUDP-N-Acetylglucosamine Acyltransferase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 114
structure length 288
sequence length 288
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 3t57A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3t57A01
2I5KA 3VBKA 2AQ9A 4E75A 2QKXA 1YP4A 5L6SA 4J18A 1KGTA 3DHOA 1KGQA 4KQLA 4R36A 3R5CA 3BSSA 4H7OA 2IU8A 3R5BA 2GGQA 3KWCA 2OI5A 3GUEA 3OUPA 3TV0A 2ICXA 3FSXA 3Q1XA 3SRTA 4N6BA 3HSQA 2VHEA 1LXAA 1TDTA 2W0VA 2GGOA 4E1KA 4MFGA 4KPZA 4KPXA 3HJJA 2OEGA 4E79A 2JF3A 1HM8A 3GOSA 2WLCA 3D98A 4HCQA 4HZDA 4M2BA 5E3RA 3VBJA 1G95A 4M28A 3VBIA 3ECTA 1J2ZA 1QRLA 4EA8A 3MQGA 3NZ2A 2V0IA 4IHFA 3VBLA 2Q4JA 3P47A 3DJ4A 3I3XA 3C8VA 2IUAA 4EA9A 3DK5A 4IHGA 1KQAA 3TK8A 1KHRA 1QQ0A 3EG4A 4MZUA 4K6RA 3R1WA 1Z90A 2IC7A 3FSYA 2NPOA 1SSMA 3P1BA 3TIOA 5E3QA 4M2AA 2OI7A 2V0KA 4M9CA 1KK6A 3IXCA 2QIVX 4FCEA 5L6VA 4N6AA 2RIJA 4R37A 3FOQA 3JQYA 3MQHA 3TWDA 4E6UA 1FXJA 1OCXA 3VBPA 5ADXU 1XATA 3EH0A 3R3IA 3CJ8A 1SSTA 2V0HA 4AA7A 1MR7A 3R0SA 3R5DA 1KRRA 2FKOA 5ADXV 3R5AA 3SPTA 4EA7A 4EGGA 3VBMA 5DEPA 2WLFA 3R3RA 3TISA 4E6TA 3BRKX 4HUSA 4KNRA 1MR9A 4KNXA 1V67A 4M99A 3R2WA 3R8YA 5E3PA 5DEMA 1MRLA 3EEVA 4G3SA 4EAAA 3OTZA 4G3PA 3KWDA 3FSBA 3OW5A 4AAWA 3OU9A 3MC4A 2TDTA 3BXYA 3KWEA 3TDTA 1SSQA 1HV9A 4M98A 2QIAA 1S80A 3BFPA 2VD4A 4G3QA 1KK4A 2WLDA 1HM0A 4J09A 1KRVA 2WLGA 4HZCA 4HURA 3D8VA 1XHDA 3PMOA 5AFUV 1KRUA 1KK5A 2IU9A 4R7PA 3BSWA 1FWYA 1HM9A 3FS8A 5DG3A 4G87A 1YP2A 3ST8A 3VBNA 3T57A 2OEFA 1V3WA 4DCLA 1QRMA 4AC3A 1YP3A 1T3DA 2XATA 5U2KA 2V0LA 2WLEA 3V4EA 2OI6A 3FTTA 1G97A 1QRFA 2V0JA 4EQYA 2ICYA 2W0WA 3F1XA 3IGJA 3OTMA 4IHHA 4N27A 4MYOA 3FWWA 1QREA 4EABA 3GVDA 1QRGA 3VNPA 3FSCA 4ISXA 2P2OA 2JF2A 3BSYA 3I3AA 5F42A 5AFUU 4N69A 1THJA
chains in the Genus database with same CATH superfamily
