4DCLA

Computationally designed self-assembling tetrahedron protein, t308, crystallized in space group f23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
188
structure length
188
Chain Sequence
MTEKEKMLAEKWYDANFDQTLINERLRAKVICFALNHTNPSATLKRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
molecule keywords Putative acetyltransferase SACOL2570
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
total genus 70
structure length 188
sequence length 188
ec nomenclature ec 2.3.1.-:
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4dclA00
1S80A 2P2OA 3SPTA 1G95A 3VNPA 1KK6A 1SSTA 3GOSA 3BSSA 3FSYA 4HZCA 2V0JA 3TISA 3P47A 3FSCA 4IHFA 2IUAA 4DCLA 3HJJA 2Q4JA 1T3DA 4MYOA 2WLEA 4EABA 2TDTA 5AFUV 1THJA 2GGOA 4N69A 3OUPA 3OTZA 3BSYA 3R5AA 3MQHA 3OTMA 3D8VA 1KRRA 3R2WA 3R5BA 3I3XA 5E3QA 4KNXA 3IXCA 4M2AA 3R0SA 4G3SA 1MR9A 4G3PA 5E3RA 2JF3A 1OCXA 3TV0A 2I5KA 1KK4A 3VBLA 4E6TA 3JQYA 4EAAA 2ICXA 1V3WA 2OEFA 1LXAA 3GVDA 5U2KA 3BXYA 2OI5A 3FSXA 1FWYA 2WLCA 1MR7A 1YP4A 4IHHA 3T57A 2WLGA 1QRGA 1KK5A 3KWCA 3VBIA 4J09A 4H7OA 5AFUU 1HM9A 3FWWA 3V4EA 2W0WA 3DHOA 3DK5A 2OI6A 3TDTA 4HURA 2WLDA 3TWDA 3OW5A 1FXJA 4M2BA 3FS8A 5ADXV 2FKOA 4HUSA 5E3PA 3BRKX 1HM8A 3OU9A 4MZUA 1KRUA 1G97A 3VBJA 3BSWA 4G87A 4HZDA 4AC3A 3R3RA 4E79A 5L6SA 3DJ4A 2OI7A 2V0LA 3KWEA 3R5CA 1QRLA 4KNRA 2QIAA 1QQ0A 2IU8A 2QKXA 4E6UA 3I3AA 3EG4A 1SSMA 2W0VA 2RIJA 4AA7A 3HSQA 3VBNA 4KPXA 4G3QA 4E1KA 2VD4A 1KHRA 3ECTA 4J18A 4M28A 3PMOA 4R36A 4HCQA 4N6AA 4R37A 1J2ZA 3TK8A 3VBKA 2NPOA 1QRMA 1XATA 3Q1XA 3KWDA 4KQLA 4ISXA 3R1WA 4KPZA 5DEPA 3NZ2A 3ST8A 5ADXU 4M99A 5DEMA 3C8VA 3FTTA 4EA7A 3SRTA 4EA8A 3GUEA 3D98A 4EA9A 2WLFA 1QREA 4AAWA 1SSQA 3R3IA 1YP3A 4EGGA 1HV9A 1QRFA 3IGJA 2QIVX 3FSBA 4M98A 4MFGA 4FCEA 3BFPA 1KQAA 3TIOA 2IU9A 4R7PA 3MC4A 1KRVA 1KGQA 2OEGA 2ICYA 3MQGA 1KGTA 5F42A 2VHEA 2JF2A 5L6VA 3R5DA 4N27A 2GGQA 3VBMA 3VBPA 2V0KA 1HM0A 1V67A 2IC7A 4M9CA 4EQYA 3R8YA 2V0HA 3EEVA 5DG3A 1YP2A 1XHDA 1MRLA 3FOQA 2V0IA 3CJ8A 4K6RA 3F1XA 2XATA 2AQ9A 4N6BA 4E75A 3EH0A 3P1BA 1TDTA 1Z90A 4IHGA
