5U2KA

Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Galactoside O-acetyltransferase complex with CoA (H3 space group)
rcsb
molecule keywords Galactoside O-acetyltransferase
molecule tags Transferase
source organism Staphylococcus aureus (strain col)
total genus 72
structure length 190
sequence length 190
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5u2kA00
4AC3A 2TDTA 3KWCA 3VBJA 3IXCA 3OU9A 2WLGA 4AA7A 1XATA 4KQLA 3D8VA 3ECTA 3OW5A 5DEPA 3BRKX 1G97A 5E3QA 4R7PA 3R8YA 4E6TA 2ICYA 5ADXU 2IU8A 2P2OA 3GOSA 5L6VA 5U2KA 1HM8A 1QRMA 3FSCA 5AFUV 1T3DA 1HV9A 3FSYA 3VNPA 1QREA 2IC7A 3BSWA 3D98A 1YP4A 4HZDA 4KNRA 3TK8A 4G3PA 3DK5A 1FXJA 1KRUA 2V0KA 3FWWA 3TWDA 3FSXA 1LXAA 4FCEA 1KGTA 1YP3A 3TISA 4M2BA 5ADXV 4M2AA 3GUEA 2V0IA 3MQGA 4N27A 3F1XA 3GVDA 3V4EA 4M28A 4KNXA 3TDTA 4EA9A 2W0WA 2WLCA 4HCQA 1KRRA 3FSBA 2GGQA 2VHEA 4IHGA 2QKXA 4N69A 3P47A 1SSQA 1S80A 3DJ4A 4N6BA 1KK4A 4J09A 4EQYA 3HSQA 3OUPA 4G87A 4MFGA 2OEGA 4E79A 3FS8A 4IHFA 3P1BA 4KPXA 2V0JA 2WLDA 3KWEA 1QQ0A 3VBMA 3R0SA 4MZUA 4E1KA 4E6UA 1QRLA 4EA8A 3DHOA 5DEMA 4HZCA 1QRFA 3BSYA 2W0VA 2ICXA 1J2ZA 3MQHA 4EAAA 3MC4A 1THJA 4R36A 3VBKA 1KGQA 3KWDA 3R5DA 2GGOA 3BXYA 2I5KA 1KRVA 4H7OA 2V0LA 3C8VA 4R37A 2JF2A 3R3RA 4M99A 3IGJA 3EG4A 4EABA 4KPZA 1QRGA 2WLEA 3R1WA 3VBIA 3EH0A 4EA7A 2OI5A 4N6AA 3Q1XA 2OI6A 3NZ2A 2XATA 4MYOA 4HURA 3T57A 4J18A 3HJJA 3BFPA 1V3WA 3CJ8A 3FTTA 3R5AA 4E75A 3ST8A 3JQYA 4G3SA 5E3PA 3EEVA 3R2WA 1FWYA 4K6RA 2FKOA 4IHHA 4ISXA 5F42A 2NPOA 1KK6A 1KQAA 2Q4JA 4G3QA 3OTMA 2V0HA 2JF3A 1SSMA 1MR9A 1MR7A 1XHDA 4HUSA 3R5CA 1KHRA 2QIVX 3VBLA 2QIAA 3R3IA 1HM0A 2AQ9A 3BSSA 1OCXA 4AAWA 5L6SA 5E3RA 3R5BA 3SPTA 1TDTA 3PMOA 1SSTA 1MRLA 3FOQA 3VBNA 1HM9A 4DCLA 2RIJA 4M98A 1G95A 1V67A 3SRTA 2OI7A 1YP2A 1Z90A 2IU9A 3OTZA 4M9CA 3TIOA 2VD4A 2WLFA 3VBPA 5DG3A 2IUAA 2OEFA 5AFUU 4EGGA 3TV0A 1KK5A 3I3XA 3I3AA
chains in the Genus database with same CATH superfamily
