1AW8B

Pyruvoyl dependent aspartate decarboxylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASPARTATE-ALPHA-DECARBOXYLASE
publication title Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Decarboxylase
total genus 21
structure length 90
sequence length 90
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 1997-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aw8B00
1Y1VA 4DMRA 2R92A 2NVXA 2Y0SA 1E5VA 1SIWA 1AW8B 1FDIA 2JA5A 2PMZA 1G8JA 1UHDA 1YLEA 4QIWA 1SFOA 1DMSA 1CR5A 1TWFA 2R7ZA 3GTLA 3IR6A 1Y1WA 3GTJA 2NYAA 2VPYA 2WB1A 4KLNA 2JA7A 2E7ZA 1PT0A 3QC8A 1E60A 2JIRA 2PJHB 1PYUB 3DMRA 5C1BA 2V45A 3QQ7A 3GTPA 4GA6A 3GTMA 4AONB 4KO8A 2E2HA 3GTOA 5GLFA 1PPYA 2EEOB 5T5ID 1K83A 1VC3B 1E32A 1I3QA 2KI8A 4CRYG 4KDLA 4KDIA 4AYBA 4AAYA 1QCSA 1TWHA 2DMRA 2R93A 3FKIA 2JIOA 2V3VA 5FTNA 2B63A 1R9TA 1WLFA 4AOKB 2VUMA 3OUGA 3IR7A 1H0HA 3H0GA 2NVYA 2JIQA 3O5AA 1R7RA 2E2IA 1IW7D 4GA5A 4C2MA 1G8KA 1PQFA 4D7ZB 5FTLA 1CZ5A 4RV0A 3CF2A 1KQGA 5C18A 3HU2A 1KQFA 4CS0A 1EU1A 3TIWA 3GTKA 3CQZA 1OGYA 2JIMA 2C45A 1PQHA 1TWAA 2VPWA 1E18A 5FTJA 5FTKA 4KODA 2YU9A 5FTMA 5EPPA 1TWGA 3TM7B 1AA6A 1R27A 5T5MD 3PLXB 1PT1A 1PQEA 3HKZA 2JA6A 2WAQA 4AZDA 5DYGA 3GTGA 1E61A 1TWCA 1TMOA 1Q16A 1I50A 1FDOA 3QWZA 5DYIA 5B6CA 2VPZA 1WCMA 1Y4ZA 3QQ8A 1QDNA 4CRZA 1PYQA 3HU1A 1H5NA 2IV2X 3HU3A 1UHEA 2NAPA 1CZ4A 1Y5IA 2VPXA 1DMRA 3ML1A 2JIPA 3GTQA 1S3SA 3IR5A
chains in the Genus database with same CATH superfamily
1Y1VA 4DMRA 3X2IA 2R92A 2NVXA 3SULA 2Y0SA 1E5VA 5H4UA 1SIWA 2A69D 2G5DA 1AW8B 1FDIA 2BE5D 2JA5A 2A68D 2PMZA 1G8JA 1UHDA 1YLEA 2PNWA 4QIWA 4ENGA 1SFOA 1DMSA 1CR5A 1TWFA 2R7ZA 3GTLA 4NOHA 3IR6A 1Y1WA 3GTJA 2NYAA 2VPYA 2WB1A 1BW4A 1OA7A 4KLNA 3X2MA 2JA7A 1SMYD 4FERA 2E7ZA 1PT0A 3QC8A 1E60A 2JIRA 2PJHB 1PYUB 3DMRA 5C1BA 2V45A 2PI8A 3QQ7A 3GTPA 4GA6A 3GTMA 4AONB 2GAEA 4KO8A 2E2HA 3GTOA 5GLFA 2HCZX 1PPYA 2EEOB 5T5ID 1K83A 1VC3B 5GM9A 1E32A 1I3QA 2BH0A 2KI8A 