3TV0A

Structure of dynactin p27 subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
143
Chain Sequence
SVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNIKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynactin targets Polo-like kinase 1 to kinetochores
rcsb
molecule keywords Dynactin subunit 6
molecule tags Structural protein
source organism Homo sapiens
total genus 49
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tv0A00
3BFPA 4N6BA 1QRMA 3KWDA 4E6UA 3EG4A 4AA7A 4EA7A 3GUEA 3R8YA 4HZDA 5F42A 2WLEA 1SSQA 4M2AA 3R3IA 5AFUV 5AFUU 3R1WA 4EA8A 4KPZA 2IU9A 2P2OA 3FS8A 2IUAA 5ADXV 2JF2A 4G3PA 1TDTA 4IHGA 4ISXA 1KRVA 3DJ4A 4EAAA 2V0HA 3BSYA 3OU9A 2Q4JA 2FKOA 1LXAA 3BXYA 3FWWA 3SPTA 2W0VA 3SRTA 3VBNA 3EH0A 3FSBA 4EABA 4EQYA 2WLDA 5U2KA 4N69A 1YP2A 3CJ8A 3PMOA 3R3RA 1QRGA 2QIAA 1XHDA 3C8VA 3R5AA 4G3SA 4AC3A 4E1KA 2VD4A 2VHEA 5DEPA 3IXCA 2OEGA 1QQ0A 2IU8A 1SSTA 4IHFA 3FSXA 5DEMA 2WLFA 2GGOA 1XATA 3D8VA 4M98A 3TDTA 3TV0A 1MRLA 4HUSA 5ADXU 3GOSA 3R0SA 1T3DA 2V0LA 3R5CA 3TK8A 1KK6A 3KWCA 4AAWA 3ECTA 3R5BA 3TIOA 3EEVA 1KK5A 1KGTA 3ST8A 3BRKX 1FWYA 3NZ2A 4KPXA 3TISA 4MZUA 3VBKA 3BSWA 3I3XA 3VBJA 3DK5A 2V0JA 1KGQA 1Z90A 2NPOA 1KK4A 2OI7A 5DG3A 1V3WA 2RIJA 1S80A 1SSMA 3OTZA 4M28A 3VNPA 2OEFA 2QKXA 3Q1XA 4EA9A 2OI5A 2ICXA 1YP3A 3I3AA 3JQYA 3MC4A 4N6AA 3F1XA 3FTTA 4J18A 1G97A 3HSQA 3T57A 1KQAA 1QRFA 2TDTA 3MQHA 5E3RA 3VBLA 1QREA 4FCEA 1HV9A 3TWDA 4KNRA 2QIVX 4R37A 2IC7A 3D98A 3VBIA 3FSYA 3BSSA 4KNXA 4MFGA 1KRRA 4E75A 4R36A 5E3PA 1HM0A 4DCLA 5L6SA 2WLGA 4R7PA 1G95A 1THJA 1V67A 2XATA 3FSCA 4M9CA 3KWEA 3R2WA 4HZCA 3OW5A 1J2ZA 2OI6A 4K6RA 2W0WA 1OCXA 3HJJA 4E79A 4HCQA 2JF3A 4HURA 1MR7A 3VBMA 3P47A 4EGGA 3MQGA 2V0IA 4N27A 4H7OA 1FXJA 3R5DA 1KRUA 1HM8A 3OUPA 2AQ9A 2V0KA 2WLCA 1YP4A 5E3QA 3IGJA 1HM9A 4IHHA 5L6VA 4G3QA 4KQLA 4MYOA 1MR9A 3FOQA 2I5KA 4M2BA 3V4EA 3OTMA 3P1BA 2ICYA 4J09A 1KHRA 3DHOA 4M99A 2GGQA 3GVDA 4G87A 1QRLA 3VBPA 4E6TA
chains in the Genus database with same CATH superfamily