4AC3A 2TDTA 3KWCA 3VBJA 3IXCA 3OU9A 2WLGA 4AA7A 1XATA 4KQLA 3D8VA 3ECTA 3OH2A 3OW5A 3BRKX 1G97A 5DEPA 4R7PA 5E3QA 3R8YA 2ICYA 4E6TA 5ADXU 2IU8A 2P2OA 3GOSA 5L6VA 5U2KA 1HM8A 1QRMA 3FSCA 5AFUV 1T3DA 1HV9A 3FSYA 3VNPA 1QREA 2IC7A 3BSWA 3D98A 1YP4A 4HZDA 4KNRA 3TK8A 4G3PA 3DK5A 1FXJA 1KRUA 3GQ8A 2V0KA 3FWWA 3TWDA 3OH1A 3FSXA 1LXAA 4FCEA 1KGTA 1YP3A 3TISA 4M2BA 5ADXV 4M2AA 3GUEA 2V0IA 3MQGA 4N27A 3F1XA 3SUCA 3GVDA 3V4EA 4M28A 1EWWA 4KNXA 3TDTA 4EA9A 2W0WA 2WLCA 4HCQA 1KRRA 3FSBA 2GGQA 2VHEA 4IHGA 2QKXA 4N69A 3P47A 1SSQA 1S80A 3DJ4A 4N6BA 1KK4A 1N4IA 4J09A 4EQYA 3HSQA 3OUPA 4G87A 4MFGA 2OEGA 4E79A 3FS8A 4IHFA 3P1BA 4KPXA 2V0JA 2WLDA 3KWEA 1QQ0A 3VBMA 3R0SA 4MZUA 4E1KA 4E6UA 1QRLA 4EA8A 3OH0A 3DHOA 5DEMA 4HZCA 1QRFA 3BSYA 2W0VA 2ICXA 3GQAA 1J2ZA 3MQHA 4EAAA 3MC4A 1THJA 4R36A 3VBKA 1KGQA 3KWDA 3R5DA 2GGOA 3BXYA 2I5KA 1KRVA 4H7OA 2V0LA 3C8VA 4R37A 2JF2A 3R3RA 4M99A 3IGJA 3EG4A 4EABA 4KPZA 1QRGA 2WLEA 1Z2FA 3R1WA 3EH0A 3VBIA 2OI5A 4N6AA 4EA7A 3Q1XA 2OI6A 3NZ2A 2XATA 4MYOA 4HURA 3T57A 4J18A 3HJJA 3BFPA 1V3WA 3CJ8A 3FTTA 3R5AA 4E75A 3ST8A 3JQYA 4G3SA 5E3PA 3EEVA 3R2WA 1FWYA 4K6RA 2FKOA 4IHHA 4ISXA 5F42A 2NPOA 1KK6A 1KQAA 3OH4A 3GQ9A 2Q4JA 4G3QA 3OTMA 2V0HA 2JF3A 1SSMA 1MR9A 1MR7A 1XHDA 4HUSA 3R5CA 1KHRA 2QIVX 3VBLA 1M8NA 2QIAA 3R3IA 1HM0A 2AQ9A 3BSSA 1OCXA 4AAWA 5L6SA 5E3RA 3R5BA 3SPTA 1TDTA 3GQ7A 1L0SA 3PMOA 1SSTA 1MRLA 3FOQA 3VBNA 1HM9A 4DCLA 2RIJA 3OGZA 1G95A 1V67A 4M98A 3SRTA 2OI7A 1YP2A 1Z90A 2IU9A 3OTZA 4M9CA 3TIOA 2VD4A 2WLFA 3OH3A 3VBPA 5DG3A 2IUAA 2OEFA 5AFUU 4EGGA 3TV0A 1KK5A 3I3XA 3I3AA
chains in the Genus database with same CATH topology
4AC3A 2TDTA 3KWCA 3VBJA 3IXCA 3OU9A 2WLGA 4AA7A 1XATA 4KQLA 3D8VA 3ECTA 3OW5A 5DEPA 3BRKX 1G97A 5E3QA 4R7PA 3R8YA 4E6TA 2ICYA 5ADXU 2IU8A 2P2OA 3GOSA 5L6VA 5U2KA 1HM8A 1QRMA 3FSCA 5AFUV 1T3DA 1HV9A 3FSYA 3VNPA 1QREA 2IC7A 3BSWA 3D98A 1YP4A 4HZDA 4KNRA 3TK8A 4G3PA 3DK5A 1FXJA 1KRUA 2V0KA 3FWWA 3TWDA 3FSXA 1LXAA 4FCEA 1KGTA 1YP3A 3TISA 4M2BA 5ADXV 4M2AA 3GUEA 2V0IA 3MQGA 4N27A 3F1XA 3GVDA 3V4EA 4M28A 4KNXA 3TDTA 4EA9A 2W0WA 2WLCA 4HCQA 