1AW8B

Pyruvoyl dependent aspartate decarboxylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Decarboxylase
molecule keywords L-ASPARTATE-ALPHA-DECARBOXYLASE
publication title Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 90
sequence length 90
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 1997-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aw8B00
2Y0SA 3O5AA 5T5MD 4DMRA 1VC3B 1WLFA 5FTJA 1TWFA 1E18A 1Y1WA 5B6CA 4AAYA 1CR5A 1H0HA 3HU3A 3GTMA 4AONB 1R27A 2R93A 4AYBA 1E5VA 3CF2A 3TIWA 4CS0A 1UHEA 1KQFA 1H5NA 2KI8A 1IW7D 4CRYG 2JIRA 2EEOB 1FDOA 1TWHA 1QDNA 2PMZA 4GA6A 1AW8B 3QQ8A 2JIPA 5EPPA 3QQ7A 2NYAA 3HU2A 1R9TA 3QWZA 1KQGA 1YLEA 3GTOA 3OUGA 3PLXB 1TWCA 2B63A 1G8KA 1PT0A 1R7RA 3HKZA 1AA6A 4C2MA 4GA5A 4KLNA 5FTLA 1Y4ZA 2E7ZA 1CZ5A 2JIOA 2VUMA 3DMRA 3GTLA 4D7ZB 5DYIA 2V3VA 2JA6A 2V45A 2PJHB 3IR5A 1DMSA 5C1BA 2VPXA 1PPYA 5T5ID 1TMOA 3GTJA 1EU1A 2R7ZA 2NVYA 1PYQA 3IR7A 1G8JA 1PYUB 3QC8A 2E2HA 3ML1A 2NVXA 2JIQA 1Q16A 3GTKA 1PQEA 2JIMA 2NAPA 4AOKB 2WB1A 1PQFA 3HU1A 1UHDA 1Y1VA 2YU9A 1DMRA 1I50A 2IV2X 2E2IA 1OGYA 2C45A 1S3SA 4RV0A 5DYGA 3GTQA 1SIWA 4KDIA 3GTGA 1WCMA 1QCSA 2DMRA 1I3QA 4KODA 4CRZA 3TM7B 2VPYA 4QIWA 5FTMA 1E32A 3CQZA 2JA5A 2VPWA 1FDIA 1K83A 3H0GA 2WAQA 1CZ4A 1PT1A 4KDLA 1E61A 3IR6A 5FTNA 1TWGA 3FKIA 5FTKA 4AZDA 1PQHA 5C18A 1TWAA 4KO8A 1SFOA 3GTPA 5GLFA 1Y5IA 2VPZA 1E60A 2JA7A 2R92A
chains in the Genus database with same CATH superfamily
2A68D 3SUKA 2Y0SA 2ENGA 3O5AA 2A6ED 1VC3B 1WLFA 5FTJA 1TWFA 1E18A 5T5MD 4DMRA 1Y1WA 3SUMA 3X2JA 5B6CA 4AAYA 1CR5A 2GAEA 1OA9A 1H0HA 3HU3A 3GTMA 4ENGA 3X2NA 4AONB 1R27A 2R93A 4AYBA 2G6GA 1E5VA 3CF2A 3TIWA 4CS0A 4JCWA 1UHEA 1KQFA 1H5NA 2CW0D 2KI8A 1IW7D 4CRYG 2JIRA 2EEOB 1FDOA 4FG2A 3X2KA 1TWHA 1QDNA 4FG4A 3X2LA 2PMZA 4GA6A 3SULA 1SMYD 3X2MA 5GM9A 1AW8B 2HCZX 3QQ8A 2JIPA 5EPPA 3QQ7A 2NYAA 3HU2A 1WC2A 1BW3A 2A6HD 1R9TA 3QWZA 4JP7A 1L8FA 1KQGA 1YLEA 3GTOA 1N10A 4NOHA 3OUGA 1OA7A 3PLXB 1TWCA 2B63A 1G8KA 2VPZA 1PT0A 3X2GA 1R7RA 2A69D 3HKZA 1YNND 3M3GA 4C2MA 1AA6A 3X2IA 2PNWA 4GA5A 4L48A 4KLNA 5FTLA 1Y4ZA 2E7ZA 3D30A 4FFTA 1CZ5A 2JIOA 2VUMA 4JS7A 2O5JD 3DMRA 3GTLA 4D7ZB 2PICA 5DYIA 2V3VA 2JA6A 2V45A 2PJHB 3IR5A 1DMSA 5C1BA 2VPXA 1PPYA 5T5ID 1TMOA 3GTJA 1EU1A 2R7ZA 2NVYA 1PYQA 3IR7A 1G8JA 1PYUB 2G5DA 3QC8A 2E2HA 3ML1A 2PJJA 2NVXA 2JIQA 1Q16A 4AVRA 2KQAA 3GTKA 1PQEA 2JIMA 1ZYRD 2NAPA 4AOKB 2WB1A 1PQFA 3HU1A 1UHDA 1Y1VA 2YU9A 1DMRA 1I50A 2IV2X 2E2IA 1OGYA 2C45A 1S3SA 4RV0A 5DYGA 3GTQA 1SIWA 4KDIA 3GTGA 3X2PA 1WCMA 4FERA 1QCSA 2DMRA 3X2OA 4JJOA 4KODA 5GLXA 4CRZA 1I3QA 3TM7B 2VPYA 4QIWA 3ENGA 5FTMA 1E32A 3CZBA 3CQZA 5H4UA 2JA5A 2VPWA 4JP6A 1ZC1A 1FDIA 1K83A 3H0GA 2WAQA 2BE5D 1CZ4A 1PT1A 4KDLA 1E61A 4ZM7A 3IR6A 5FTNA 1TWGA 3FKIA 5FTKA 4AZDA 2AE0X 2YUJA 1PQHA 5C18A 5GLYA 3X2HA 1TWAA 1BW4A 4KO8A 1SFOA 3GTPA 5GLFA 1HD5A 3SUJA 1YNJD 2BH0A 1Y5IA 1E60A 2JA7A 2R92A 2PI8A
chains in the Genus database with same CATH topology
2A68D 2Y0SA 3O5AA 5T5MD 2A6ED 1VC3B 1WLFA 5FTJA 1TWFA 1E18A 4DMRA 1Y1WA 5B6CA 4AAYA 1CR5A 2GAEA 1H0HA 3HU3A 3GTMA 4AONB 1R27A 2R93A 4AYBA 2G6GA 1E5VA 3CF2A 3TIWA 4CS0A 1UHEA 1KQFA 1H5NA 2CW0D 2KI8A 1IW7D 4CRYG 2JIRA 2EEOB 1FDOA 1TWHA 1QDNA 2PMZA 4GA6A 1SMYD 1AW8B 3QQ8A 2JIPA 5EPPA 3QQ7A 2NYAA 3HU2A 2A6HD 1R9TA 3QWZA 1KQGA 1YLEA 3GTOA 4NOHA 3OUGA 3PLXB 1TWCA 2B63A 1G8KA 1PT0A 1R7RA 2A69D 3HKZA 1YNND 4C2MA 1AA6A 2PNWA 4GA5A 4KLNA 5FTLA 1Y4ZA 2E7ZA 1CZ5A 2JIOA 2VUMA 2O5JD 3DMRA 3GTLA 4D7ZB 2PICA 5DYIA 2V3VA 2JA6A 2V45A 2PJHB 3IR5A 1DMSA 5C1BA 2VPXA 1PPYA 5T5ID 1TMOA 3GTJA 1EU1A 2R7ZA 2NVYA 1PYQA 3IR7A 1G8JA 1PYUB 2G5DA 3QC8A 2E2HA 3ML1A 2PJJA 2NVXA 2JIQA 1Q16A 3GTKA 1PQEA 2JIMA 1ZYRD 2NAPA 4AOKB 2WB1A 1PQFA 3HU1A 1UHDA 1Y1VA 2YU9A 1DMRA 1I50A 2IV2X 2E2IA 1OGYA 2C45A 1S3SA 4RV0A 5DYGA 3GTQA 1SIWA 4KDIA 3GTGA 1WCMA 1QCSA 2DMRA 1I3QA 4KODA 4CRZA 3TM7B 2VPYA 4QIWA 5FTMA 1E32A 3CZBA 