3T57A

Activity and crystal structure of arabidopsis udp-n-acetylglucosamine acyltransferase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
288
structure length
288
Chain Sequence
b'LIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELYSVPAVSAMLQSIRDSFTESRRGICK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine O-acyltransferase domain-containing
publication title Activity and Crystal Structure of Arabidopsis thalianaUDP-N-Acetylglucosamine Acyltransferase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 114
structure length 288
sequence length 288
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 3t57A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3t57A01
1YP3A 2QIAA 3DJ4A 2ICXA 3GOSA 4M28A 3DHOA 2IUAA 3I3AA 5E3RA 5E3QA 1KHRA 2Q4JA 2P2OA 4KPZA 2WLGA 4KNRA 1MR7A 2OI6A 3R3IA 4DCLA 2IU8A 3BSWA 3HJJA 2TDTA 3R5AA 1FXJA 1KK6A 2W0VA 4KPXA 5F42A 1J2ZA 1KK5A 4EA8A 3VBJA 2WLFA 3SRTA 1KGTA 5AFUV 4M98A 3OTMA 4MZUA 3TIOA 4M2AA 1YP4A 4AC3A 1QRMA 3KWEA 3OU9A 1KRUA 2AQ9A 1SSMA 1YP2A 2V0KA 3BXYA 3NZ2A 3FSXA 4E6TA 1T3DA 3EEVA 3VBLA 4EGGA 2WLEA 1S80A 4G3SA 3D98A 3V4EA 2JF2A 4HCQA 4EQYA 4G3QA 2OEFA 1KQAA 4HZCA 2OI7A 3R5CA 3TK8A 3SPTA 3VBMA 2GGOA 4M9CA 1V3WA 2I5KA 5DEMA 1XHDA 2V0HA 3DK5A 3ST8A 4IHGA 4N27A 3HSQA 3MC4A 3VNPA 4EAAA 4HZDA 3IXCA 2WLCA 3OW5A 5L6VA 3BRKX 1V67A 4FCEA 3CJ8A 4HUSA 4KQLA 4G87A 1FWYA 1LXAA 5DEPA 3F1XA 1XATA 4EA9A 1HV9A 4G3PA 2VD4A 2XATA 1HM0A 2RIJA 1MRLA 1Z90A 4N69A 2WLDA 3BSYA 3R1WA 3KWDA 5ADXU 3JQYA 1QRFA 3TV0A 3R5DA 3I3XA 4N6AA 4E79A 4IHHA 1QRGA 2QIVX 4EA7A 2OEGA 3T57A 1MR9A 3VBNA 3FOQA 3GUEA 5E3PA 4E75A 3P1BA 3R8YA 3FSYA 4MYOA 3R5BA 3IGJA 4ISXA 1KK4A 2V0LA 4EABA 3MQHA 2GGQA 1SSQA 3OTZA 1G95A 1G97A 1QRLA 3FWWA 3KWCA 3BSSA 1THJA 4N6BA 5AFUU 4AAWA 2V0JA 3GVDA 2QKXA 4K6RA 3R2WA 3FSCA 4M2BA 3FTTA 4M99A 1KRRA 4E6UA 2OI5A 1SSTA 3EG4A 4E1KA 2IU9A 4J09A 3EH0A 4R7PA 3TWDA 5U2KA 1QREA 3OUPA 2IC7A 3TDTA 4H7OA 2FKOA 1HM9A 3MQGA 3R3RA 2VHEA 4IHFA 3TISA 1OCXA 2V0IA 3C8VA 3D8VA 3VBIA 4HURA 3VBKA 3BFPA 2W0WA 3R0SA 1KRVA 1KGQA 2ICYA 3FSBA 3PMOA 4AA7A 3VBPA 4R37A 4J18A 1TDTA 4MFGA 3P47A 5ADXV 2JF3A 4R36A 5DG3A 2NPOA 4KNXA 5L6SA 3Q1XA 3ECTA 1HM8A 3FS8A 1QQ0A