2I5KA 3OGZA 3VBKA 2AQ9A 4E75A 2QKXA 1YP4A 5L6SA 4J18A 3OH4A 1KGTA 3DHOA 1KGQA 4KQLA 4R36A 3R5CA 3BSSA 4H7OA 2IU8A 3R5BA 2GGQA 3KWCA 2OI5A 3GUEA 3OUPA 3TV0A 2ICXA 3FSXA 3GQAA 3Q1XA 3SRTA 4N6BA 3OH3A 3HSQA 2VHEA 1LXAA 1M8NA 1TDTA 2W0VA 2GGOA 4E1KA 4MFGA 4KPZA 4KPXA 3HJJA 2OEGA 4E79A 2JF3A 1HM8A 3GOSA 2WLCA 3D98A 4HCQA 4HZDA 4M2BA 5E3RA 3VBJA 1G95A 4M28A 3VBIA 3ECTA 1J2ZA 1QRLA 4EA8A 3MQGA 3NZ2A 2V0IA 4IHFA 3VBLA 2Q4JA 3P47A 3DJ4A 3I3XA 3C8VA 2IUAA 4EA9A 3DK5A 4IHGA 1KQAA 3TK8A 1KHRA 1QQ0A 3EG4A 4MZUA 4K6RA 3R1WA 1Z2FA 1Z90A 2IC7A 3FSYA 2NPOA 1L0SA 1SSMA 3P1BA 3TIOA 5E3QA 4M2AA 2OI7A 2V0KA 4M9CA 1KK6A 3IXCA 2QIVX 4FCEA 5L6VA 4N6AA 2RIJA 4R37A 3FOQA 3JQYA 3MQHA 3TWDA 4E6UA 1FXJA 1OCXA 3VBPA 5ADXU 1XATA 3EH0A 3R3IA 3CJ8A 1SSTA 2V0HA 4AA7A 1MR7A 3R0SA 3R5DA 1KRRA 2FKOA 5ADXV 3R5AA 3SPTA 4EA7A 4EGGA 3VBMA 5DEPA 2WLFA 3R3RA 3TISA 4E6TA 3BRKX 4HUSA 4KNRA 1MR9A 4KNXA 1V67A 4M99A 3R2WA 3R8YA 5E3PA 5DEMA 1MRLA 3EEVA 4G3SA 4EAAA 1EWWA 3OTZA 4G3PA 3KWDA 3FSBA 3OW5A 4AAWA 3OU9A 3MC4A 2TDTA 3BXYA 3KWEA 3TDTA 1SSQA 1HV9A 4M98A 2QIAA 1S80A 3BFPA 2VD4A 4G3QA 1KK4A 2WLDA 1HM0A 4J09A 1KRVA 2WLGA 4HZCA 4HURA 3D8VA 1XHDA 3PMOA 5AFUV 1KRUA 3OH0A 1KK5A 1N4IA 2IU9A 4R7PA 3BSWA 1FWYA 1HM9A 3FS8A 5DG3A 4G87A 1YP2A 3ST8A 3VBNA 3T57A 3GQ8A 2OEFA 1V3WA 4DCLA 1QRMA 4AC3A 1YP3A 1T3DA 2XATA 5U2KA 2V0LA 2WLEA 3V4EA 2OI6A 3GQ7A 3FTTA 1G97A 1QRFA 2V0JA 4EQYA 2ICYA 2W0WA 3F1XA 3IGJA 3OH1A 3OTMA 4IHHA 4N27A 4MYOA 3SUCA 3FWWA 1QREA 3GQ9A 4EABA 3GVDA 3OH2A 1QRGA 3VNPA 3FSCA 4ISXA 2P2OA 2JF2A 3BSYA 3I3AA 5F42A 5AFUU 4N69A 1THJA
chains in the Genus database with same CATH topology
2I5KA 3VBKA 2AQ9A 4E75A 2QKXA 1YP4A 5L6SA 4J18A 1KGTA 3DHOA 1KGQA 4KQLA 4R36A 3R5CA 3BSSA 4H7OA 2IU8A 3R5BA 2GGQA 3KWCA 2OI5A 3GUEA 3OUPA 3TV0A 2ICXA 3FSXA 3Q1XA 3SRTA 4N6BA 3HSQA 2VHEA 1LXAA 1TDTA 2W0VA 2GGOA 4E1KA 4MFGA 4KPZA 4KPXA 3HJJA 2OEGA 4E79A 2JF3A 1HM8A 3GOSA 2WLCA 3D98A 4HCQA 4HZDA 4M2BA 5E3RA 3VBJA 1G95A 4M28A 3VBIA 3ECTA 1J2ZA 1QRLA 4EA8A 3MQGA 3NZ2A 2V0IA 4IHFA 3VBLA 2Q4JA 3P47A 3DJ4A 3I3XA 3C8VA 2IUAA 4EA9A 3DK5A 4IHGA 1KQAA 3TK8A 1KHRA 1QQ0A 3EG4A 4MZUA 4K6RA 3R1WA 1Z90A 2IC7A 3FSYA 2NPOA 1SSMA 