5DEPA

Structure of pseudomonas aeruginosa lpxa in complex with udp-glcnac
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
MSLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.
pubmed doi rcsb
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
molecule tags Transferase
source organism Pseudomonas aeruginosa (strain pa7)
total genus 107
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 5depA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5depA01
3TV0A 2V0IA 3JQYA 2ICYA 3V4EA 4AA7A 4MYOA 1KGTA 2IU8A 2OI7A 3GUEA 4HCQA 4M2AA 1KRUA 2V0KA 3FSCA 1THJA 4HURA 3KWDA 3R5DA 4J18A 2V0HA 3EH0A 3FSBA 4EA8A 1KK4A 1KRVA 4EGGA 4KNRA 2WLCA 3F1XA 3KWCA 1YP3A 3VBJA 4E79A 2AQ9A 4EABA 2OI5A 4G3PA 3IGJA 3D8VA 3TWDA 1OCXA 3VBLA 2QKXA 1LXAA 3SRTA 4DCLA 4EA7A 3MQGA 3R5BA 2ICXA 2P2OA 5E3RA 3FWWA 1G97A 4AAWA 4N27A 4E6UA 2OI6A 1KK6A 3BFPA 3VBKA 4M98A 2IU9A 2FKOA 3P1BA 4R7PA 5E3PA 1HM9A 4FCEA 1KHRA 4EAAA 2IC7A 4MZUA 1Z90A 4N6BA 4IHGA 3R0SA 3MQHA 3R1WA 3TISA 3HSQA 3P47A 4J09A 2XATA 1SSQA 4G87A 2NPOA 4G3SA 2WLGA 1FWYA 5L6VA 3BSWA 1XATA 4ISXA 5DEMA 3EG4A 1HM0A 3FSXA 1QREA 4N6AA 3EEVA 1SSTA 4KQLA 5E3QA 3I3XA 3OTZA 3R3RA 2V0JA 3FOQA 2W0WA 3FS8A 4KPZA 3BSSA 5L6SA 1KK5A 4E75A 3CJ8A 1KRRA 3BRKX 4HUSA 3HJJA 4G3QA 3ST8A 3R2WA 1T3DA 4HZDA 3VBNA 4EQYA 2VD4A 4HZCA 1FXJA 3SPTA 1J2ZA 3D98A 3R5CA 3GVDA 3GOSA 2VHEA 1MR7A 2RIJA 4IHFA 5ADXU 4M2BA 2WLDA 3I3AA 2JF2A 3KWEA 3OW5A 1QRLA 3TIOA 3FTTA 3IXCA 2OEGA 4MFGA 4E6TA 1KQAA 2OEFA 2I5KA 1HV9A 3VNPA 2QIAA 2Q4JA 1TDTA 3Q1XA 3VBIA 3DHOA 3R5AA 1XHDA 2W0VA 3NZ2A 5ADXV 1YP2A 4KNXA 1MRLA 3C8VA 3BSYA 3ECTA 4M9CA 3BXYA 1YP4A 1G95A 3DJ4A 3PMOA 4N69A 2GGOA 1QQ0A 1S80A 4R36A 5DEPA 1QRFA 4H7OA 5F42A 2WLEA 1HM8A 3OTMA 4M99A 5AFUU 1QRGA 4E1KA 3OUPA 2TDTA 4R37A 1KGQA 3TK8A 3VBPA 2JF3A 2IUAA 1MR9A 2GGQA 1V3WA 4EA9A 3TDTA 1QRMA 3DK5A 3R8YA 1SSMA 4M28A 3T57A 3VBMA 4K6RA 2V0LA 4KPXA 1V67A 5AFUV 3FSYA 5DG3A 4AC3A 2QIVX 3OU9A 3R3IA 2WLFA 3MC4A 5U2KA 4IHHA
chains in the Genus database with same CATH superfamily