chains in the Genus database with same CATH superfamily
1YP3A 2QIAA 3DJ4A 2ICXA 3GOSA 4M28A 3DHOA 2IUAA 3I3AA 5E3RA 5E3QA 1KHRA 2Q4JA 2P2OA 4KPZA 2WLGA 4KNRA 1MR7A 2OI6A 3R3IA 4DCLA 3OH1A 2IU8A 3BSWA 3GQAA 3HJJA 2TDTA 3R5AA 1FXJA 1KK6A 2W0VA 4KPXA 5F42A 1J2ZA 1KK5A 4EA8A 3VBJA 1N4IA 2WLFA 3SRTA 1KGTA 5AFUV 4M98A 3OTMA 4MZUA 3TIOA 4M2AA 1YP4A 4AC3A 1QRMA 3KWEA 3OU9A 1KRUA 2AQ9A 1SSMA 1YP2A 2V0KA 3BXYA 3NZ2A 3FSXA 3SUCA 4E6TA 1T3DA 3EEVA 3VBLA 4EGGA 2WLEA 1S80A 4G3SA 3D98A 3V4EA 2JF2A 4HCQA 4EQYA 1M8NA 4G3QA 2OEFA 1KQAA 4HZCA 2OI7A 3R5CA 3TK8A 3SPTA 3VBMA 2GGOA 4M9CA 3OGZA 1V3WA 2I5KA 5DEMA 1XHDA 2V0HA 3DK5A 3ST8A 4IHGA 4N27A 3HSQA 3MC4A 3VNPA 4EAAA 4HZDA 3IXCA 2WLCA 3OW5A 5L6VA 3BRKX 1V67A 4FCEA 3CJ8A 4HUSA 4KQLA 4G87A 1FWYA 1LXAA 5DEPA 3F1XA 1XATA 4EA9A 1HV9A 4G3PA 2VD4A 2XATA 1HM0A 2RIJA 1MRLA 1Z90A 4N69A 2WLDA 3BSYA 3R1WA 3KWDA 5ADXU 3JQYA 1QRFA 3TV0A 3R5DA 3I3XA 4N6AA 4E79A 4IHHA 1QRGA 2QIVX 1Z2FA 4EA7A 2OEGA 3T57A 1MR9A 3VBNA 3FOQA 3GQ9A 3GUEA 5E3PA 4E75A 3P1BA 3R8YA 3FSYA 3GQ8A 4MYOA 3R5BA 3IGJA 4ISXA 1KK4A 2V0LA 4EABA 3MQHA 2GGQA 1SSQA 3OTZA 1G95A 1G97A 1QRLA 3FWWA 3KWCA 3BSSA 1THJA 4N6BA 5AFUU 4AAWA 2V0JA 3GVDA 2QKXA 4K6RA 3OH2A 3R2WA 3FSCA 4M2BA 3GQ7A 3FTTA 1L0SA 4M99A 1KRRA 4E6UA 2OI5A 1SSTA 3EG4A 4E1KA 2IU9A 4J09A 3EH0A 4R7PA 3TWDA 5U2KA 1QREA 3OUPA 2IC7A 3TDTA 4H7OA 3OH0A 2FKOA 1HM9A 3MQGA 3R3RA 2VHEA 4IHFA 3TISA 1OCXA 2V0IA 3C8VA 3D8VA 3VBIA 4HURA 3VBKA 3BFPA 2W0WA 3R0SA 1KRVA 1KGQA 2ICYA 3FSBA 3PMOA 4AA7A 1EWWA 3VBPA 4R37A 4J18A 3OH4A 1TDTA 4MFGA 3P47A 5ADXV 2JF3A 4R36A 5DG3A 2NPOA 3OH3A 4KNXA 3Q1XA 5L6SA 3ECTA 1HM8A 3FS8A 1QQ0A
chains in the Genus database with same CATH topology