chains in the Genus database with same CATH superfamily
1S80A 2P2OA 3SPTA 3OH2A 1G95A 3VNPA 1KK6A 1SSTA 3GOSA 3BSSA 3FSYA 4HZCA 2V0JA 3TISA 3P47A 3FSCA 4IHFA 2IUAA 4DCLA 3HJJA 2Q4JA 1L0SA 1T3DA 4MYOA 2WLEA 4EABA 2TDTA 5AFUV 1THJA 2GGOA 4N69A 3OUPA 3OH4A 3OTZA 3BSYA 3R5AA 3MQHA 3OTMA 3D8VA 1KRRA 3OH1A 3R2WA 1EWWA 3R5BA 3I3XA 5E3QA 4KNXA 3IXCA 4M2AA 3R0SA 4G3SA 1MR9A 4G3PA 5E3RA 2JF3A 1OCXA 3TV0A 2I5KA 1KK4A 3VBLA 4E6TA 3OH0A 3JQYA 4EAAA 2ICXA 3GQ9A 1V3WA 2OEFA 1LXAA 3GVDA 5U2KA 3BXYA 2OI5A 3FSXA 1FWYA 2WLCA 1MR7A 1YP4A 4IHHA 3T57A 2WLGA 1QRGA 1KK5A 3KWCA 3VBIA 4J09A 4H7OA 5AFUU 1HM9A 3FWWA 3OH3A 3V4EA 2W0WA 3DHOA 3DK5A 2OI6A 3TDTA 4HURA 2WLDA 3TWDA 3OW5A 1FXJA 4M2BA 3FS8A 5ADXV 2FKOA 4HUSA 5E3PA 3BRKX 1HM8A 3OU9A 4MZUA 1KRUA 1G97A 3GQAA 3VBJA 3BSWA 4G87A 4HZDA 4AC3A 3R3RA 4E79A 5L6SA 3DJ4A 2OI7A 2V0LA 3KWEA 1M8NA 3R5CA 1QRLA 4KNRA 2QIAA 1QQ0A 2IU8A 2QKXA 4E6UA 3I3AA 3EG4A 1SSMA 2W0VA 2RIJA 4AA7A 3HSQA 3VBNA 4KPXA 4G3QA 4E1KA 1KHRA 2VD4A 3ECTA 4J18A 4M28A 3PMOA 4R36A 4HCQA 4N6AA 4R37A 1J2ZA 3TK8A 3VBKA 2NPOA 1Z2FA 3SUCA 1N4IA 1QRMA 1XATA 3Q1XA 3KWDA 4KQLA 4ISXA 3R1WA 4KPZA 5DEPA 3NZ2A 3ST8A 5ADXU 4M99A 5DEMA 3C8VA 3FTTA 4EA7A 3SRTA 4EA8A 3GUEA 3D98A 4EA9A 2WLFA 1QREA 4AAWA 1SSQA 3R3IA 1YP3A 3GQ8A 4EGGA 1HV9A 1QRFA 3IGJA 2QIVX 3FSBA 4M98A 4MFGA 4FCEA 3BFPA 1KQAA 3TIOA 2IU9A 4R7PA 3MC4A 1KRVA 1KGQA 2OEGA 2ICYA 3MQGA 1KGTA 5F42A 2VHEA 2JF2A 5L6VA 3R5DA 4N27A 2GGQA 3VBMA 3VBPA 2V0KA 1HM0A 1V67A 2IC7A 4M9CA 4EQYA 3R8YA 2V0HA 3EEVA 5DG3A 1YP2A 3GQ7A 1XHDA 1MRLA 3FOQA 2V0IA 3CJ8A 3OGZA 4K6RA 3F1XA 2XATA 2AQ9A 4N6BA 4E75A 3EH0A 3P1BA 1TDTA 1Z90A 4IHGA
chains in the Genus database with same CATH topology
1S80A 2P2OA 3SPTA 1G95A 3VNPA 1KK6A 1SSTA 3GOSA 3BSSA 3FSYA 4HZCA 2V0JA 3TISA 3P47A 3FSCA 4IHFA 2IUAA 4DCLA 3HJJA 2Q4JA 1T3DA 4MYOA 2WLEA 4EABA 2TDTA 5AFUV 1THJA 2GGOA 4N69A 3OUPA 3OTZA 3BSYA 3R5AA 3MQHA 3OTMA 3D8VA 1KRRA 3R2WA 3R5BA 3I3XA 5E3QA 4KNXA 3IXCA 4M2AA 3R0SA 4G3SA 1MR9A 4G3PA 5E3RA 2JF3A 1OCXA 3TV0A 2I5KA 