3TV0A 2V0IA 3JQYA 2ICYA 3V4EA 4AA7A 4MYOA 1KGTA 2IU8A 2OI7A 3GUEA 4HCQA 4M2AA 1KRUA 2V0KA 3FSCA 1THJA 4HURA 3KWDA 3R5DA 4J18A 2V0HA 3EH0A 3FSBA 4EA8A 1KK4A 1KRVA 4EGGA 4KNRA 2WLCA 3F1XA 3KWCA 1YP3A 3VBJA 4E79A 2AQ9A 4EABA 2OI5A 4G3PA 3IGJA 3D8VA 3TWDA 1OCXA 3VBLA 2QKXA 1LXAA 3SRTA 4DCLA 3GQ8A 3MQGA 3R5BA 4EA7A 2ICXA 2P2OA 5E3RA 3FWWA 1G97A 4AAWA 4N27A 4E6UA 1L0SA 2OI6A 1KK6A 3BFPA 3VBKA 4M98A 2IU9A 2FKOA 3P1BA 4R7PA 5E3PA 1HM9A 4FCEA 1KHRA 4EAAA 2IC7A 4MZUA 1Z90A 4N6BA 4IHGA 3R0SA 3MQHA 3R1WA 3TISA 3HSQA 3P47A 4J09A 2XATA 1SSQA 4G87A 2NPOA 4G3SA 2WLGA 1FWYA 5L6VA 3BSWA 3GQ9A 1XATA 4ISXA 5DEMA 3EG4A 1HM0A 3FSXA 3OH4A 1QREA 4N6AA 3EEVA 1SSTA 4KQLA 5E3QA 3I3XA 3OTZA 3R3RA 2V0JA 3FOQA 2W0WA 3FS8A 4KPZA 3BSSA 3OGZA 5L6SA 1KK5A 4E75A 3CJ8A 1KRRA 3BRKX 1EWWA 4HUSA 3HJJA 4G3QA 3ST8A 3R2WA 1T3DA 4HZDA 3VBNA 4EQYA 2VD4A 4HZCA 1FXJA 3SPTA 1J2ZA 3D98A 3R5CA 3GVDA 3GOSA 2VHEA 3SUCA 1MR7A 2RIJA 4IHFA 5ADXU 4M2BA 2WLDA 3I3AA 2JF2A 3KWEA 3OW5A 1QRLA 3OH1A 3TIOA 3FTTA 3IXCA 2OEGA 4MFGA 4E6TA 1KQAA 2OEFA 2I5KA 1HV9A 3VNPA 2QIAA 2Q4JA 1TDTA 3Q1XA 3VBIA 3DHOA 3OH3A 3R5AA 1XHDA 2W0VA 3NZ2A 5ADXV 1YP2A 4KNXA 1MRLA 3C8VA 3BSYA 3ECTA 3GQ7A 4M9CA 3BXYA 1YP4A 1G95A 3DJ4A 3PMOA 4N69A 2GGOA 1QQ0A 1S80A 4R36A 5DEPA 1M8NA 1QRFA 4H7OA 5F42A 2WLEA 1Z2FA 1HM8A 3OTMA 4M99A 1N4IA 5AFUU 1QRGA 4E1KA 3OUPA 2TDTA 4R37A 1KGQA 3TK8A 3VBPA 3GQAA 2JF3A 2IUAA 1MR9A 2GGQA 3OH2A 1V3WA 4EA9A 3TDTA 1QRMA 3DK5A 3R8YA 1SSMA 4M28A 3T57A 3VBMA 4K6RA 2V0LA 4KPXA 1V67A 3OH0A 3FSYA 5DG3A 5AFUV 2QIVX 4AC3A 3OU9A 3R3IA 2WLFA 3MC4A 5U2KA 4IHHA
chains in the Genus database with same CATH topology
3TV0A 2V0IA 3JQYA 2ICYA 3V4EA 4AA7A 4MYOA 1KGTA 2IU8A 2OI7A 3GUEA 4HCQA 4M2AA 1KRUA 2V0KA 3FSCA 1THJA 4HURA 3KWDA 3R5DA 4J18A 2V0HA 3EH0A 3FSBA 4EA8A 1KK4A 1KRVA 4EGGA 4KNRA 2WLCA 3F1XA 3KWCA 1YP3A 3VBJA 4E79A 2AQ9A 4EABA 2OI5A 4G3PA 3IGJA 3D8VA 3TWDA 1OCXA 3VBLA 2QKXA 1LXAA 3SRTA 4DCLA 4EA7A 3MQGA 3R5BA 2ICXA 2P2OA 5E3RA 3FWWA 1G97A 4AAWA 4N27A 4E6UA 2OI6A 1KK6A 3BFPA 