3BFPA 4N6BA 1QRMA 3KWDA 4E6UA 3EG4A 4AA7A 4EA7A 3GUEA 3R8YA 4HZDA 5F42A 2WLEA 1SSQA 4M2AA 3R3IA 5AFUV 5AFUU 3R1WA 4EA8A 1EWWA 4KPZA 2IU9A 2P2OA 3FS8A 2IUAA 5ADXV 2JF2A 4G3PA 1TDTA 4IHGA 4ISXA 1KRVA 3DJ4A 4EAAA 2V0HA 3BSYA 3OU9A 2Q4JA 2FKOA 3GQAA 1LXAA 3BXYA 3FWWA 3SPTA 2W0VA 3SRTA 3VBNA 3EH0A 3FSBA 4EABA 4EQYA 2WLDA 5U2KA 4N69A 1YP2A 3CJ8A 3PMOA 3R3RA 1QRGA 2QIAA 1XHDA 3C8VA 3GQ9A 3R5AA 4G3SA 4AC3A 4E1KA 2VD4A 2VHEA 5DEPA 3IXCA 2OEGA 1QQ0A 2IU8A 1SSTA 4IHFA 3FSXA 5DEMA 2WLFA 2GGOA 1XATA 3D8VA 4M98A 3TDTA 3TV0A 1MRLA 4HUSA 5ADXU 3GOSA 3R0SA 1T3DA 2V0LA 3R5CA 3TK8A 1KK6A 3KWCA 4AAWA 3ECTA 3GQ8A 3R5BA 3TIOA 3EEVA 3OGZA 1KK5A 1KGTA 3ST8A 3BRKX 1FWYA 3NZ2A 4KPXA 3TISA 4MZUA 3VBKA 3BSWA 3I3XA 3VBJA 3DK5A 2V0JA 1KGQA 1Z90A 2NPOA 1KK4A 2OI7A 5DG3A 1V3WA 2RIJA 1S80A 1SSMA 3OTZA 4M28A 3VNPA 3OH2A 2OEFA 1Z2FA 2QKXA 3Q1XA 4EA9A 2OI5A 2ICXA 1YP3A 3I3AA 3JQYA 3MC4A 3OH3A 4N6AA 3F1XA 3FTTA 4J18A 1G97A 3HSQA 3T57A 1KQAA 1QRFA 2TDTA 3MQHA 5E3RA 3VBLA 1QREA 4FCEA 1HV9A 1N4IA 3TWDA 1L0SA 4KNRA 2QIVX 3GQ7A 4R37A 3OH4A 2IC7A 3D98A 3VBIA 3FSYA 3BSSA 4KNXA 4MFGA 1KRRA 4E75A 4R36A 5E3PA 1HM0A 4DCLA 5L6SA 2WLGA 4R7PA 1G95A 1THJA 1V67A 2XATA 3FSCA 4M9CA 3KWEA 3R2WA 4HZCA 3OW5A 1J2ZA 2OI6A 3OH1A 4K6RA 2W0WA 1OCXA 3HJJA 4E79A 4HCQA 2JF3A 4HURA 1MR7A 3VBMA 3P47A 4EGGA 3MQGA 2V0IA 4N27A 4H7OA 1FXJA 3R5DA 1KRUA 1HM8A 3OH0A 3OUPA 2AQ9A 2V0KA 2WLCA 1YP4A 5E3QA 3IGJA 1HM9A 4IHHA 5L6VA 4G3QA 4KQLA 4MYOA 1MR9A 3FOQA 2I5KA 4M2BA 1M8NA 3V4EA 3OTMA 3SUCA 3P1BA 2ICYA 4J09A 1KHRA 3DHOA 4M99A 2GGQA 3GVDA 4G87A 1QRLA 3VBPA 4E6TA
chains in the Genus database with same CATH topology
3BFPA 4N6BA 1QRMA 3KWDA 4E6UA 3EG4A 4AA7A 4EA7A 3GUEA 3R8YA 4HZDA 5F42A 2WLEA 1SSQA 4M2AA 3R3IA 5AFUV 5AFUU 3R1WA 4EA8A 4KPZA 2IU9A 2P2OA 3FS8A 2IUAA 5ADXV 2JF2A 4G3PA 1TDTA 4IHGA 4ISXA 1KRVA 3DJ4A 4EAAA 2V0HA 3BSYA 3OU9A 2Q4JA 2FKOA 1LXAA 3BXYA 3FWWA 3SPTA 2W0VA 3SRTA 3VBNA 3EH0A 3FSBA 4EABA 4EQYA 2WLDA 5U2KA 4N69A 1YP2A 3CJ8A 3PMOA 3R3RA 1QRGA 2QIAA 1XHDA 3C8VA 3R5AA 4G3SA 4AC3A 4E1KA 