1KRRA 3FSBA 2GGQA 2VHEA 4IHGA 2QKXA 4N69A 3P47A 1SSQA 1S80A 3DJ4A 4N6BA 1KK4A 4J09A 4EQYA 3HSQA 3OUPA 4G87A 4MFGA 2OEGA 4E79A 3FS8A 4IHFA 3P1BA 4KPXA 2V0JA 2WLDA 3KWEA 1QQ0A 3VBMA 3R0SA 4MZUA 4E1KA 4E6UA 1QRLA 4EA8A 3DHOA 5DEMA 4HZCA 1QRFA 3BSYA 2W0VA 2ICXA 1J2ZA 3MQHA 4EAAA 3MC4A 1THJA 4R36A 3VBKA 1KGQA 3KWDA 3R5DA 2GGOA 3BXYA 2I5KA 1KRVA 4H7OA 2V0LA 3C8VA 4R37A 2JF2A 3R3RA 4M99A 3IGJA 3EG4A 4EABA 4KPZA 1QRGA 2WLEA 3R1WA 3VBIA 3EH0A 4EA7A 2OI5A 4N6AA 3Q1XA 2OI6A 3NZ2A 2XATA 4MYOA 4HURA 3T57A 4J18A 3HJJA 3BFPA 1V3WA 3CJ8A 3FTTA 3R5AA 4E75A 3ST8A 3JQYA 4G3SA 5E3PA 3EEVA 3R2WA 1FWYA 4K6RA 2FKOA 4IHHA 4ISXA 5F42A 2NPOA 1KK6A 1KQAA 2Q4JA 4G3QA 3OTMA 2V0HA 2JF3A 1SSMA 1MR9A 1MR7A 1XHDA 4HUSA 3R5CA 1KHRA 2QIVX 3VBLA 2QIAA 3R3IA 1HM0A 2AQ9A 3BSSA 1OCXA 4AAWA 5L6SA 5E3RA 3R5BA 3SPTA 1TDTA 3PMOA 1SSTA 1MRLA 3FOQA 3VBNA 1HM9A 4DCLA 2RIJA 4M98A 1G95A 1V67A 3SRTA 2OI7A 1YP2A 1Z90A 2IU9A 3OTZA 4M9CA 3TIOA 2VD4A 2WLFA 3VBPA 5DG3A 2IUAA 2OEFA 5AFUU 4EGGA 3TV0A 1KK5A 3I3XA 3I3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC3 A;  2TDT A;  3KWC A;  3VBJ A;  3IXC A;  3OU9 A;  2WLG A;  4AA7 A;  1XAT A;  4KQL A;  3D8V A;  3ECT A;  3OW5 A;  5DEP A;  3BRK X;  1G97 A;  5E3Q A;  4R7P A;  3R8Y A;  4E6T A;  2ICY A;  5ADX U;  2IU8 A;  2P2O A;  3GOS A;  5L6V A;  5U2K A;  1HM8 A;  1QRM A;  3FSC A;  5AFU V;  1T3D A;  1HV9 A;  3FSY A;  3VNP A;  1QRE A;  2IC7 A;  3BSW A;  3D98 A;  1YP4 A;  4HZD A;  4KNR A;  3TK8 A;  4G3P A;  3DK5 A;  1FXJ A;  1KRU A;  2V0K A;  3FWW A;  3TWD A;  3FSX A;  1LXA A;  4FCE A;  1KGT A;  1YP3 A;  3TIS A;  4M2B A;  5ADX V;  4M2A A;  3GUE A;  2V0I A;  3MQG A;  4N27 A;  3F1X A;  3GVD A;  3V4E A;  4M28 A;  4KNX A;  3TDT A;  4EA9 A;  2W0W A;  2WLC A;  4HCQ A;  1KRR A;  3FSB A;  2GGQ A;  2VHE A;  4IHG A;  2QKX A;  4N69 A;  3P47 A;  1SSQ A;  1S80 A;  3DJ4 A;  4N6B A;  1KK4 A;  4J09 A;  4EQY A;  3HSQ A;  3OUP A;  4G87 A;  4MFG A;  2OEG A;  4E79 A;  3FS8 A;  4IHF A;  3P1B A;  4KPX A;  2V0J A;  2WLD A;  