2ENGA 3X2LA 4CRYG 4KDLA 4KDIA 5GLXA 4AYBA 4FG2A 2DMRA 1QCSA 1TWHA 4AAYA 2R93A 3FKIA 2JIOA 2V3VA 5FTNA 2B63A 1R9TA 1HD5A 1WLFA 2PJJA 4AOKB 3X2GA 2VUMA 3OUGA 3IR7A 3X2HA 1H0HA 3H0GA 1WC2A 1OA9A 2NVYA 3CZBA 2JIQA 3O5AA 1R7RA 1ZC1A 3X2NA 2E2IA 1IW7D 4JS7A 3SUKA 4GA5A 4FFTA 4C2MA 1G8KA 1PQFA 4D7ZB 2YUJA 3D30A 5FTLA 1CZ5A 3M3GA 4RV0A 3CF2A 1YNJD 4JCWA 5C18A 3HU2A 1KQGA 1KQFA 2KQAA 4CS0A 1EU1A 3TIWA 3GTKA 3CQZA 3X2JA 1OGYA 2JIMA 2C45A 1PQHA 1TWAA 2VPWA 1E18A 4JP6A 5FTJA 1ZYRD 4KODA 5FTMA 5FTKA 2YU9A 5EPPA 1TWGA 3TM7B 4JP7A 1AA6A 1R27A 3ENGA 5T5MD 2A6ED 3PLXB 1PT1A 1PQEA 3SUJA 3HKZA 4L48A 2JA6A 2AE0X 2WAQA 4AZDA 5DYGA 2A6HD 3GTGA 1E61A 1TWCA 5GLYA 1TMOA 1Q16A 1I50A 1FDOA 3QWZA 5DYIA 5B6CA 2VPZA 1WCMA 1YNND 1Y4ZA 2G6GA 1QDNA 3QQ8A 3SUMA 3X2OA 4ZM7A 4CRZA 1PYQA 1BW3A 3HU1A 4FG4A 1H5NA 2IV2X 3HU3A 1UHEA 2NAPA 2O5JD 1CZ4A 1Y5IA 4JJOA 2VPXA 2PICA 2CW0D 1DMRA 3ML1A 1N10A 1L8FA 4AVRA 2JIPA 3X2KA 3X2PA 3GTQA 1S3SA 3IR5A
chains in the Genus database with same CATH topology
1Y1VA 4DMRA 2R92A 2NVXA 2Y0SA 1E5VA 1SIWA 2A69D 2G5DA 1AW8B 1FDIA 2BE5D 2JA5A 2A68D 2PMZA 1G8JA 1UHDA 1YLEA 2PNWA 4QIWA 1SFOA 1DMSA 1CR5A 1TWFA 2R7ZA 3GTLA 4NOHA 3IR6A 1Y1WA 3GTJA 2NYAA 2VPYA 2WB1A 4KLNA 2JA7A 1SMYD 2E7ZA 1PT0A 3QC8A 1E60A 2JIRA 2PJHB 1PYUB 3DMRA 5C1BA 2V45A 2PI8A 3QQ7A 3GTPA 4GA6A 3GTMA 4AONB 2GAEA 4KO8A 2E2HA 3GTOA 5GLFA 1PPYA 2EEOB 5T5ID 1K83A 1VC3B 1E32A 1I3QA 2KI8A 4CRYG 4KDLA 4KDIA 4AYBA 4AAYA 2DMRA 1QCSA 1TWHA 2R93A 3FKIA 2JIOA 2V3VA 5FTNA 2B63A 1R9TA 1WLFA 2PJJA 4AOKB 2VUMA 3OUGA 3IR7A 1H0HA 3H0GA 2NVYA 3CZBA 2JIQA 3O5AA 1R7RA 1ZC1A 2E2IA 1IW7D 4GA5A 4C2MA 1G8KA 1PQFA 4D7ZB 2YUJA 5FTLA 1CZ5A 4RV0A 3CF2A 1YNJD 1KQGA 5C18A 3HU2A 1KQFA 4CS0A 1EU1A 3TIWA 3GTKA 3CQZA 1OGYA 2JIMA 2C45A 1PQHA 1TWAA 2VPWA 1E18A 5FTJA 5FTKA 1ZYRD 4KODA 5FTMA 2YU9A 5EPPA 1TWGA 3TM7B 1AA6A 1R27A 5T5MD 2A6ED 3PLXB 1PT1A 1PQEA 3HKZA 2JA6A 2AE0X 2WAQA 4AZDA 5DYGA 2A6HD 3GTGA 