3P1BA 3TIOA 5E3QA 4M2AA 2OI7A 2V0KA 4M9CA 1KK6A 3IXCA 2QIVX 4FCEA 5L6VA 4N6AA 2RIJA 4R37A 3FOQA 3JQYA 3MQHA 3TWDA 4E6UA 1FXJA 1OCXA 3VBPA 5ADXU 1XATA 3EH0A 3R3IA 3CJ8A 1SSTA 2V0HA 4AA7A 1MR7A 3R0SA 3R5DA 1KRRA 2FKOA 5ADXV 3R5AA 3SPTA 4EA7A 4EGGA 3VBMA 5DEPA 2WLFA 3R3RA 3TISA 4E6TA 3BRKX 4HUSA 4KNRA 1MR9A 4KNXA 1V67A 4M99A 3R2WA 3R8YA 5E3PA 5DEMA 1MRLA 3EEVA 4G3SA 4EAAA 3OTZA 4G3PA 3KWDA 3FSBA 3OW5A 4AAWA 3OU9A 3MC4A 2TDTA 3BXYA 3KWEA 3TDTA 1SSQA 1HV9A 4M98A 2QIAA 1S80A 3BFPA 2VD4A 4G3QA 1KK4A 2WLDA 1HM0A 4J09A 1KRVA 2WLGA 4HZCA 4HURA 3D8VA 1XHDA 3PMOA 5AFUV 1KRUA 1KK5A 2IU9A 4R7PA 3BSWA 1FWYA 1HM9A 3FS8A 5DG3A 4G87A 1YP2A 3ST8A 3VBNA 3T57A 2OEFA 1V3WA 4DCLA 1QRMA 4AC3A 1YP3A 1T3DA 2XATA 5U2KA 2V0LA 2WLEA 3V4EA 2OI6A 3FTTA 1G97A 1QRFA 2V0JA 4EQYA 2ICYA 2W0WA 3F1XA 3IGJA 3OTMA 4IHHA 4N27A 4MYOA 3FWWA 1QREA 4EABA 3GVDA 1QRGA 3VNPA 3FSCA 4ISXA 2P2OA 2JF2A 3BSYA 3I3AA 5F42A 5AFUU 4N69A 1THJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5K A;  3VBK A;  2AQ9 A;  4E75 A;  2QKX A;  1YP4 A;  5L6S A;  4J18 A;  1KGT A;  3DHO A;  1KGQ A;  4KQL A;  4R36 A;  3R5C A;  3BSS A;  4H7O A;  2IU8 A;  3R5B A;  2GGQ A;  3KWC A;  2OI5 A;  3GUE A;  3OUP A;  3TV0 A;  2ICX A;  3FSX A;  3Q1X A;  3SRT A;  4N6B A;  3HSQ A;  2VHE A;  1LXA A;  1TDT A;  2W0V A;  2GGO A;  4E1K A;  4MFG A;  4KPZ A;  4KPX A;  3HJJ A;  2OEG A;  4E79 A;  2JF3 A;  1HM8 A;  3GOS A;  2WLC A;  3D98 A;  4HCQ A;  4HZD A;  4M2B A;  5E3R A;  3VBJ A;  1G95 A;  4M28 A;  3VBI A;  3ECT A;  1J2Z A;  1QRL A;  4EA8 A;  3MQG A;  3NZ2 A;  2V0I A;  4IHF A;  3VBL A;  2Q4J A;  3P47 A;  3DJ4 A;  3I3X A;  3C8V A;  2IUA A;  4EA9 A;  3DK5 A;  4IHG A;  1KQA A;  3TK8 A;  1KHR A;  1QQ0 A;  3EG4 A;  4MZU A;  4K6R A;  3R1W A;  1Z90 A;  2IC7 A;  3FSY A;  2NPO A;  1SSM A;  3P1B A;  3TIO A;  5E3Q A;  4M2A A;  2OI7 A;  2V0K A;  4M9C A;  1KK6 A;  3IXC A;  2QIV X;  4FCE A;  5L6V A;  4N6A A;  2RIJ A;  4R37 A;  3FOQ A;  3JQY A;  3MQH A;  3TWD A;  4E6U A;  1FXJ A;  1OCX A;  3VBP A;  5ADX U;  1XAT A;  3EH0 A;  3R3I A;  3CJ8 A;  1SST A;  2V0H A;  4AA7 A;  1MR7 A;  3R0S A;  3R5D A;  1KRR A;  2FKO A;  5ADX V;  3R5A A;  3SPT A;  4EA7 A;  4EGG A;  3VBM A;  5DEP A;  2WLF A;  3R3R A;  3TIS A;  4E6T A;  3BRK X;  4HUS A;  4KNR A;  1MR9 A;  4KNX A;  1V67 A;  4M99 A;  3R2W A;  3R8Y A;  5E3P A;  5DEM A;  1MRL A;  3EEV A;  4G3S A;  4EAA A;  3OTZ A;  4G3P A;  3KWD A;  3FSB A;  3OW5 A;  4AAW A;  3OU9 A;  3MC4 A;  2TDT A;  3BXY A;  3KWE A;  3TDT A;  1SSQ A;  1HV9 A;  4M98 A;  2QIA A;  1S80 A;  3BFP A;  2VD4 A;  4G3Q A;  1KK4 A;  2WLD A;  1HM0 A;  4J09 A;  1KRV A;  2WLG A;  4HZC A;  4HUR A;  3D8V A;  1XHD A;  3PMO A;  5AFU V;  1KRU A;  1KK5 A;  2IU9 A;  4R7P A;  3BSW A;  1FWY A;  1HM9 A;  3FS8 A;  5DG3 A;  4G87 A;  1YP2 A;  3ST8 A;  3VBN A;  3T57 A;  2OEF A;  1V3W A;  4DCL A;  1QRM A;  4AC3 A;  1YP3 A;  1T3D A;  2XAT A;  5U2K A;  2V0L A;  2WLE A;  3V4E A;  2OI6 A;  3FTT A;  1G97 A;  1QRF A;  2V0J A;  4EQY A;  2ICY A;  2W0W A;  3F1X A;  3IGJ A;  3OTM A;  4IHH A;  4N27 A;  4MYO A;  3FWW A;  1QRE A;  4EAB A;  3GVD A;  1QRG A;  3VNP A;  3FSC A;  4ISX A;  2P2O A;  2JF2 A;  3BSY A;  3I3A A;  5F42 A;  5AFU U;  4N69 A;  1THJ A; 
#chains in the Genus database with same CATH topology
 2I5K A;  3OGZ A;  3VBK A;  2AQ9 A;  4E75 A;  2QKX A;  1YP4 A;  5L6S A;  4J18 A;  3OH4 A;  1KGT A;  3DHO A;  1KGQ A;  4KQL A;  4R36 A;  3R5C A;  3BSS A;  4H7O A;  2IU8 A;  3R5B A;  2GGQ A;  3KWC A;  2OI5 A;  3GUE A;  3OUP A;  3TV0 A;  2ICX A;  3FSX A;  3GQA A;  3Q1X A;  3SRT A;  4N6B A;  3OH3 A;  3HSQ A;  2VHE A;  1LXA A;  1M8N A;  1TDT A;  2W0V A;  2GGO A;  4E1K A;  4MFG A;  4KPZ A;  4KPX A;  3HJJ A;  2OEG A;  4E79 A;  2JF3 A;  1HM8 A;  3GOS A;  2WLC A;  3D98 A;  4HCQ A;  4HZD A;  4M2B A;  5E3R A;  3VBJ A;  1G95 A;  4M28 A;  3VBI A;  3ECT A;  1J2Z A;  1QRL A;  4EA8 A;  3MQG A;  3NZ2 A;  2V0I A;  4IHF A;  3VBL A;  2Q4J A;  3P47 A;  3DJ4 A;  3I3X A;  3C8V A;  2IUA A;  4EA9 A;  