3CQZA 2JA5A 2VPWA 1ZC1A 1FDIA 1K83A 3H0GA 2WAQA 2BE5D 1CZ4A 1PT1A 4KDLA 1E61A 3IR6A 5FTNA 1TWGA 3FKIA 5FTKA 4AZDA 2AE0X 2YUJA 1PQHA 5C18A 1TWAA 4KO8A 1SFOA 3GTPA 5GLFA 1YNJD 1Y5IA 2VPZA 1E60A 2JA7A 2R92A 2PI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S A;  3O5A A;  5T5M D;  4DMR A;  1VC3 B;  1WLF A;  5FTJ A;  1TWF A;  1E18 A;  1Y1W A;  5B6C A;  4AAY A;  1CR5 A;  1H0H A;  3HU3 A;  3GTM A;  4AON B;  1R27 A;  2R93 A;  4AYB A;  1E5V A;  3CF2 A;  3TIW A;  4CS0 A;  1UHE A;  1KQF A;  1H5N A;  2KI8 A;  1IW7 D;  4CRY G;  2JIR A;  2EEO B;  1FDO A;  1TWH A;  1QDN A;  2PMZ A;  4GA6 A;  1AW8 B;  3QQ8 A;  2JIP A;  5EPP A;  3QQ7 A;  2NYA A;  3HU2 A;  1R9T A;  3QWZ A;  1KQG A;  1YLE A;  3GTO A;  3OUG A;  3PLX B;  1TWC A;  2B63 A;  1G8K A;  1PT0 A;  1R7R A;  3HKZ A;  1AA6 A;  4C2M A;  4GA5 A;  4KLN A;  5FTL A;  1Y4Z A;  2E7Z A;  1CZ5 A;  2JIO A;  2VUM A;  3DMR A;  3GTL A;  4D7Z B;  5DYI A;  2V3V A;  2JA6 A;  2V45 A;  2PJH B;  3IR5 A;  1DMS A;  5C1B A;  2VPX A;  1PPY A;  5T5I D;  1TMO A;  3GTJ A;  1EU1 A;  2R7Z A;  2NVY A;  1PYQ A;  3IR7 A;  1G8J A;  1PYU B;  3QC8 A;  2E2H A;  3ML1 A;  2NVX A;  2JIQ A;  1Q16 A;  3GTK A;  1PQE A;  2JIM A;  2NAP A;  4AOK B;  2WB1 A;  1PQF A;  3HU1 A;  1UHD A;  1Y1V A;  2YU9 A;  1DMR A;  1I50 A;  2IV2 X;  2E2I A;  1OGY A;  2C45 A;  1S3S A;  4RV0 A;  5DYG A;  3GTQ A;  1SIW A;  4KDI A;  3GTG A;  1WCM A;  1QCS A;  2DMR A;  1I3Q A;  4KOD A;  4CRZ A;  3TM7 B;  2VPY A;  4QIW A;  5FTM A;  1E32 A;  3CQZ A;  2JA5 A;  2VPW A;  1FDI A;  1K83 A;  3H0G A;  2WAQ A;  1CZ4 A;  1PT1 A;  4KDL A;  1E61 A;  3IR6 A;  5FTN A;  1TWG A;  3FKI A;  5FTK A;  4AZD A;  1PQH A;  5C18 A;  1TWA A;  4KO8 A;  1SFO A;  3GTP A;  5GLF A;  1Y5I A;  2VPZ A;  1E60 A;  2JA7 A;  2R92 A; 
#chains in the Genus database with same CATH topology