2VD4A 2VHEA 5DEPA 3IXCA 2OEGA 1QQ0A 2IU8A 1SSTA 4IHFA 3FSXA 5DEMA 2WLFA 2GGOA 1XATA 3D8VA 4M98A 3TDTA 3TV0A 1MRLA 4HUSA 5ADXU 3GOSA 3R0SA 1T3DA 2V0LA 3R5CA 3TK8A 1KK6A 3KWCA 4AAWA 3ECTA 3R5BA 3TIOA 3EEVA 1KK5A 1KGTA 3ST8A 3BRKX 1FWYA 3NZ2A 4KPXA 3TISA 4MZUA 3VBKA 3BSWA 3I3XA 3VBJA 3DK5A 2V0JA 1KGQA 1Z90A 2NPOA 1KK4A 2OI7A 5DG3A 1V3WA 2RIJA 1S80A 1SSMA 3OTZA 4M28A 3VNPA 2OEFA 2QKXA 3Q1XA 4EA9A 2OI5A 2ICXA 1YP3A 3I3AA 3JQYA 3MC4A 4N6AA 3F1XA 3FTTA 4J18A 1G97A 3HSQA 3T57A 1KQAA 1QRFA 2TDTA 3MQHA 5E3RA 3VBLA 1QREA 4FCEA 1HV9A 3TWDA 4KNRA 2QIVX 4R37A 2IC7A 3D98A 3VBIA 3FSYA 3BSSA 4KNXA 4MFGA 1KRRA 4E75A 4R36A 5E3PA 1HM0A 4DCLA 5L6SA 2WLGA 4R7PA 1G95A 1THJA 1V67A 2XATA 3FSCA 4M9CA 3KWEA 3R2WA 4HZCA 3OW5A 1J2ZA 2OI6A 4K6RA 2W0WA 1OCXA 3HJJA 4E79A 4HCQA 2JF3A 4HURA 1MR7A 3VBMA 3P47A 4EGGA 3MQGA 2V0IA 4N27A 4H7OA 1FXJA 3R5DA 1KRUA 1HM8A 3OUPA 2AQ9A 2V0KA 2WLCA 1YP4A 5E3QA 3IGJA 1HM9A 4IHHA 5L6VA 4G3QA 4KQLA 4MYOA 1MR9A 3FOQA 2I5KA 4M2BA 3V4EA 3OTMA 3P1BA 2ICYA 4J09A 1KHRA 3DHOA 4M99A 2GGQA 3GVDA 4G87A 1QRLA 3VBPA 4E6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFP A;  4N6B A;  1QRM A;  3KWD A;  4E6U A;  3EG4 A;  4AA7 A;  4EA7 A;  3GUE A;  3R8Y A;  4HZD A;  5F42 A;  2WLE A;  1SSQ A;  4M2A A;  3R3I A;  5AFU V;  5AFU U;  3R1W A;  4EA8 A;  4KPZ A;  2IU9 A;  2P2O A;  3FS8 A;  2IUA A;  5ADX V;  2JF2 A;  4G3P A;  1TDT A;  4IHG A;  4ISX A;  1KRV A;  3DJ4 A;  4EAA A;  2V0H A;  3BSY A;  3OU9 A;  2Q4J A;  2FKO A;  1LXA A;  3BXY A;  3FWW A;  3SPT A;  2W0V A;  3SRT A;  3VBN A;  3EH0 A;  3FSB A;  4EAB A;  4EQY A;  2WLD A;  5U2K A;  4N69 A;  1YP2 A;  3CJ8 A;  3PMO A;  3R3R A;  1QRG A;  2QIA A;  1XHD A;  3C8V A;  3R5A A;  4G3S A;  4AC3 A;  4E1K A;  2VD4 A;  2VHE A;  5DEP A;  3IXC A;  2OEG A;  1QQ0 A;  2IU8 A;  1SST A;  4IHF A;  3FSX A;  5DEM A;  2WLF A;  2GGO A;  1XAT A;  3D8V A;  4M98 A;  3TDT A;  3TV0 A;  1MRL A;  4HUS A;  5ADX U;  3GOS A;  3R0S A;  1T3D A;  2V0L A;  3R5C A;  3TK8 A;  1KK6 A;  3KWC A;  4AAW A;  3ECT A;  