1YP3A 2QIAA 3DJ4A 2ICXA 3GOSA 4M28A 3DHOA 2IUAA 3I3AA 5E3RA 5E3QA 1KHRA 2Q4JA 2P2OA 4KPZA 2WLGA 4KNRA 1MR7A 2OI6A 3R3IA 4DCLA 2IU8A 3BSWA 3HJJA 2TDTA 3R5AA 1FXJA 1KK6A 2W0VA 4KPXA 5F42A 1J2ZA 1KK5A 4EA8A 3VBJA 2WLFA 3SRTA 1KGTA 5AFUV 4M98A 3OTMA 4MZUA 3TIOA 4M2AA 1YP4A 4AC3A 1QRMA 3KWEA 3OU9A 1KRUA 2AQ9A 1SSMA 1YP2A 2V0KA 3BXYA 3NZ2A 3FSXA 4E6TA 1T3DA 3EEVA 3VBLA 4EGGA 2WLEA 1S80A 4G3SA 3D98A 3V4EA 2JF2A 4HCQA 4EQYA 4G3QA 2OEFA 1KQAA 4HZCA 2OI7A 3R5CA 3TK8A 3SPTA 3VBMA 2GGOA 4M9CA 1V3WA 2I5KA 5DEMA 1XHDA 2V0HA 3DK5A 3ST8A 4IHGA 4N27A 3HSQA 3MC4A 3VNPA 4EAAA 4HZDA 3IXCA 2WLCA 3OW5A 5L6VA 3BRKX 1V67A 4FCEA 3CJ8A 4HUSA 4KQLA 4G87A 1FWYA 1LXAA 5DEPA 3F1XA 1XATA 4EA9A 1HV9A 4G3PA 2VD4A 2XATA 1HM0A 2RIJA 1MRLA 1Z90A 4N69A 2WLDA 3BSYA 3R1WA 3KWDA 5ADXU 3JQYA 1QRFA 3TV0A 3R5DA 3I3XA 4N6AA 4E79A 4IHHA 1QRGA 2QIVX 4EA7A 2OEGA 3T57A 1MR9A 3VBNA 3FOQA 3GUEA 5E3PA 4E75A 3P1BA 3R8YA 3FSYA 4MYOA 3R5BA 3IGJA 4ISXA 1KK4A 2V0LA 4EABA 3MQHA 2GGQA 1SSQA 3OTZA 1G95A 1G97A 1QRLA 3FWWA 3KWCA 3BSSA 1THJA 4N6BA 5AFUU 4AAWA 2V0JA 3GVDA 2QKXA 4K6RA 3R2WA 3FSCA 4M2BA 3FTTA 4M99A 1KRRA 4E6UA 2OI5A 1SSTA 3EG4A 4E1KA 2IU9A 4J09A 3EH0A 4R7PA 3TWDA 5U2KA 1QREA 3OUPA 2IC7A 3TDTA 4H7OA 2FKOA 1HM9A 3MQGA 3R3RA 2VHEA 4IHFA 3TISA 1OCXA 2V0IA 3C8VA 3D8VA 3VBIA 4HURA 3VBKA 3BFPA 2W0WA 3R0SA 1KRVA 1KGQA 2ICYA 3FSBA 3PMOA 4AA7A 3VBPA 4R37A 4J18A 1TDTA 4MFGA 3P47A 5ADXV 2JF3A 4R36A 5DG3A 2NPOA 4KNXA 5L6SA 3Q1XA 3ECTA 1HM8A 3FS8A 1QQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP3 A;  2QIA A;  3DJ4 A;  2ICX A;  3GOS A;  4M28 A;  3DHO A;  2IUA A;  3I3A A;  5E3R A;  5E3Q A;  1KHR A;  2Q4J A;  2P2O A;  4KPZ A;  2WLG A;  4KNR A;  1MR7 A;  2OI6 A;  3R3I A;  4DCL A;  2IU8 A;  3BSW A;  3HJJ A;  2TDT A;  3R5A A;  1FXJ A;  1KK6 A;  2W0V A;  4KPX A;  5F42 A;  1J2Z A;  1KK5 A;  4EA8 A;  3VBJ A;  2WLF A;  3SRT A;  1KGT A;  5AFU V;  4M98 A;  3OTM A;  4MZU A;  3TIO A;  4M2A A;  1YP4 A;  4AC3 A;  1QRM A;  3KWE A;  3OU9 A;  1KRU A;  2AQ9 A;  1SSM A;  1YP2 A;  2V0K A;  3BXY A;  3NZ2 A;  3FSX A;  4E6T A;  1T3D A;  3EEV A;  3VBL A;  4EGG A;  2WLE A;  1S80 A;  4G3S A;  3D98 A;  3V4E A;  2JF2 A;  4HCQ A;  4EQY A;  4G3Q A;  2OEF A;  1KQA A;  4HZC A;  2OI7 A;  3R5C A;  3TK8 A;  3SPT A;  3VBM A;  2GGO A;  4M9C A;  1V3W A;  