 2A68 D;  3SUK A;  2Y0S A;  2ENG A;  3O5A A;  2A6E D;  1VC3 B;  1WLF A;  5FTJ A;  1TWF A;  1E18 A;  5T5M D;  4DMR A;  1Y1W A;  3SUM A;  3X2J A;  5B6C A;  4AAY A;  1CR5 A;  2GAE A;  1OA9 A;  1H0H A;  3HU3 A;  3GTM A;  4ENG A;  3X2N A;  4AON B;  1R27 A;  2R93 A;  4AYB A;  2G6G A;  1E5V A;  3CF2 A;  3TIW A;  4CS0 A;  4JCW A;  1UHE A;  1KQF A;  1H5N A;  2CW0 D;  2KI8 A;  1IW7 D;  4CRY G;  2JIR A;  2EEO B;  1FDO A;  4FG2 A;  3X2K A;  1TWH A;  1QDN A;  4FG4 A;  3X2L A;  2PMZ A;  4GA6 A;  3SUL A;  1SMY D;  3X2M A;  5GM9 A;  1AW8 B;  2HCZ X;  3QQ8 A;  2JIP A;  5EPP A;  3QQ7 A;  2NYA A;  3HU2 A;  1WC2 A;  1BW3 A;  2A6H D;  1R9T A;  3QWZ A;  4JP7 A;  1L8F A;  1KQG A;  1YLE A;  3GTO A;  1N10 A;  4NOH A;  3OUG A;  1OA7 A;  3PLX B;  1TWC A;  2B63 A;  1G8K A;  2VPZ A;  1PT0 A;  3X2G A;  1R7R A;  2A69 D;  3HKZ A;  1YNN D;  3M3G A;  4C2M A;  1AA6 A;  3X2I A;  2PNW A;  4GA5 A;  4L48 A;  4KLN A;  5FTL A;  1Y4Z A;  2E7Z A;  3D30 A;  4FFT A;  1CZ5 A;  2JIO A;  2VUM A;  4JS7 A;  2O5J D;  3DMR A;  3GTL A;  4D7Z B;  2PIC A;  5DYI A;  2V3V A;  2JA6 A;  2V45 A;  2PJH B;  3IR5 A;  1DMS A;  5C1B A;  2VPX A;  1PPY A;  5T5I D;  1TMO A;  3GTJ A;  1EU1 A;  2R7Z A;  2NVY A;  1PYQ A;  3IR7 A;  1G8J A;  1PYU B;  2G5D A;  3QC8 A;  2E2H A;  3ML1 A;  2PJJ A;  2NVX A;  2JIQ A;  1Q16 A;  4AVR A;  2KQA A;  3GTK A;  1PQE A;  2JIM A;  1ZYR D;  2NAP A;  4AOK B;  2WB1 A;  1PQF A;  3HU1 A;  1UHD A;  1Y1V A;  2YU9 A;  1DMR A;  1I50 A;  2IV2 X;  2E2I A;  1OGY A;  2C45 A;  1S3S A;  4RV0 A;  5DYG A;  3GTQ A;  1SIW A;  4KDI A;  3GTG A;  3X2P A;  1WCM A;  4FER A;  1QCS A;  2DMR A;  3X2O A;  4JJO A;  4KOD A;  5GLX A;  4CRZ A;  1I3Q A;  3TM7 B;  2VPY A;  4QIW A;  3ENG A;  5FTM A;  1E32 A;  3CZB A;  3CQZ A;  5H4U A;  2JA5 A;  2VPW A;  4JP6 A;  1ZC1 A;  1FDI A;  1K83 A;  3H0G A;  2WAQ A;  2BE5 D;  1CZ4 A;  1PT1 A;  4KDL A;  1E61 A;  4ZM7 A;  3IR6 A;  5FTN A;  1TWG A;  3FKI A;  5FTK A;  4AZD A;  2AE0 X;  2YUJ A;  1PQH A;  5C18 A;  5GLY A;  3X2H A;  1TWA A;  1BW4 A;  4KO8 A;  1SFO A;  3GTP A;  5GLF A;  1HD5 A;  3SUJ A;  1YNJ D;  2BH0 A;  1Y5I A;  1E60 A;  2JA7 A;  2R92 A;  2PI8 A; 