3R5B A;  3TIO A;  3EEV A;  1KK5 A;  1KGT A;  3ST8 A;  3BRK X;  1FWY A;  3NZ2 A;  4KPX A;  3TIS A;  4MZU A;  3VBK A;  3BSW A;  3I3X A;  3VBJ A;  3DK5 A;  2V0J A;  1KGQ A;  1Z90 A;  2NPO A;  1KK4 A;  2OI7 A;  5DG3 A;  1V3W A;  2RIJ A;  1S80 A;  1SSM A;  3OTZ A;  4M28 A;  3VNP A;  2OEF A;  2QKX A;  3Q1X A;  4EA9 A;  2OI5 A;  2ICX A;  1YP3 A;  3I3A A;  3JQY A;  3MC4 A;  4N6A A;  3F1X A;  3FTT A;  4J18 A;  1G97 A;  3HSQ A;  3T57 A;  1KQA A;  1QRF A;  2TDT A;  3MQH A;  5E3R A;  3VBL A;  1QRE A;  4FCE A;  1HV9 A;  3TWD A;  4KNR A;  2QIV X;  4R37 A;  2IC7 A;  3D98 A;  3VBI A;  3FSY A;  3BSS A;  4KNX A;  4MFG A;  1KRR A;  4E75 A;  4R36 A;  5E3P A;  1HM0 A;  4DCL A;  5L6S A;  2WLG A;  4R7P A;  1G95 A;  1THJ A;  1V67 A;  2XAT A;  3FSC A;  4M9C A;  3KWE A;  3R2W A;  4HZC A;  3OW5 A;  1J2Z A;  2OI6 A;  4K6R A;  2W0W A;  1OCX A;  3HJJ A;  4E79 A;  4HCQ A;  2JF3 A;  4HUR A;  1MR7 A;  3VBM A;  3P47 A;  4EGG A;  3MQG A;  2V0I A;  4N27 A;  4H7O A;  1FXJ A;  3R5D A;  1KRU A;  1HM8 A;  3OUP A;  2AQ9 A;  2V0K A;  2WLC A;  1YP4 A;  5E3Q A;  3IGJ A;  1HM9 A;  4IHH A;  5L6V A;  4G3Q A;  4KQL A;  4MYO A;  1MR9 A;  3FOQ A;  2I5K A;  4M2B A;  3V4E A;  3OTM A;  3P1B A;  2ICY A;  4J09 A;  1KHR A;  3DHO A;  4M99 A;  2GGQ A;  3GVD A;  4G87 A;  1QRL A;  3VBP A;  4E6T A; 
#chains in the Genus database with same CATH topology
 3BFP A;  4N6B A;  1QRM A;  3KWD A;  4E6U A;  3EG4 A;  4AA7 A;  4EA7 A;  3GUE A;  3R8Y A;  4HZD A;  5F42 A;  2WLE A;  1SSQ A;  4M2A A;  3R3I A;  5AFU V;  5AFU U;  3R1W A;  4EA8 A;  1EWW A;  4KPZ A;  2IU9 A;  2P2O A;  3FS8 A;  2IUA A;  5ADX V;  2JF2 A;  4G3P A;  1TDT A;  4IHG A;  4ISX A;  1KRV A;  3DJ4 A;  4EAA A;  2V0H A;  3BSY A;  3OU9 A;  2Q4J A;  2FKO A;  3GQA A;  1LXA A;  3BXY A;  3FWW A;  3SPT A;  2W0V A;  3SRT A;  3VBN A;  3EH0 A;  3FSB A;  4EAB A;  4EQY A;  2WLD A;  5U2K A;  4N69 A;  1YP2 A;  3CJ8 A;  3PMO A;  3R3R A;  1QRG A;  2QIA A;  1XHD A;  3C8V A;  3GQ9 A;  3R5A A;  4G3S A;  4AC3 A;  4E1K A;  2VD4 A;  