1KK4A 3VBLA 4E6TA 3JQYA 4EAAA 2ICXA 1V3WA 2OEFA 1LXAA 3GVDA 5U2KA 3BXYA 2OI5A 3FSXA 1FWYA 2WLCA 1MR7A 1YP4A 4IHHA 3T57A 2WLGA 1QRGA 1KK5A 3KWCA 3VBIA 4J09A 4H7OA 5AFUU 1HM9A 3FWWA 3V4EA 2W0WA 3DHOA 3DK5A 2OI6A 3TDTA 4HURA 2WLDA 3TWDA 3OW5A 1FXJA 4M2BA 3FS8A 5ADXV 2FKOA 4HUSA 5E3PA 3BRKX 1HM8A 3OU9A 4MZUA 1KRUA 1G97A 3VBJA 3BSWA 4G87A 4HZDA 4AC3A 3R3RA 4E79A 5L6SA 3DJ4A 2OI7A 2V0LA 3KWEA 3R5CA 1QRLA 4KNRA 2QIAA 1QQ0A 2IU8A 2QKXA 4E6UA 3I3AA 3EG4A 1SSMA 2W0VA 2RIJA 4AA7A 3HSQA 3VBNA 4KPXA 4G3QA 4E1KA 2VD4A 1KHRA 3ECTA 4J18A 4M28A 3PMOA 4R36A 4HCQA 4N6AA 4R37A 1J2ZA 3TK8A 3VBKA 2NPOA 1QRMA 1XATA 3Q1XA 3KWDA 4KQLA 4ISXA 3R1WA 4KPZA 5DEPA 3NZ2A 3ST8A 5ADXU 4M99A 5DEMA 3C8VA 3FTTA 4EA7A 3SRTA 4EA8A 3GUEA 3D98A 4EA9A 2WLFA 1QREA 4AAWA 1SSQA 3R3IA 1YP3A 4EGGA 1HV9A 1QRFA 3IGJA 2QIVX 3FSBA 4M98A 4MFGA 4FCEA 3BFPA 1KQAA 3TIOA 2IU9A 4R7PA 3MC4A 1KRVA 1KGQA 2OEGA 2ICYA 3MQGA 1KGTA 5F42A 2VHEA 2JF2A 5L6VA 3R5DA 4N27A 2GGQA 3VBMA 3VBPA 2V0KA 1HM0A 1V67A 2IC7A 4M9CA 4EQYA 3R8YA 2V0HA 3EEVA 5DG3A 1YP2A 1XHDA 1MRLA 3FOQA 2V0IA 3CJ8A 4K6RA 3F1XA 2XATA 2AQ9A 4N6BA 4E75A 3EH0A 3P1BA 1TDTA 1Z90A 4IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S80 A;  2P2O A;  3SPT A;  1G95 A;  3VNP A;  1KK6 A;  1SST A;  3GOS A;  3BSS A;  3FSY A;  4HZC A;  2V0J A;  3TIS A;  3P47 A;  3FSC A;  4IHF A;  2IUA A;  4DCL A;  3HJJ A;  2Q4J A;  1T3D A;  4MYO A;  2WLE A;  4EAB A;  2TDT A;  5AFU V;  1THJ A;  2GGO A;  4N69 A;  3OUP A;  3OTZ A;  3BSY A;  3R5A A;  3MQH A;  3OTM A;  3D8V A;  1KRR A;  3R2W A;  3R5B A;  3I3X A;  5E3Q A;  4KNX A;  3IXC A;  4M2A A;  3R0S A;  4G3S A;  1MR9 A;  4G3P A;  5E3R A;  2JF3 A;  1OCX A;  3TV0 A;  2I5K A;  1KK4 A;  3VBL A;  4E6T A;  3JQY A;  4EAA A;  2ICX A;  1V3W A;  2OEF A;  1LXA A;  3GVD A;  5U2K A;  3BXY A;  2OI5 A;  3FSX A;  1FWY A;  2WLC A;  1MR7 A;  1YP4 A;  4IHH A;  3T57 A;  2WLG A;  1QRG A;  1KK5 A;  3KWC A;  3VBI A;  4J09 A;  4H7O A;  5AFU U;  1HM9 A;  3FWW A;  3V4E A;  2W0W A;  3DHO A;  3DK5 A;  2OI6 A;  3TDT A;  4HUR A;  