3VBKA 4M98A 2IU9A 2FKOA 3P1BA 4R7PA 5E3PA 1HM9A 4FCEA 1KHRA 4EAAA 2IC7A 4MZUA 1Z90A 4N6BA 4IHGA 3R0SA 3MQHA 3R1WA 3TISA 3HSQA 3P47A 4J09A 2XATA 1SSQA 4G87A 2NPOA 4G3SA 2WLGA 1FWYA 5L6VA 3BSWA 1XATA 4ISXA 5DEMA 3EG4A 1HM0A 3FSXA 1QREA 4N6AA 3EEVA 1SSTA 4KQLA 5E3QA 3I3XA 3OTZA 3R3RA 2V0JA 3FOQA 2W0WA 3FS8A 4KPZA 3BSSA 5L6SA 1KK5A 4E75A 3CJ8A 1KRRA 3BRKX 4HUSA 3HJJA 4G3QA 3ST8A 3R2WA 1T3DA 4HZDA 3VBNA 4EQYA 2VD4A 4HZCA 1FXJA 3SPTA 1J2ZA 3D98A 3R5CA 3GVDA 3GOSA 2VHEA 1MR7A 2RIJA 4IHFA 5ADXU 4M2BA 2WLDA 3I3AA 2JF2A 3KWEA 3OW5A 1QRLA 3TIOA 3FTTA 3IXCA 2OEGA 4MFGA 4E6TA 1KQAA 2OEFA 2I5KA 1HV9A 3VNPA 2QIAA 2Q4JA 1TDTA 3Q1XA 3VBIA 3DHOA 3R5AA 1XHDA 2W0VA 3NZ2A 5ADXV 1YP2A 4KNXA 1MRLA 3C8VA 3BSYA 3ECTA 4M9CA 3BXYA 1YP4A 1G95A 3DJ4A 3PMOA 4N69A 2GGOA 1QQ0A 1S80A 4R36A 5DEPA 1QRFA 4H7OA 5F42A 2WLEA 1HM8A 3OTMA 4M99A 5AFUU 1QRGA 4E1KA 3OUPA 2TDTA 4R37A 1KGQA 3TK8A 3VBPA 2JF3A 2IUAA 1MR9A 2GGQA 1V3WA 4EA9A 3TDTA 1QRMA 3DK5A 3R8YA 1SSMA 4M28A 3T57A 3VBMA 4K6RA 2V0LA 4KPXA 1V67A 5AFUV 3FSYA 5DG3A 4AC3A 2QIVX 3OU9A 3R3IA 2WLFA 3MC4A 5U2KA 4IHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TV0 A;  2V0I A;  3JQY A;  2ICY A;  3V4E A;  4AA7 A;  4MYO A;  1KGT A;  2IU8 A;  2OI7 A;  3GUE A;  4HCQ A;  4M2A A;  1KRU A;  2V0K A;  3FSC A;  1THJ A;  4HUR A;  3KWD A;  3R5D A;  4J18 A;  2V0H A;  3EH0 A;  3FSB A;  4EA8 A;  1KK4 A;  1KRV A;  4EGG A;  4KNR A;  2WLC A;  3F1X A;  3KWC A;  1YP3 A;  3VBJ A;  4E79 A;  2AQ9 A;  4EAB A;  2OI5 A;  4G3P A;  3IGJ A;  3D8V A;  3TWD A;  1OCX A;  3VBL A;  2QKX A;  1LXA A;  3SRT A;  4DCL A;  4EA7 A;  3MQG A;  3R5B A;  2ICX A;  2P2O A;  5E3R A;  3FWW A;  1G97 A;  4AAW A;  4N27 A;  4E6U A;  2OI6 A;  1KK6 A;  3BFP A;  3VBK A;  4M98 A;  2IU9 A;  2FKO A;  3P1B A;  4R7P A;  5E3P A;  1HM9 A;  4FCE A;  1KHR A;  4EAA A;  2IC7 A;  4MZU A;  1Z90 A;  4N6B A;  4IHG A;  3R0S A;  3MQH A;  3R1W A;  3TIS A;  3HSQ A;  3P47 A;  4J09 A;  2XAT A;  1SSQ A;  4G87 A;  2NPO A;  4G3S A;  2WLG A;  1FWY A;  5L6V A;  3BSW A;  1XAT