1E61A 1TWCA 1TMOA 1Q16A 1I50A 1FDOA 3QWZA 5DYIA 5B6CA 2VPZA 1WCMA 1YNND 1Y4ZA 2G6GA 1QDNA 3QQ8A 4CRZA 1PYQA 3HU1A 1H5NA 2IV2X 3HU3A 1UHEA 2NAPA 2O5JD 1CZ4A 1Y5IA 2VPXA 2PICA 2CW0D 1DMRA 3ML1A 2JIPA 3GTQA 1S3SA 3IR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V A;  4DMR A;  2R92 A;  2NVX A;  2Y0S A;  1E5V A;  1SIW A;  1AW8 B;  1FDI A;  2JA5 A;  2PMZ A;  1G8J A;  1UHD A;  1YLE A;  4QIW A;  1SFO A;  1DMS A;  1CR5 A;  1TWF A;  2R7Z A;  3GTL A;  3IR6 A;  1Y1W A;  3GTJ A;  2NYA A;  2VPY A;  2WB1 A;  4KLN A;  2JA7 A;  2E7Z A;  1PT0 A;  3QC8 A;  1E60 A;  2JIR A;  2PJH B;  1PYU B;  3DMR A;  5C1B A;  2V45 A;  3QQ7 A;  3GTP A;  4GA6 A;  3GTM A;  4AON B;  4KO8 A;  2E2H A;  3GTO A;  5GLF A;  1PPY A;  2EEO B;  5T5I D;  1K83 A;  1VC3 B;  1E32 A;  1I3Q A;  2KI8 A;  4CRY G;  4KDL A;  4KDI A;  4AYB A;  4AAY A;  1QCS A;  1TWH A;  2DMR A;  2R93 A;  3FKI A;  2JIO A;  2V3V A;  5FTN A;  2B63 A;  1R9T A;  1WLF A;  4AOK B;  2VUM A;  3OUG A;  3IR7 A;  1H0H A;  3H0G A;  2NVY A;  2JIQ A;  3O5A A;  1R7R A;  2E2I A;  1IW7 D;  4GA5 A;  4C2M A;  1G8K A;  1PQF A;  4D7Z B;  5FTL A;  1CZ5 A;  4RV0 A;  3CF2 A;  1KQG A;  5C18 A;  3HU2 A;  1KQF A;  4CS0 A;  1EU1 A;  3TIW A;  3GTK A;  3CQZ A;  1OGY A;  2JIM A;  2C45 A;  1PQH A;  1TWA A;  2VPW A;  1E18 A;  5FTJ A;  5FTK A;  4KOD A;  2YU9 A;  5FTM A;  5EPP A;  1TWG A;  3TM7 B;  1AA6 A;  1R27 A;  5T5M D;  3PLX B;  1PT1 A;  1PQE A;  3HKZ A;  2JA6 A;  2WAQ A;  4AZD A;  5DYG A;  3GTG A;  1E61 A;  1TWC A;  1TMO A;  1Q16 A;  1I50 A;  1FDO A;  3QWZ A;  5DYI A;  5B6C A;  2VPZ A;  1WCM A;  1Y4Z A;  3QQ8 A;  1QDN A;  4CRZ A;  1PYQ A;  3HU1 A;  1H5N A;  2IV2 X;  3HU3 A;  1UHE A;  2NAP A;  1CZ4 A;  1Y5I A;  2VPX A;  1DMR A;  3ML1 A;  2JIP A;  3GTQ A;  1S3S A;  3IR5 A; 
#chains in the Genus database with same CATH topology