2WLD A;  3TWD A;  3OW5 A;  1FXJ A;  4M2B A;  3FS8 A;  5ADX V;  2FKO A;  4HUS A;  5E3P A;  3BRK X;  1HM8 A;  3OU9 A;  4MZU A;  1KRU A;  1G97 A;  3VBJ A;  3BSW A;  4G87 A;  4HZD A;  4AC3 A;  3R3R A;  4E79 A;  5L6S A;  3DJ4 A;  2OI7 A;  2V0L A;  3KWE A;  3R5C A;  1QRL A;  4KNR A;  2QIA A;  1QQ0 A;  2IU8 A;  2QKX A;  4E6U A;  3I3A A;  3EG4 A;  1SSM A;  2W0V A;  2RIJ A;  4AA7 A;  3HSQ A;  3VBN A;  4KPX A;  4G3Q A;  4E1K A;  2VD4 A;  1KHR A;  3ECT A;  4J18 A;  4M28 A;  3PMO A;  4R36 A;  4HCQ A;  4N6A A;  4R37 A;  1J2Z A;  3TK8 A;  3VBK A;  2NPO A;  1QRM A;  1XAT A;  3Q1X A;  3KWD A;  4KQL A;  4ISX A;  3R1W A;  4KPZ A;  5DEP A;  3NZ2 A;  3ST8 A;  5ADX U;  4M99 A;  5DEM A;  3C8V A;  3FTT A;  4EA7 A;  3SRT A;  4EA8 A;  3GUE A;  3D98 A;  4EA9 A;  2WLF A;  1QRE A;  4AAW A;  1SSQ A;  3R3I A;  1YP3 A;  4EGG A;  1HV9 A;  1QRF A;  3IGJ A;  2QIV X;  3FSB A;  4M98 A;  4MFG A;  4FCE A;  3BFP A;  1KQA A;  3TIO A;  2IU9 A;  4R7P A;  3MC4 A;  1KRV A;  1KGQ A;  2OEG A;  2ICY A;  3MQG A;  1KGT A;  5F42 A;  2VHE A;  2JF2 A;  5L6V A;  3R5D A;  4N27 A;  2GGQ A;  3VBM A;  3VBP A;  2V0K A;  1HM0 A;  1V67 A;  2IC7 A;  4M9C A;  4EQY A;  3R8Y A;  2V0H A;  3EEV A;  5DG3 A;  1YP2 A;  1XHD A;  1MRL A;  3FOQ A;  2V0I A;  3CJ8 A;  4K6R A;  3F1X A;  2XAT A;  2AQ9 A;  4N6B A;  4E75 A;  3EH0 A;  3P1B A;  1TDT A;  1Z90 A;  4IHG A; 
#chains in the Genus database with same CATH topology
 1S80 A;  2P2O A;  3SPT A;  3OH2 A;  1G95 A;  3VNP A;  1KK6 A;  1SST A;  3GOS A;  3BSS A;  3FSY A;  4HZC A;  2V0J A;  3TIS A;  3P47 A;  3FSC A;  4IHF A;  2IUA A;  4DCL A;  3HJJ A;  2Q4J A;  1L0S A;  1T3D A;  4MYO A;  2WLE A;  4EAB A;  2TDT A;  5AFU V;  1THJ A;  2GGO A;  4N69 A;  3OUP A;  3OH4 A;  3OTZ A;  3BSY A;  3R5A A;  3MQH A;  3OTM A;  3D8V A;  1KRR A;  3OH1 A;  3R2W A;  1EWW A;  3R5B A;  3I3X A;  5E3Q A;  4KNX A;  3IXC A;  4M2A A;  3R0S A;  4G3S A;  1MR9 A;  4G3P A;  5E3R A;  2JF3 A;  1OCX A;  3TV0 A;  2I5K A;  1KK4 A;  3VBL A;  4E6T A;  3OH0 A;  3JQY A;  4EAA A;  2ICX A;  