A;  4ISX A;  5DEM A;  3EG4 A;  1HM0 A;  3FSX A;  1QRE A;  4N6A A;  3EEV A;  1SST A;  4KQL A;  5E3Q A;  3I3X A;  3OTZ A;  3R3R A;  2V0J A;  3FOQ A;  2W0W A;  3FS8 A;  4KPZ A;  3BSS A;  5L6S A;  1KK5 A;  4E75 A;  3CJ8 A;  1KRR A;  3BRK X;  4HUS A;  3HJJ A;  4G3Q A;  3ST8 A;  3R2W A;  1T3D A;  4HZD A;  3VBN A;  4EQY A;  2VD4 A;  4HZC A;  1FXJ A;  3SPT A;  1J2Z A;  3D98 A;  3R5C A;  3GVD A;  3GOS A;  2VHE A;  1MR7 A;  2RIJ A;  4IHF A;  5ADX U;  4M2B A;  2WLD A;  3I3A A;  2JF2 A;  3KWE A;  3OW5 A;  1QRL A;  3TIO A;  3FTT A;  3IXC A;  2OEG A;  4MFG A;  4E6T A;  1KQA A;  2OEF A;  2I5K A;  1HV9 A;  3VNP A;  2QIA A;  2Q4J A;  1TDT A;  3Q1X A;  3VBI A;  3DHO A;  3R5A A;  1XHD A;  2W0V A;  3NZ2 A;  5ADX V;  1YP2 A;  4KNX A;  1MRL A;  3C8V A;  3BSY A;  3ECT A;  4M9C A;  3BXY A;  1YP4 A;  1G95 A;  3DJ4 A;  3PMO A;  4N69 A;  2GGO A;  1QQ0 A;  1S80 A;  4R36 A;  5DEP A;  1QRF A;  4H7O A;  5F42 A;  2WLE A;  1HM8 A;  3OTM A;  4M99 A;  5AFU U;  1QRG A;  4E1K A;  3OUP A;  2TDT A;  4R37 A;  1KGQ A;  3TK8 A;  3VBP A;  2JF3 A;  2IUA A;  1MR9 A;  2GGQ A;  1V3W A;  4EA9 A;  3TDT A;  1QRM A;  3DK5 A;  3R8Y A;  1SSM A;  4M28 A;  3T57 A;  3VBM A;  4K6R A;  2V0L A;  4KPX A;  1V67 A;  5AFU V;  3FSY A;  5DG3 A;  4AC3 A;  2QIV X;  3OU9 A;  3R3I A;  2WLF A;  3MC4 A;  5U2K A;  4IHH A; 
#chains in the Genus database with same CATH topology
 3TV0 A;  2V0I A;  3JQY A;  2ICY A;  3V4E A;  4AA7 A;  4MYO A;  1KGT A;  2IU8 A;  2OI7 A;  3GUE A;  4HCQ A;  4M2A A;  1KRU A;  2V0K A;  3FSC A;  1THJ A;  4HUR A;  3KWD A;  3R5D A;  4J18 A;  2V0H A;  3EH0 A;  3FSB A;  4EA8 A;  1KK4 A;  1KRV A;  4EGG A;  4KNR A;  2WLC A;  3F1X A;  3KWC A;  1YP3 A;  3VBJ A;  4E79 A;  2AQ9 A;  4EAB A;  2OI5 A;  4G3P A;  3IGJ A;  3D8V A;  3TWD A;  1OCX A;  3VBL A;  2QKX A;  1LXA A;  3SRT A;  4DCL A;  3GQ8 A;  3MQG A;  3R5B A;  4EA7 A;  2ICX A;  2P2O A;  5E3R A;  3FWW A;  1G97 A;  4AAW A;  4N27 A;  4E6U A;  1L0S A;  2OI6 A;  1KK6 A;  3BFP A;  3VBK A;  4M98 A;  2IU9 A;  2FKO A;  