2VHE A;  5DEP A;  3IXC A;  2OEG A;  1QQ0 A;  2IU8 A;  1SST A;  4IHF A;  3FSX A;  5DEM A;  2WLF A;  2GGO A;  1XAT A;  3D8V A;  4M98 A;  3TDT A;  3TV0 A;  1MRL A;  4HUS A;  5ADX U;  3GOS A;  3R0S A;  1T3D A;  2V0L A;  3R5C A;  3TK8 A;  1KK6 A;  3KWC A;  4AAW A;  3ECT A;  3GQ8 A;  3R5B A;  3TIO A;  3EEV A;  3OGZ A;  1KK5 A;  1KGT A;  3ST8 A;  3BRK X;  1FWY A;  3NZ2 A;  4KPX A;  3TIS A;  4MZU A;  3VBK A;  3BSW A;  3I3X A;  3VBJ A;  3DK5 A;  2V0J A;  1KGQ A;  1Z90 A;  2NPO A;  1KK4 A;  2OI7 A;  5DG3 A;  1V3W A;  2RIJ A;  1S80 A;  1SSM A;  3OTZ A;  4M28 A;  3VNP A;  3OH2 A;  2OEF A;  1Z2F A;  2QKX A;  3Q1X A;  4EA9 A;  2OI5 A;  2ICX A;  1YP3 A;  3I3A A;  3JQY A;  3MC4 A;  3OH3 A;  4N6A A;  3F1X A;  3FTT A;  4J18 A;  1G97 A;  3HSQ A;  3T57 A;  1KQA A;  1QRF A;  2TDT A;  3MQH A;  5E3R A;  3VBL A;  1QRE A;  4FCE A;  1HV9 A;  1N4I A;  3TWD A;  1L0S A;  4KNR A;  2QIV X;  3GQ7 A;  4R37 A;  3OH4 A;  2IC7 A;  3D98 A;  3VBI A;  3FSY A;  3BSS A;  4KNX A;  4MFG A;  1KRR A;  4E75 A;  4R36 A;  5E3P A;  1HM0 A;  4DCL A;  5L6S A;  2WLG A;  4R7P A;  1G95 A;  1THJ A;  1V67 A;  2XAT A;  3FSC A;  4M9C A;  3KWE A;  3R2W A;  4HZC A;  3OW5 A;  1J2Z A;  2OI6 A;  3OH1 A;  4K6R A;  2W0W A;  1OCX A;  3HJJ A;  4E79 A;  4HCQ A;  2JF3 A;  4HUR A;  1MR7 A;  3VBM A;  3P47 A;  4EGG A;  3MQG A;  2V0I A;  4N27 A;  4H7O A;  1FXJ A;  3R5D A;  1KRU A;  1HM8 A;  3OH0 A;  3OUP A;  2AQ9 A;  2V0K A;  2WLC A;  1YP4 A;  5E3Q A;  3IGJ A;  1HM9 A;  4IHH A;  5L6V A;  4G3Q A;  4KQL A;  4MYO A;  1MR9 A;  3FOQ A;  2I5K A;  4M2B A;  1M8N A;  3V4E A;  3OTM A;  3SUC A;  3P1B A;  2ICY A;  4J09 A;  1KHR A;  3DHO A;  4M99 A;  2GGQ A;  3GVD A;  4G87 A;  1QRL A;  3VBP A;  4E6T A; 
#chains in the Genus database with same CATH homology