2I5K A;  5DEM A;  1XHD A;  2V0H A;  3DK5 A;  3ST8 A;  4IHG A;  4N27 A;  3HSQ A;  3MC4 A;  3VNP A;  4EAA A;  4HZD A;  3IXC A;  2WLC A;  3OW5 A;  5L6V A;  3BRK X;  1V67 A;  4FCE A;  3CJ8 A;  4HUS A;  4KQL A;  4G87 A;  1FWY A;  1LXA A;  5DEP A;  3F1X A;  1XAT A;  4EA9 A;  1HV9 A;  4G3P A;  2VD4 A;  2XAT A;  1HM0 A;  2RIJ A;  1MRL A;  1Z90 A;  4N69 A;  2WLD A;  3BSY A;  3R1W A;  3KWD A;  5ADX U;  3JQY A;  1QRF A;  3TV0 A;  3R5D A;  3I3X A;  4N6A A;  4E79 A;  4IHH A;  1QRG A;  2QIV X;  4EA7 A;  2OEG A;  3T57 A;  1MR9 A;  3VBN A;  3FOQ A;  3GUE A;  5E3P A;  4E75 A;  3P1B A;  3R8Y A;  3FSY A;  4MYO A;  3R5B A;  3IGJ A;  4ISX A;  1KK4 A;  2V0L A;  4EAB A;  3MQH A;  2GGQ A;  1SSQ A;  3OTZ A;  1G95 A;  1G97 A;  1QRL A;  3FWW A;  3KWC A;  3BSS A;  1THJ A;  4N6B A;  5AFU U;  4AAW A;  2V0J A;  3GVD A;  2QKX A;  4K6R A;  3R2W A;  3FSC A;  4M2B A;  3FTT A;  4M99 A;  1KRR A;  4E6U A;  2OI5 A;  1SST A;  3EG4 A;  4E1K A;  2IU9 A;  4J09 A;  3EH0 A;  4R7P A;  3TWD A;  5U2K A;  1QRE A;  3OUP A;  2IC7 A;  3TDT A;  4H7O A;  2FKO A;  1HM9 A;  3MQG A;  3R3R A;  2VHE A;  4IHF A;  3TIS A;  1OCX A;  2V0I A;  3C8V A;  3D8V A;  3VBI A;  4HUR A;  3VBK A;  3BFP A;  2W0W A;  3R0S A;  1KRV A;  1KGQ A;  2ICY A;  3FSB A;  3PMO A;  4AA7 A;  3VBP A;  4R37 A;  4J18 A;  1TDT A;  4MFG A;  3P47 A;  5ADX V;  2JF3 A;  4R36 A;  5DG3 A;  2NPO A;  4KNX A;  5L6S A;  3Q1X A;  3ECT A;  1HM8 A;  3FS8 A;  1QQ0 A; 
#chains in the Genus database with same CATH topology
 1YP3 A;  2QIA A;  3DJ4 A;  2ICX A;  3GOS A;  4M28 A;  3DHO A;  2IUA A;  3I3A A;  5E3R A;  5E3Q A;  1KHR A;  2Q4J A;  2P2O A;  4KPZ A;  2WLG A;  4KNR A;  1MR7 A;  2OI6 A;  3R3I A;  4DCL A;  3OH1 A;  2IU8 A;  3BSW A;  3GQA A;  3HJJ A;  2TDT A;  3R5A A;  1FXJ A;  1KK6 A;  2W0V A;  4KPX A;  5F42 A;  1J2Z A;  1KK5 A;  4EA8 A;  3VBJ A;  1N4I A;  2WLF A;  3SRT A;  1KGT A;  5AFU V;  4M98 A;  3OTM A;  4MZU A;  3TIO A;  4M2A A;  1YP4 A;  4AC3 A;  1QRM A;  3KWE A;  3OU9 A;  1KRU A;  2AQ9 A;  1SSM A;  1YP2 A;  2V0K A;  3BXY A;  3NZ2 A;  3FSX A;  