3P1B A;  4R7P A;  5E3P A;  1HM9 A;  4FCE A;  1KHR A;  4EAA A;  2IC7 A;  4MZU A;  1Z90 A;  4N6B A;  4IHG A;  3R0S A;  3MQH A;  3R1W A;  3TIS A;  3HSQ A;  3P47 A;  4J09 A;  2XAT A;  1SSQ A;  4G87 A;  2NPO A;  4G3S A;  2WLG A;  1FWY A;  5L6V A;  3BSW A;  3GQ9 A;  1XAT A;  4ISX A;  5DEM A;  3EG4 A;  1HM0 A;  3FSX A;  3OH4 A;  1QRE A;  4N6A A;  3EEV A;  1SST A;  4KQL A;  5E3Q A;  3I3X A;  3OTZ A;  3R3R A;  2V0J A;  3FOQ A;  2W0W A;  3FS8 A;  4KPZ A;  3BSS A;  3OGZ A;  5L6S A;  1KK5 A;  4E75 A;  3CJ8 A;  1KRR A;  3BRK X;  1EWW A;  4HUS A;  3HJJ A;  4G3Q A;  3ST8 A;  3R2W A;  1T3D A;  4HZD A;  3VBN A;  4EQY A;  2VD4 A;  4HZC A;  1FXJ A;  3SPT A;  1J2Z A;  3D98 A;  3R5C A;  3GVD A;  3GOS A;  2VHE A;  3SUC A;  1MR7 A;  2RIJ A;  4IHF A;  5ADX U;  4M2B A;  2WLD A;  3I3A A;  2JF2 A;  3KWE A;  3OW5 A;  1QRL A;  3OH1 A;  3TIO A;  3FTT A;  3IXC A;  2OEG A;  4MFG A;  4E6T A;  1KQA A;  2OEF A;  2I5K A;  1HV9 A;  3VNP A;  2QIA A;  2Q4J A;  1TDT A;  3Q1X A;  3VBI A;  3DHO A;  3OH3 A;  3R5A A;  1XHD A;  2W0V A;  3NZ2 A;  5ADX V;  1YP2 A;  4KNX A;  1MRL A;  3C8V A;  3BSY A;  3ECT A;  3GQ7 A;  4M9C A;  3BXY A;  1YP4 A;  1G95 A;  3DJ4 A;  3PMO A;  4N69 A;  2GGO A;  1QQ0 A;  1S80 A;  4R36 A;  5DEP A;  1M8N A;  1QRF A;  4H7O A;  5F42 A;  2WLE A;  1Z2F A;  1HM8 A;  3OTM A;  4M99 A;  1N4I A;  5AFU U;  1QRG A;  4E1K A;  3OUP A;  2TDT A;  4R37 A;  1KGQ A;  3TK8 A;  3VBP A;  3GQA A;  2JF3 A;  2IUA A;  1MR9 A;  2GGQ A;  3OH2 A;  1V3W A;  4EA9 A;  3TDT A;  1QRM A;  3DK5 A;  3R8Y A;  1SSM A;  4M28 A;  3T57 A;  3VBM A;  4K6R A;  2V0L A;  4KPX A;  1V67 A;  3OH0 A;  3FSY A;  5DG3 A;  5AFU V;  2QIV X;  4AC3 A;  3OU9 A;  3R3I A;  2WLF A;  3MC4 A;  5U2K A;  4IHH A; 
#chains in the Genus database with same CATH homology