3KWE A;  1QQ0 A;  3VBM A;  3R0S A;  4MZU A;  4E1K A;  4E6U A;  1QRL A;  4EA8 A;  3DHO A;  5DEM A;  4HZC A;  1QRF A;  3BSY A;  2W0V A;  2ICX A;  1J2Z A;  3MQH A;  4EAA A;  3MC4 A;  1THJ A;  4R36 A;  3VBK A;  1KGQ A;  3KWD A;  3R5D A;  2GGO A;  3BXY A;  2I5K A;  1KRV A;  4H7O A;  2V0L A;  3C8V A;  4R37 A;  2JF2 A;  3R3R A;  4M99 A;  3IGJ A;  3EG4 A;  4EAB A;  4KPZ A;  1QRG A;  2WLE A;  3R1W A;  3VBI A;  3EH0 A;  4EA7 A;  2OI5 A;  4N6A A;  3Q1X A;  2OI6 A;  3NZ2 A;  2XAT A;  4MYO A;  4HUR A;  3T57 A;  4J18 A;  3HJJ A;  3BFP A;  1V3W A;  3CJ8 A;  3FTT A;  3R5A A;  4E75 A;  3ST8 A;  3JQY A;  4G3S A;  5E3P A;  3EEV A;  3R2W A;  1FWY A;  4K6R A;  2FKO A;  4IHH A;  4ISX A;  5F42 A;  2NPO A;  1KK6 A;  1KQA A;  2Q4J A;  4G3Q A;  3OTM A;  2V0H A;  2JF3 A;  1SSM A;  1MR9 A;  1MR7 A;  1XHD A;  4HUS A;  3R5C A;  1KHR A;  2QIV X;  3VBL A;  2QIA A;  3R3I A;  1HM0 A;  2AQ9 A;  3BSS A;  1OCX A;  4AAW A;  5L6S A;  5E3R A;  3R5B A;  3SPT A;  1TDT A;  3PMO A;  1SST A;  1MRL A;  3FOQ A;  3VBN A;  1HM9 A;  4DCL A;  2RIJ A;  4M98 A;  1G95 A;  1V67 A;  3SRT A;  2OI7 A;  1YP2 A;  1Z90 A;  2IU9 A;  3OTZ A;  4M9C A;  3TIO A;  2VD4 A;  2WLF A;  3VBP A;  5DG3 A;  2IUA A;  2OEF A;  5AFU U;  4EGG A;  3TV0 A;  1KK5 A;  3I3X A;  3I3A A; 
#chains in the Genus database with same CATH topology
 4AC3 A;  2TDT A;  3KWC A;  3VBJ A;  3IXC A;  3OU9 A;  2WLG A;  4AA7 A;  1XAT A;  4KQL A;  3D8V A;  3ECT A;  3OH2 A;  3OW5 A;  3BRK X;  1G97 A;  5DEP A;  4R7P A;  5E3Q A;  3R8Y A;  2ICY A;  4E6T A;  5ADX U;  2IU8 A;  2P2O A;  3GOS A;  5L6V A;  5U2K A;  1HM8 A;  1QRM A;  3FSC A;  5AFU V;  1T3D A;  1HV9 A;  3FSY A;  3VNP A;  1QRE A;  2IC7 A;  3BSW A;  3D98 A;  1YP4 A;  4HZD A;  4KNR A;  3TK8 A;  4G3P A;  3DK5 A;  1FXJ A;  1KRU A;  3GQ8 A;  2V0K A;  3FWW A;  3TWD A;  3OH1 A;  3FSX A;  1LXA A;  4FCE A;  1KGT A;  1YP3 A;  3TIS A;  4M2B A;  5ADX V;  4M2A A;  3GUE A;  2V0I A;  3MQG A;  4N27 A;  3F1X A;  3SUC A;  3GVD A;  3V4E A;  4M28 A;  1EWW A;  