3SUC A;  4E6T A;  1T3D A;  3EEV A;  3VBL A;  4EGG A;  2WLE A;  1S80 A;  4G3S A;  3D98 A;  3V4E A;  2JF2 A;  4HCQ A;  4EQY A;  1M8N A;  4G3Q A;  2OEF A;  1KQA A;  4HZC A;  2OI7 A;  3R5C A;  3TK8 A;  3SPT A;  3VBM A;  2GGO A;  4M9C A;  3OGZ A;  1V3W A;  2I5K A;  5DEM A;  1XHD A;  2V0H A;  3DK5 A;  3ST8 A;  4IHG A;  4N27 A;  3HSQ A;  3MC4 A;  3VNP A;  4EAA A;  4HZD A;  3IXC A;  2WLC A;  3OW5 A;  5L6V A;  3BRK X;  1V67 A;  4FCE A;  3CJ8 A;  4HUS A;  4KQL A;  4G87 A;  1FWY A;  1LXA A;  5DEP A;  3F1X A;  1XAT A;  4EA9 A;  1HV9 A;  4G3P A;  2VD4 A;  2XAT A;  1HM0 A;  2RIJ A;  1MRL A;  1Z90 A;  4N69 A;  2WLD A;  3BSY A;  3R1W A;  3KWD A;  5ADX U;  3JQY A;  1QRF A;  3TV0 A;  3R5D A;  3I3X A;  4N6A A;  4E79 A;  4IHH A;  1QRG A;  2QIV X;  1Z2F A;  4EA7 A;  2OEG A;  3T57 A;  1MR9 A;  3VBN A;  3FOQ A;  3GQ9 A;  3GUE A;  5E3P A;  4E75 A;  3P1B A;  3R8Y A;  3FSY A;  3GQ8 A;  4MYO A;  3R5B A;  3IGJ A;  4ISX A;  1KK4 A;  2V0L A;  4EAB A;  3MQH A;  2GGQ A;  1SSQ A;  3OTZ A;  1G95 A;  1G97 A;  1QRL A;  3FWW A;  3KWC A;  3BSS A;  1THJ A;  4N6B A;  5AFU U;  4AAW A;  2V0J A;  3GVD A;  2QKX A;  4K6R A;  3OH2 A;  3R2W A;  3FSC A;  4M2B A;  3GQ7 A;  3FTT A;  1L0S A;  4M99 A;  1KRR A;  4E6U A;  2OI5 A;  1SST A;  3EG4 A;  4E1K A;  2IU9 A;  4J09 A;  3EH0 A;  4R7P A;  3TWD A;  5U2K A;  1QRE A;  3OUP A;  2IC7 A;  3TDT A;  4H7O A;  3OH0 A;  2FKO A;  1HM9 A;  3MQG A;  3R3R A;  2VHE A;  4IHF A;  3TIS A;  1OCX A;  2V0I A;  3C8V A;  3D8V A;  3VBI A;  4HUR A;  3VBK A;  3BFP A;  2W0W A;  3R0S A;  1KRV A;  1KGQ A;  2ICY A;  3FSB A;  3PMO A;  4AA7 A;  1EWW A;  3VBP A;  4R37 A;  4J18 A;  3OH4 A;  1TDT A;  4MFG A;  3P47 A;  5ADX V;  2JF3 A;  4R36 A;  5DG3 A;  2NPO A;  3OH3 A;  4KNX A;  3Q1X A;  5L6S A;  3ECT A;  1HM8 A;  3FS8 A;  1QQ0 A; 
#chains in the Genus database with same CATH homology