 3TV0 A;  2V0I A;  3JQY A;  2ICY A;  3V4E A;  4AA7 A;  4MYO A;  1KGT A;  2IU8 A;  2OI7 A;  3GUE A;  4HCQ A;  4M2A A;  1KRU A;  2V0K A;  3FSC A;  1THJ A;  4HUR A;  3KWD A;  3R5D A;  4J18 A;  2V0H A;  3EH0 A;  3FSB A;  4EA8 A;  1KK4 A;  1KRV A;  4EGG A;  4KNR A;  2WLC A;  3F1X A;  3KWC A;  1YP3 A;  3VBJ A;  4E79 A;  2AQ9 A;  4EAB A;  2OI5 A;  4G3P A;  3IGJ A;  3D8V A;  3TWD A;  1OCX A;  3VBL A;  2QKX A;  1LXA A;  3SRT A;  4DCL A;  4EA7 A;  3MQG A;  3R5B A;  2ICX A;  2P2O A;  5E3R A;  3FWW A;  1G97 A;  4AAW A;  4N27 A;  4E6U A;  2OI6 A;  1KK6 A;  3BFP A;  3VBK A;  4M98 A;  2IU9 A;  2FKO A;  3P1B A;  4R7P A;  5E3P A;  1HM9 A;  4FCE A;  1KHR A;  4EAA A;  2IC7 A;  4MZU A;  1Z90 A;  4N6B A;  4IHG A;  3R0S A;  3MQH A;  3R1W A;  3TIS A;  3HSQ A;  3P47 A;  4J09 A;  2XAT A;  1SSQ A;  4G87 A;  2NPO A;  4G3S A;  2WLG A;  1FWY A;  5L6V A;  3BSW A;  1XAT A;  4ISX A;  5DEM A;  3EG4 A;  1HM0 A;  3FSX A;  1QRE A;  4N6A A;  3EEV A;  1SST A;  4KQL A;  5E3Q A;  3I3X A;  3OTZ A;  3R3R A;  2V0J A;  3FOQ A;  2W0W A;  3FS8 A;  4KPZ A;  3BSS A;  5L6S A;  1KK5 A;  4E75 A;  3CJ8 A;  1KRR A;  3BRK X;  4HUS A;  3HJJ A;  4G3Q A;  3ST8 A;  3R2W A;  1T3D A;  4HZD A;  3VBN A;  4EQY A;  2VD4 A;  4HZC A;  1FXJ A;  3SPT A;  1J2Z A;  3D98 A;  3R5C A;  3GVD A;  3GOS A;  2VHE A;  1MR7 A;  2RIJ A;  4IHF A;  5ADX U;  4M2B A;  2WLD A;  3I3A A;  2JF2 A;  3KWE A;  3OW5 A;  1QRL A;  3TIO A;  3FTT A;  3IXC A;  2OEG A;  4MFG A;  4E6T A;  1KQA A;  2OEF A;  2I5K A;  1HV9 A;  3VNP A;  2QIA A;  2Q4J A;  1TDT A;  3Q1X A;  3VBI A;  3DHO A;  3R5A A;  1XHD A;  2W0V A;  3NZ2 A;  5ADX V;  1YP2 A;  4KNX A;  1MRL A;  3C8V A;  3BSY A;  3ECT A;  4M9C A;  3BXY A;  1YP4 A;  1G95 A;  3DJ4 A;  3PMO A;  4N69 A;  2GGO A;  1QQ0 A;  1S80 A;  4R36 A;  5DEP A;  1QRF A;  4H7O A;  5F42 A;  2WLE A;  1HM8 A;  3OTM A;  4M99 A;  5AFU U;  1QRG A;  4E1K A;  3OUP A;  2TDT A;  4R37 A;  1KGQ A;  3TK8 A;  3VBP A;  2JF3 A;  2IUA A;  1MR9 A;  2GGQ A;  1V3W A;  4EA9 A;  3TDT A;  1QRM A;  3DK5 A;  3R8Y A;  1SSM A;  4M28 A;  3T57 A;  3VBM A;  4K6R A;  2V0L A;  4KPX A;  1V67 A;  5AFU V;  3FSY A;  5DG3 A;  4AC3 A;  2QIV X;  3OU9 A;  3R3I A;  2WLF A;  3MC4 A;  5U2K A;  4IHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...