#chains in the Genus database with same CATH homology
 2A68 D;  2Y0S A;  3O5A A;  5T5M D;  2A6E D;  1VC3 B;  1WLF A;  5FTJ A;  1TWF A;  1E18 A;  4DMR A;  1Y1W A;  5B6C A;  4AAY A;  1CR5 A;  2GAE A;  1H0H A;  3HU3 A;  3GTM A;  4AON B;  1R27 A;  2R93 A;  4AYB A;  2G6G A;  1E5V A;  3CF2 A;  3TIW A;  4CS0 A;  1UHE A;  1KQF A;  1H5N A;  2CW0 D;  2KI8 A;  1IW7 D;  4CRY G;  2JIR A;  2EEO B;  1FDO A;  1TWH A;  1QDN A;  2PMZ A;  4GA6 A;  1SMY D;  1AW8 B;  3QQ8 A;  2JIP A;  5EPP A;  3QQ7 A;  2NYA A;  3HU2 A;  2A6H D;  1R9T A;  3QWZ A;  1KQG A;  1YLE A;  3GTO A;  4NOH A;  3OUG A;  3PLX B;  1TWC A;  2B63 A;  1G8K A;  1PT0 A;  1R7R A;  2A69 D;  3HKZ A;  1YNN D;  4C2M A;  1AA6 A;  2PNW A;  4GA5 A;  4KLN A;  5FTL A;  1Y4Z A;  2E7Z A;  1CZ5 A;  2JIO A;  2VUM A;  2O5J D;  3DMR A;  3GTL A;  4D7Z B;  2PIC A;  5DYI A;  2V3V A;  2JA6 A;  2V45 A;  2PJH B;  3IR5 A;  1DMS A;  5C1B A;  2VPX A;  1PPY A;  5T5I D;  1TMO A;  3GTJ A;  1EU1 A;  2R7Z A;  2NVY A;  1PYQ A;  3IR7 A;  1G8J A;  1PYU B;  2G5D A;  3QC8 A;  2E2H A;  3ML1 A;  2PJJ A;  2NVX A;  2JIQ A;  1Q16 A;  3GTK A;  1PQE A;  2JIM A;  1ZYR D;  2NAP A;  4AOK B;  2WB1 A;  1PQF A;  3HU1 A;  1UHD A;  1Y1V A;  2YU9 A;  1DMR A;  1I50 A;  2IV2 X;  2E2I A;  1OGY A;  2C45 A;  1S3S A;  4RV0 A;  5DYG A;  3GTQ A;  1SIW A;  4KDI A;  3GTG A;  1WCM A;  1QCS A;  2DMR A;  1I3Q A;  4KOD A;  4CRZ A;  3TM7 B;  2VPY A;  4QIW A;  5FTM A;  1E32 A;  3CZB A;  3CQZ A;  2JA5 A;  2VPW A;  1ZC1 A;  1FDI A;  1K83 A;  3H0G A;  2WAQ A;  2BE5 D;  1CZ4 A;  1PT1 A;  4KDL A;  1E61 A;  3IR6 A;  5FTN A;  1TWG A;  3FKI A;  5FTK A;  4AZD A;  2AE0 X;  2YUJ A;  1PQH A;  5C18 A;  1TWA A;  4KO8 A;  1SFO A;  3GTP A;  5GLF A;  1YNJ D;  1Y5I A;  2VPZ A;  1E60 A;  2JA7 A;  2R92 A;  2PI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...