3DK5 A;  4IHG A;  1KQA A;  3TK8 A;  1KHR A;  1QQ0 A;  3EG4 A;  4MZU A;  4K6R A;  3R1W A;  1Z2F A;  1Z90 A;  2IC7 A;  3FSY A;  2NPO A;  1L0S A;  1SSM A;  3P1B A;  3TIO A;  5E3Q A;  4M2A A;  2OI7 A;  2V0K A;  4M9C A;  1KK6 A;  3IXC A;  2QIV X;  4FCE A;  5L6V A;  4N6A A;  2RIJ A;  4R37 A;  3FOQ A;  3JQY A;  3MQH A;  3TWD A;  4E6U A;  1FXJ A;  1OCX A;  3VBP A;  5ADX U;  1XAT A;  3EH0 A;  3R3I A;  3CJ8 A;  1SST A;  2V0H A;  4AA7 A;  1MR7 A;  3R0S A;  3R5D A;  1KRR A;  2FKO A;  5ADX V;  3R5A A;  3SPT A;  4EA7 A;  4EGG A;  3VBM A;  5DEP A;  2WLF A;  3R3R A;  3TIS A;  4E6T A;  3BRK X;  4HUS A;  4KNR A;  1MR9 A;  4KNX A;  1V67 A;  4M99 A;  3R2W A;  3R8Y A;  5E3P A;  5DEM A;  1MRL A;  3EEV A;  4G3S A;  4EAA A;  1EWW A;  3OTZ A;  4G3P A;  3KWD A;  3FSB A;  3OW5 A;  4AAW A;  3OU9 A;  3MC4 A;  2TDT A;  3BXY A;  3KWE A;  3TDT A;  1SSQ A;  1HV9 A;  4M98 A;  2QIA A;  1S80 A;  3BFP A;  2VD4 A;  4G3Q A;  1KK4 A;  2WLD A;  1HM0 A;  4J09 A;  1KRV A;  2WLG A;  4HZC A;  4HUR A;  3D8V A;  1XHD A;  3PMO A;  5AFU V;  1KRU A;  3OH0 A;  1KK5 A;  1N4I A;  2IU9 A;  4R7P A;  3BSW A;  1FWY A;  1HM9 A;  3FS8 A;  5DG3 A;  4G87 A;  1YP2 A;  3ST8 A;  3VBN A;  3T57 A;  3GQ8 A;  2OEF A;  1V3W A;  4DCL A;  1QRM A;  4AC3 A;  1YP3 A;  1T3D A;  2XAT A;  5U2K A;  2V0L A;  2WLE A;  3V4E A;  2OI6 A;  3GQ7 A;  3FTT A;  1G97 A;  1QRF A;  2V0J A;  4EQY A;  2ICY A;  2W0W A;  3F1X A;  3IGJ A;  3OH1 A;  3OTM A;  4IHH A;  4N27 A;  4MYO A;  3SUC A;  3FWW A;  1QRE A;  3GQ9 A;  4EAB A;  3GVD A;  3OH2 A;  1QRG A;  3VNP A;  3FSC A;  4ISX A;  2P2O A;  2JF2 A;  3BSY A;  3I3A A;  5F42 A;  5AFU U;  4N69 A;  1THJ A; 
#chains in the Genus database with same CATH homology