 1Y1V A;  4DMR A;  3X2I A;  2R92 A;  2NVX A;  3SUL A;  2Y0S A;  1E5V A;  5H4U A;  1SIW A;  2A69 D;  2G5D A;  1AW8 B;  1FDI A;  2BE5 D;  2JA5 A;  2A68 D;  2PMZ A;  1G8J A;  1UHD A;  1YLE A;  2PNW A;  4QIW A;  4ENG A;  1SFO A;  1DMS A;  1CR5 A;  1TWF A;  2R7Z A;  3GTL A;  4NOH A;  3IR6 A;  1Y1W A;  3GTJ A;  2NYA A;  2VPY A;  2WB1 A;  1BW4 A;  1OA7 A;  4KLN A;  3X2M A;  2JA7 A;  1SMY D;  4FER A;  2E7Z A;  1PT0 A;  3QC8 A;  1E60 A;  2JIR A;  2PJH B;  1PYU B;  3DMR A;  5C1B A;  2V45 A;  2PI8 A;  3QQ7 A;  3GTP A;  4GA6 A;  3GTM A;  4AON B;  2GAE A;  4KO8 A;  2E2H A;  3GTO A;  5GLF A;  2HCZ X;  1PPY A;  2EEO B;  5T5I D;  1K83 A;  1VC3 B;  5GM9 A;  1E32 A;  1I3Q A;  2BH0 A;  2KI8 A;  2ENG A;  3X2L A;  4CRY G;  4KDL A;  4KDI A;  5GLX A;  4AYB A;  4FG2 A;  2DMR A;  1QCS A;  1TWH A;  4AAY A;  2R93 A;  3FKI A;  2JIO A;  2V3V A;  5FTN A;  2B63 A;  1R9T A;  1HD5 A;  1WLF A;  2PJJ A;  4AOK B;  3X2G A;  2VUM A;  3OUG A;  3IR7 A;  3X2H A;  1H0H A;  3H0G A;  1WC2 A;  1OA9 A;  2NVY A;  3CZB A;  2JIQ A;  3O5A A;  1R7R A;  1ZC1 A;  3X2N A;  2E2I A;  1IW7 D;  4JS7 A;  3SUK A;  4GA5 A;  4FFT A;  4C2M A;  1G8K A;  1PQF A;  4D7Z B;  2YUJ A;  3D30 A;  5FTL A;  1CZ5 A;  3M3G A;  4RV0 A;  3CF2 A;  1YNJ D;  4JCW A;  5C18 A;  3HU2 A;  1KQG A;  1KQF A;  2KQA A;  4CS0 A;  1EU1 A;  3TIW A;  3GTK A;  3CQZ A;  3X2J A;  1OGY A;  2JIM A;  2C45 A;  1PQH A;  1TWA A;  2VPW A;  1E18 A;  4JP6 A;  5FTJ A;  1ZYR D;  4KOD A;  5FTM A;  5FTK A;  2YU9 A;  5EPP A;  1TWG A;  3TM7 B;  4JP7 A;  1AA6 A;  1R27 A;  3ENG A;  5T5M D;  2A6E D;  3PLX B;  1PT1 A;  1PQE A;  3SUJ A;  3HKZ A;  4L48 A;  2JA6 A;  2AE0 X;  2WAQ A;  4AZD A;  5DYG A;  2A6H D;  3GTG A;  1E61 A;  1TWC A;  5GLY A;  1TMO A;  1Q16 A;  1I50 A;  1FDO A;  3QWZ A;  5DYI A;  5B6C A;  2VPZ A;  1WCM A;  1YNN D;  1Y4Z A;  2G6G A;  1QDN A;  3QQ8 A;  3SUM A;  3X2O A;  4ZM7 A;  4CRZ A;  1PYQ A;  1BW3 A;  3HU1 A;  4FG4 A;  1H5N A;  2IV2 X;  3HU3 A;  1UHE A;  2NAP A;  2O5J D;  1CZ4 A;  1Y5I A;  4JJO A;  2VPX A;  2PIC A;  2CW0 D;  1DMR A;  3ML1 A;  1N10 A;  1L8F A;  4AVR A;  2JIP A;  3X2K A;  3X2P A;  3GTQ A;  1S3S A;  3IR5 A; 