4KNX A;  3TDT A;  4EA9 A;  2W0W A;  2WLC A;  4HCQ A;  1KRR A;  3FSB A;  2GGQ A;  2VHE A;  4IHG A;  2QKX A;  4N69 A;  3P47 A;  1SSQ A;  1S80 A;  3DJ4 A;  4N6B A;  1KK4 A;  1N4I A;  4J09 A;  4EQY A;  3HSQ A;  3OUP A;  4G87 A;  4MFG A;  2OEG A;  4E79 A;  3FS8 A;  4IHF A;  3P1B A;  4KPX A;  2V0J A;  2WLD A;  3KWE A;  1QQ0 A;  3VBM A;  3R0S A;  4MZU A;  4E1K A;  4E6U A;  1QRL A;  4EA8 A;  3OH0 A;  3DHO A;  5DEM A;  4HZC A;  1QRF A;  3BSY A;  2W0V A;  2ICX A;  3GQA A;  1J2Z A;  3MQH A;  4EAA A;  3MC4 A;  1THJ A;  4R36 A;  3VBK A;  1KGQ A;  3KWD A;  3R5D A;  2GGO A;  3BXY A;  2I5K A;  1KRV A;  4H7O A;  2V0L A;  3C8V A;  4R37 A;  2JF2 A;  3R3R A;  4M99 A;  3IGJ A;  3EG4 A;  4EAB A;  4KPZ A;  1QRG A;  2WLE A;  1Z2F A;  3R1W A;  3EH0 A;  3VBI A;  2OI5 A;  4N6A A;  4EA7 A;  3Q1X A;  2OI6 A;  3NZ2 A;  2XAT A;  4MYO A;  4HUR A;  3T57 A;  4J18 A;  3HJJ A;  3BFP A;  1V3W A;  3CJ8 A;  3FTT A;  3R5A A;  4E75 A;  3ST8 A;  3JQY A;  4G3S A;  5E3P A;  3EEV A;  3R2W A;  1FWY A;  4K6R A;  2FKO A;  4IHH A;  4ISX A;  5F42 A;  2NPO A;  1KK6 A;  1KQA A;  3OH4 A;  3GQ9 A;  2Q4J A;  4G3Q A;  3OTM A;  2V0H A;  2JF3 A;  1SSM A;  1MR9 A;  1MR7 A;  1XHD A;  4HUS A;  3R5C A;  1KHR A;  2QIV X;  3VBL A;  1M8N A;  2QIA A;  3R3I A;  1HM0 A;  2AQ9 A;  3BSS A;  1OCX A;  4AAW A;  5L6S A;  5E3R A;  3R5B A;  3SPT A;  1TDT A;  3GQ7 A;  1L0S A;  3PMO A;  1SST A;  1MRL A;  3FOQ A;  3VBN A;  1HM9 A;  4DCL A;  2RIJ A;  3OGZ A;  1G95 A;  1V67 A;  4M98 A;  3SRT A;  2OI7 A;  1YP2 A;  1Z90 A;  2IU9 A;  3OTZ A;  4M9C A;  3TIO A;  2VD4 A;  2WLF A;  3OH3 A;  3VBP A;  5DG3 A;  2IUA A;  2OEF A;  5AFU U;  4EGG A;  3TV0 A;  1KK5 A;  3I3X A;  3I3A A; 
#chains in the Genus database with same CATH homology