3GQ9 A;  1V3W A;  2OEF A;  1LXA A;  3GVD A;  5U2K A;  3BXY A;  2OI5 A;  3FSX A;  1FWY A;  2WLC A;  1MR7 A;  1YP4 A;  4IHH A;  3T57 A;  2WLG A;  1QRG A;  1KK5 A;  3KWC A;  3VBI A;  4J09 A;  4H7O A;  5AFU U;  1HM9 A;  3FWW A;  3OH3 A;  3V4E A;  2W0W A;  3DHO A;  3DK5 A;  2OI6 A;  3TDT A;  4HUR A;  2WLD A;  3TWD A;  3OW5 A;  1FXJ A;  4M2B A;  3FS8 A;  5ADX V;  2FKO A;  4HUS A;  5E3P A;  3BRK X;  1HM8 A;  3OU9 A;  4MZU A;  1KRU A;  1G97 A;  3GQA A;  3VBJ A;  3BSW A;  4G87 A;  4HZD A;  4AC3 A;  3R3R A;  4E79 A;  5L6S A;  3DJ4 A;  2OI7 A;  2V0L A;  3KWE A;  1M8N A;  3R5C A;  1QRL A;  4KNR A;  2QIA A;  1QQ0 A;  2IU8 A;  2QKX A;  4E6U A;  3I3A A;  3EG4 A;  1SSM A;  2W0V A;  2RIJ A;  4AA7 A;  3HSQ A;  3VBN A;  4KPX A;  4G3Q A;  4E1K A;  1KHR A;  2VD4 A;  3ECT A;  4J18 A;  4M28 A;  3PMO A;  4R36 A;  4HCQ A;  4N6A A;  4R37 A;  1J2Z A;  3TK8 A;  3VBK A;  2NPO A;  1Z2F A;  3SUC A;  1N4I A;  1QRM A;  1XAT A;  3Q1X A;  3KWD A;  4KQL A;  4ISX A;  3R1W A;  4KPZ A;  5DEP A;  3NZ2 A;  3ST8 A;  5ADX U;  4M99 A;  5DEM A;  3C8V A;  3FTT A;  4EA7 A;  3SRT A;  4EA8 A;  3GUE A;  3D98 A;  4EA9 A;  2WLF A;  1QRE A;  4AAW A;  1SSQ A;  3R3I A;  1YP3 A;  3GQ8 A;  4EGG A;  1HV9 A;  1QRF A;  3IGJ A;  2QIV X;  3FSB A;  4M98 A;  4MFG A;  4FCE A;  3BFP A;  1KQA A;  3TIO A;  2IU9 A;  4R7P A;  3MC4 A;  1KRV A;  1KGQ A;  2OEG A;  2ICY A;  3MQG A;  1KGT A;  5F42 A;  2VHE A;  2JF2 A;  5L6V A;  3R5D A;  4N27 A;  2GGQ A;  3VBM A;  3VBP A;  2V0K A;  1HM0 A;  1V67 A;  2IC7 A;  4M9C A;  4EQY A;  3R8Y A;  2V0H A;  3EEV A;  5DG3 A;  1YP2 A;  3GQ7 A;  1XHD A;  1MRL A;  3FOQ A;  2V0I A;  3CJ8 A;  3OGZ A;  4K6R A;  3F1X A;  2XAT A;  2AQ9 A;  4N6B A;  4E75 A;  3EH0 A;  3P1B A;  1TDT A;  1Z90 A;  4IHG A; 
#chains in the Genus database with same CATH homology