 3BFP A;  4N6B A;  1QRM A;  3KWD A;  4E6U A;  3EG4 A;  4AA7 A;  4EA7 A;  3GUE A;  3R8Y A;  4HZD A;  5F42 A;  2WLE A;  1SSQ A;  4M2A A;  3R3I A;  5AFU V;  5AFU U;  3R1W A;  4EA8 A;  4KPZ A;  2IU9 A;  2P2O A;  3FS8 A;  2IUA A;  5ADX V;  2JF2 A;  4G3P A;  1TDT A;  4IHG A;  4ISX A;  1KRV A;  3DJ4 A;  4EAA A;  2V0H A;  3BSY A;  3OU9 A;  2Q4J A;  2FKO A;  1LXA A;  3BXY A;  3FWW A;  3SPT A;  2W0V A;  3SRT A;  3VBN A;  3EH0 A;  3FSB A;  4EAB A;  4EQY A;  2WLD A;  5U2K A;  4N69 A;  1YP2 A;  3CJ8 A;  3PMO A;  3R3R A;  1QRG A;  2QIA A;  1XHD A;  3C8V A;  3R5A A;  4G3S A;  4AC3 A;  4E1K A;  2VD4 A;  2VHE A;  5DEP A;  3IXC A;  2OEG A;  1QQ0 A;  2IU8 A;  1SST A;  4IHF A;  3FSX A;  5DEM A;  2WLF A;  2GGO A;  1XAT A;  3D8V A;  4M98 A;  3TDT A;  3TV0 A;  1MRL A;  4HUS A;  5ADX U;  3GOS A;  3R0S A;  1T3D A;  2V0L A;  3R5C A;  3TK8 A;  1KK6 A;  3KWC A;  4AAW A;  3ECT A;  3R5B A;  3TIO A;  3EEV A;  1KK5 A;  1KGT A;  3ST8 A;  3BRK X;  1FWY A;  3NZ2 A;  4KPX A;  3TIS A;  4MZU A;  3VBK A;  3BSW A;  3I3X A;  3VBJ A;  3DK5 A;  2V0J A;  1KGQ A;  1Z90 A;  2NPO A;  1KK4 A;  2OI7 A;  5DG3 A;  1V3W A;  2RIJ A;  1S80 A;  1SSM A;  3OTZ A;  4M28 A;  3VNP A;  2OEF A;  2QKX A;  3Q1X A;  4EA9 A;  2OI5 A;  2ICX A;  1YP3 A;  3I3A A;  3JQY A;  3MC4 A;  4N6A A;  3F1X A;  3FTT A;  4J18 A;  1G97 A;  3HSQ A;  3T57 A;  1KQA A;  1QRF A;  2TDT A;  3MQH A;  5E3R A;  3VBL A;  1QRE A;  4FCE A;  1HV9 A;  3TWD A;  4KNR A;  2QIV X;  4R37 A;  2IC7 A;  3D98 A;  3VBI A;  3FSY A;  3BSS A;  4KNX A;  4MFG A;  1KRR A;  4E75 A;  4R36 A;  5E3P A;  1HM0 A;  4DCL A;  5L6S A;  2WLG A;  4R7P A;  1G95 A;  1THJ A;  1V67 A;  2XAT A;  3FSC A;  4M9C A;  3KWE A;  3R2W A;  4HZC A;  3OW5 A;  1J2Z A;  2OI6 A;  4K6R A;  2W0W A;  1OCX A;  3HJJ A;  4E79 A;  4HCQ A;  2JF3 A;  4HUR A;  1MR7 A;  3VBM A;  3P47 A;  4EGG A;  3MQG A;  2V0I A;  4N27 A;  4H7O A;  1FXJ A;  3R5D A;  1KRU A;  1HM8 A;  3OUP A;  2AQ9 A;  2V0K A;  2WLC A;  1YP4 A;  5E3Q A;  3IGJ A;  1HM9 A;  4IHH A;  5L6V A;  4G3Q A;  4KQL A;  4MYO A;  1MR9 A;  3FOQ A;  2I5K A;  4M2B A;  3V4E A;  3OTM A;  3P1B A;  2ICY A;  4J09 A;  1KHR A;  3DHO A;  4M99 A;  2GGQ A;  3GVD A;  4G87 A;  1QRL A;  3VBP A;  4E6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...