 4AC3 A;  2TDT A;  3KWC A;  3VBJ A;  3IXC A;  3OU9 A;  2WLG A;  4AA7 A;  1XAT A;  4KQL A;  3D8V A;  3ECT A;  3OW5 A;  5DEP A;  3BRK X;  1G97 A;  5E3Q A;  4R7P A;  3R8Y A;  4E6T A;  2ICY A;  5ADX U;  2IU8 A;  2P2O A;  3GOS A;  5L6V A;  5U2K A;  1HM8 A;  1QRM A;  3FSC A;  5AFU V;  1T3D A;  1HV9 A;  3FSY A;  3VNP A;  1QRE A;  2IC7 A;  3BSW A;  3D98 A;  1YP4 A;  4HZD A;  4KNR A;  3TK8 A;  4G3P A;  3DK5 A;  1FXJ A;  1KRU A;  2V0K A;  3FWW A;  3TWD A;  3FSX A;  1LXA A;  4FCE A;  1KGT A;  1YP3 A;  3TIS A;  4M2B A;  5ADX V;  4M2A A;  3GUE A;  2V0I A;  3MQG A;  4N27 A;  3F1X A;  3GVD A;  3V4E A;  4M28 A;  4KNX A;  3TDT A;  4EA9 A;  2W0W A;  2WLC A;  4HCQ A;  1KRR A;  3FSB A;  2GGQ A;  2VHE A;  4IHG A;  2QKX A;  4N69 A;  3P47 A;  1SSQ A;  1S80 A;  3DJ4 A;  4N6B A;  1KK4 A;  4J09 A;  4EQY A;  3HSQ A;  3OUP A;  4G87 A;  4MFG A;  2OEG A;  4E79 A;  3FS8 A;  4IHF A;  3P1B A;  4KPX A;  2V0J A;  2WLD A;  3KWE A;  1QQ0 A;  3VBM A;  3R0S A;  4MZU A;  4E1K A;  4E6U A;  1QRL A;  4EA8 A;  3DHO A;  5DEM A;  4HZC A;  1QRF A;  3BSY A;  2W0V A;  2ICX A;  1J2Z A;  3MQH A;  4EAA A;  3MC4 A;  1THJ A;  4R36 A;  3VBK A;  1KGQ A;  3KWD A;  3R5D A;  2GGO A;  3BXY A;  2I5K A;  1KRV A;  4H7O A;  2V0L A;  3C8V A;  4R37 A;  2JF2 A;  3R3R A;  4M99 A;  3IGJ A;  3EG4 A;  4EAB A;  4KPZ A;  1QRG A;  2WLE A;  3R1W A;  3VBI A;  3EH0 A;  4EA7 A;  2OI5 A;  4N6A A;  3Q1X A;  2OI6 A;  3NZ2 A;  2XAT A;  4MYO A;  4HUR A;  3T57 A;  4J18 A;  3HJJ A;  3BFP A;  1V3W A;  3CJ8 A;  3FTT A;  3R5A A;  4E75 A;  3ST8 A;  3JQY A;  4G3S A;  5E3P A;  3EEV A;  3R2W A;  1FWY A;  4K6R A;  2FKO A;  4IHH A;  4ISX A;  5F42 A;  2NPO A;  1KK6 A;  1KQA A;  2Q4J A;  4G3Q A;  3OTM A;  2V0H A;  2JF3 A;  1SSM A;  1MR9 A;  1MR7 A;  1XHD A;  4HUS A;  3R5C A;  1KHR A;  2QIV X;  3VBL A;  2QIA A;  3R3I A;  1HM0 A;  2AQ9 A;  3BSS A;  1OCX A;  4AAW A;  5L6S A;  5E3R A;  3R5B A;  3SPT A;  1TDT A;  3PMO A;  1SST A;  1MRL A;  3FOQ A;  3VBN A;  1HM9 A;  4DCL A;  2RIJ A;  4M98 A;  1G95 A;  1V67 A;  3SRT A;  2OI7 A;  1YP2 A;  1Z90 A;  2IU9 A;  3OTZ A;  4M9C A;  3TIO A;  2VD4 A;  2WLF A;  3VBP A;  5DG3 A;  2IUA A;  2OEF A;  5AFU U;  4EGG A;  3TV0 A;  1KK5 A;  3I3X A;  3I3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...