 1S80 A;  2P2O A;  3SPT A;  1G95 A;  3VNP A;  1KK6 A;  1SST A;  3GOS A;  3BSS A;  3FSY A;  4HZC A;  2V0J A;  3TIS A;  3P47 A;  3FSC A;  4IHF A;  2IUA A;  4DCL A;  3HJJ A;  2Q4J A;  1T3D A;  4MYO A;  2WLE A;  4EAB A;  2TDT A;  5AFU V;  1THJ A;  2GGO A;  4N69 A;  3OUP A;  3OTZ A;  3BSY A;  3R5A A;  3MQH A;  3OTM A;  3D8V A;  1KRR A;  3R2W A;  3R5B A;  3I3X A;  5E3Q A;  4KNX A;  3IXC A;  4M2A A;  3R0S A;  4G3S A;  1MR9 A;  4G3P A;  5E3R A;  2JF3 A;  1OCX A;  3TV0 A;  2I5K A;  1KK4 A;  3VBL A;  4E6T A;  3JQY A;  4EAA A;  2ICX A;  1V3W A;  2OEF A;  1LXA A;  3GVD A;  5U2K A;  3BXY A;  2OI5 A;  3FSX A;  1FWY A;  2WLC A;  1MR7 A;  1YP4 A;  4IHH A;  3T57 A;  2WLG A;  1QRG A;  1KK5 A;  3KWC A;  3VBI A;  4J09 A;  4H7O A;  5AFU U;  1HM9 A;  3FWW A;  3V4E A;  2W0W A;  3DHO A;  3DK5 A;  2OI6 A;  3TDT A;  4HUR A;  2WLD A;  3TWD A;  3OW5 A;  1FXJ A;  4M2B A;  3FS8 A;  5ADX V;  2FKO A;  4HUS A;  5E3P A;  3BRK X;  1HM8 A;  3OU9 A;  4MZU A;  1KRU A;  1G97 A;  3VBJ A;  3BSW A;  4G87 A;  4HZD A;  4AC3 A;  3R3R A;  4E79 A;  5L6S A;  3DJ4 A;  2OI7 A;  2V0L A;  3KWE A;  3R5C A;  1QRL A;  4KNR A;  2QIA A;  1QQ0 A;  2IU8 A;  2QKX A;  4E6U A;  3I3A A;  3EG4 A;  1SSM A;  2W0V A;  2RIJ A;  4AA7 A;  3HSQ A;  3VBN A;  4KPX A;  4G3Q A;  4E1K A;  2VD4 A;  1KHR A;  3ECT A;  4J18 A;  4M28 A;  3PMO A;  4R36 A;  4HCQ A;  4N6A A;  4R37 A;  1J2Z A;  3TK8 A;  3VBK A;  2NPO A;  1QRM A;  1XAT A;  3Q1X A;  3KWD A;  4KQL A;  4ISX A;  3R1W A;  4KPZ A;  5DEP A;  3NZ2 A;  3ST8 A;  5ADX U;  4M99 A;  5DEM A;  3C8V A;  3FTT A;  4EA7 A;  3SRT A;  4EA8 A;  3GUE A;  3D98 A;  4EA9 A;  2WLF A;  1QRE A;  4AAW A;  1SSQ A;  3R3I A;  1YP3 A;  4EGG A;  1HV9 A;  1QRF A;  3IGJ A;  2QIV X;  3FSB A;  4M98 A;  4MFG A;  4FCE A;  3BFP A;  1KQA A;  3TIO A;  2IU9 A;  4R7P A;  3MC4 A;  1KRV A;  1KGQ A;  2OEG A;  2ICY A;  3MQG A;  1KGT A;  5F42 A;  2VHE A;  2JF2 A;  5L6V A;  3R5D A;  4N27 A;  2GGQ A;  3VBM A;  3VBP A;  2V0K A;  1HM0 A;  1V67 A;  2IC7 A;  4M9C A;  4EQY A;  3R8Y A;  2V0H A;  3EEV A;  5DG3 A;  1YP2 A;  1XHD A;  1MRL A;  3FOQ A;  2V0I A;  3CJ8 A;  4K6R A;  3F1X A;  2XAT A;  2AQ9 A;  4N6B A;  4E75 A;  3EH0 A;  3P1B A;  1TDT A;  1Z90 A;  4IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...