 1YP3 A;  2QIA A;  3DJ4 A;  2ICX A;  3GOS A;  4M28 A;  3DHO A;  2IUA A;  3I3A A;  5E3R A;  5E3Q A;  1KHR A;  2Q4J A;  2P2O A;  4KPZ A;  2WLG A;  4KNR A;  1MR7 A;  2OI6 A;  3R3I A;  4DCL A;  2IU8 A;  3BSW A;  3HJJ A;  2TDT A;  3R5A A;  1FXJ A;  1KK6 A;  2W0V A;  4KPX A;  5F42 A;  1J2Z A;  1KK5 A;  4EA8 A;  3VBJ A;  2WLF A;  3SRT A;  1KGT A;  5AFU V;  4M98 A;  3OTM A;  4MZU A;  3TIO A;  4M2A A;  1YP4 A;  4AC3 A;  1QRM A;  3KWE A;  3OU9 A;  1KRU A;  2AQ9 A;  1SSM A;  1YP2 A;  2V0K A;  3BXY A;  3NZ2 A;  3FSX A;  4E6T A;  1T3D A;  3EEV A;  3VBL A;  4EGG A;  2WLE A;  1S80 A;  4G3S A;  3D98 A;  3V4E A;  2JF2 A;  4HCQ A;  4EQY A;  4G3Q A;  2OEF A;  1KQA A;  4HZC A;  2OI7 A;  3R5C A;  3TK8 A;  3SPT A;  3VBM A;  2GGO A;  4M9C A;  1V3W A;  2I5K A;  5DEM A;  1XHD A;  2V0H A;  3DK5 A;  3ST8 A;  4IHG A;  4N27 A;  3HSQ A;  3MC4 A;  3VNP A;  4EAA A;  4HZD A;  3IXC A;  2WLC A;  3OW5 A;  5L6V A;  3BRK X;  1V67 A;  4FCE A;  3CJ8 A;  4HUS A;  4KQL A;  4G87 A;  1FWY A;  1LXA A;  5DEP A;  3F1X A;  1XAT A;  4EA9 A;  1HV9 A;  4G3P A;  2VD4 A;  2XAT A;  1HM0 A;  2RIJ A;  1MRL A;  1Z90 A;  4N69 A;  2WLD A;  3BSY A;  3R1W A;  3KWD A;  5ADX U;  3JQY A;  1QRF A;  3TV0 A;  3R5D A;  3I3X A;  4N6A A;  4E79 A;  4IHH A;  1QRG A;  2QIV X;  4EA7 A;  2OEG A;  3T57 A;  1MR9 A;  3VBN A;  3FOQ A;  3GUE A;  5E3P A;  4E75 A;  3P1B A;  3R8Y A;  3FSY A;  4MYO A;  3R5B A;  3IGJ A;  4ISX A;  1KK4 A;  2V0L A;  4EAB A;  3MQH A;  2GGQ A;  1SSQ A;  3OTZ A;  1G95 A;  1G97 A;  1QRL A;  3FWW A;  3KWC A;  3BSS A;  1THJ A;  4N6B A;  5AFU U;  4AAW A;  2V0J A;  3GVD A;  2QKX A;  4K6R A;  3R2W A;  3FSC A;  4M2B A;  3FTT A;  4M99 A;  1KRR A;  4E6U A;  2OI5 A;  1SST A;  3EG4 A;  4E1K A;  2IU9 A;  4J09 A;  3EH0 A;  4R7P A;  3TWD A;  5U2K A;  1QRE A;  3OUP A;  2IC7 A;  3TDT A;  4H7O A;  2FKO A;  1HM9 A;  3MQG A;  3R3R A;  2VHE A;  4IHF A;  3TIS A;  1OCX A;  2V0I A;  3C8V A;  3D8V A;  3VBI A;  4HUR A;  3VBK A;  3BFP A;  2W0W A;  3R0S A;  1KRV A;  1KGQ A;  2ICY A;  3FSB A;  3PMO A;  4AA7 A;  3VBP A;  4R37 A;  4J18 A;  1TDT A;  4MFG A;  3P47 A;  5ADX V;  2JF3 A;  4R36 A;  5DG3 A;  2NPO A;  4KNX A;  5L6S A;  3Q1X A;  3ECT A;  1HM8 A;  3FS8 A;  1QQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...