#chains in the Genus database with same CATH homology
 1Y1V A;  4DMR A;  2R92 A;  2NVX A;  2Y0S A;  1E5V A;  1SIW A;  2A69 D;  2G5D A;  1AW8 B;  1FDI A;  2BE5 D;  2JA5 A;  2A68 D;  2PMZ A;  1G8J A;  1UHD A;  1YLE A;  2PNW A;  4QIW A;  1SFO A;  1DMS A;  1CR5 A;  1TWF A;  2R7Z A;  3GTL A;  4NOH A;  3IR6 A;  1Y1W A;  3GTJ A;  2NYA A;  2VPY A;  2WB1 A;  4KLN A;  2JA7 A;  1SMY D;  2E7Z A;  1PT0 A;  3QC8 A;  1E60 A;  2JIR A;  2PJH B;  1PYU B;  3DMR A;  5C1B A;  2V45 A;  2PI8 A;  3QQ7 A;  3GTP A;  4GA6 A;  3GTM A;  4AON B;  2GAE A;  4KO8 A;  2E2H A;  3GTO A;  5GLF A;  1PPY A;  2EEO B;  5T5I D;  1K83 A;  1VC3 B;  1E32 A;  1I3Q A;  2KI8 A;  4CRY G;  4KDL A;  4KDI A;  4AYB A;  4AAY A;  2DMR A;  1QCS A;  1TWH A;  2R93 A;  3FKI A;  2JIO A;  2V3V A;  5FTN A;  2B63 A;  1R9T A;  1WLF A;  2PJJ A;  4AOK B;  2VUM A;  3OUG A;  3IR7 A;  1H0H A;  3H0G A;  2NVY A;  3CZB A;  2JIQ A;  3O5A A;  1R7R A;  1ZC1 A;  2E2I A;  1IW7 D;  4GA5 A;  4C2M A;  1G8K A;  1PQF A;  4D7Z B;  2YUJ A;  5FTL A;  1CZ5 A;  4RV0 A;  3CF2 A;  1YNJ D;  1KQG A;  5C18 A;  3HU2 A;  1KQF A;  4CS0 A;  1EU1 A;  3TIW A;  3GTK A;  3CQZ A;  1OGY A;  2JIM A;  2C45 A;  1PQH A;  1TWA A;  2VPW A;  1E18 A;  5FTJ A;  5FTK A;  1ZYR D;  4KOD A;  5FTM A;  2YU9 A;  5EPP A;  1TWG A;  3TM7 B;  1AA6 A;  1R27 A;  5T5M D;  2A6E D;  3PLX B;  1PT1 A;  1PQE A;  3HKZ A;  2JA6 A;  2AE0 X;  2WAQ A;  4AZD A;  5DYG A;  2A6H D;  3GTG A;  1E61 A;  1TWC A;  1TMO A;  1Q16 A;  1I50 A;  1FDO A;  3QWZ A;  5DYI A;  5B6C A;  2VPZ A;  1WCM A;  1YNN D;  1Y4Z A;  2G6G A;  1QDN A;  3QQ8 A;  4CRZ A;  1PYQ A;  3HU1 A;  1H5N A;  2IV2 X;  3HU3 A;  1UHE A;  2NAP A;  2O5J D;  1CZ4 A;  1Y5I A;  2VPX A;  2PIC A;  2CW0 D;  1DMR A;  3ML1 A;  2JIP A;  3GTQ A;  1S3S A;  3IR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...