 2I5K A;  3VBK A;  2AQ9 A;  4E75 A;  2QKX A;  1YP4 A;  5L6S A;  4J18 A;  1KGT A;  3DHO A;  1KGQ A;  4KQL A;  4R36 A;  3R5C A;  3BSS A;  4H7O A;  2IU8 A;  3R5B A;  2GGQ A;  3KWC A;  2OI5 A;  3GUE A;  3OUP A;  3TV0 A;  2ICX A;  3FSX A;  3Q1X A;  3SRT A;  4N6B A;  3HSQ A;  2VHE A;  1LXA A;  1TDT A;  2W0V A;  2GGO A;  4E1K A;  4MFG A;  4KPZ A;  4KPX A;  3HJJ A;  2OEG A;  4E79 A;  2JF3 A;  1HM8 A;  3GOS A;  2WLC A;  3D98 A;  4HCQ A;  4HZD A;  4M2B A;  5E3R A;  3VBJ A;  1G95 A;  4M28 A;  3VBI A;  3ECT A;  1J2Z A;  1QRL A;  4EA8 A;  3MQG A;  3NZ2 A;  2V0I A;  4IHF A;  3VBL A;  2Q4J A;  3P47 A;  3DJ4 A;  3I3X A;  3C8V A;  2IUA A;  4EA9 A;  3DK5 A;  4IHG A;  1KQA A;  3TK8 A;  1KHR A;  1QQ0 A;  3EG4 A;  4MZU A;  4K6R A;  3R1W A;  1Z90 A;  2IC7 A;  3FSY A;  2NPO A;  1SSM A;  3P1B A;  3TIO A;  5E3Q A;  4M2A A;  2OI7 A;  2V0K A;  4M9C A;  1KK6 A;  3IXC A;  2QIV X;  4FCE A;  5L6V A;  4N6A A;  2RIJ A;  4R37 A;  3FOQ A;  3JQY A;  3MQH A;  3TWD A;  4E6U A;  1FXJ A;  1OCX A;  3VBP A;  5ADX U;  1XAT A;  3EH0 A;  3R3I A;  3CJ8 A;  1SST A;  2V0H A;  4AA7 A;  1MR7 A;  3R0S A;  3R5D A;  1KRR A;  2FKO A;  5ADX V;  3R5A A;  3SPT A;  4EA7 A;  4EGG A;  3VBM A;  5DEP A;  2WLF A;  3R3R A;  3TIS A;  4E6T A;  3BRK X;  4HUS A;  4KNR A;  1MR9 A;  4KNX A;  1V67 A;  4M99 A;  3R2W A;  3R8Y A;  5E3P A;  5DEM A;  1MRL A;  3EEV A;  4G3S A;  4EAA A;  3OTZ A;  4G3P A;  3KWD A;  3FSB A;  3OW5 A;  4AAW A;  3OU9 A;  3MC4 A;  2TDT A;  3BXY A;  3KWE A;  3TDT A;  1SSQ A;  1HV9 A;  4M98 A;  2QIA A;  1S80 A;  3BFP A;  2VD4 A;  4G3Q A;  1KK4 A;  2WLD A;  1HM0 A;  4J09 A;  1KRV A;  2WLG A;  4HZC A;  4HUR A;  3D8V A;  1XHD A;  3PMO A;  5AFU V;  1KRU A;  1KK5 A;  2IU9 A;  4R7P A;  3BSW A;  1FWY A;  1HM9 A;  3FS8 A;  5DG3 A;  4G87 A;  1YP2 A;  3ST8 A;  3VBN A;  3T57 A;  2OEF A;  1V3W A;  4DCL A;  1QRM A;  4AC3 A;  1YP3 A;  1T3D A;  2XAT A;  5U2K A;  2V0L A;  2WLE A;  3V4E A;  2OI6 A;  3FTT A;  1G97 A;  1QRF A;  2V0J A;  4EQY A;  2ICY A;  2W0W A;  3F1X A;  3IGJ A;  3OTM A;  4IHH A;  4N27 A;  4MYO A;  3FWW A;  1QRE A;  4EAB A;  3GVD A;  1QRG A;  3VNP A;  3FSC A;  4ISX A;  2P2O A;  2JF2 A;  3BSY A;  3I3A A;  5F42 A;  5AFU U;  4N69 A;  1THJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...