1AW8B

Pyruvoyl dependent aspartate decarboxylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASPARTATE-ALPHA-DECARBOXYLASE
publication title Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Decarboxylase
total genus 21
structure length 90
sequence length 90
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 1997-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aw8B00
1KQFA 3HKZA 1PYUB 5T5ID 3GTKA 5FTMA 4CRYG 1UHDA 4AZDA 4GA6A 4RV0A 1SFOA 1DMRA 3ML1A 5B6CA 5DYIA 4D7ZB 1AW8B 1WLFA 4DMRA 4KDIA 2JIMA 2B63A 1OGYA 4KLNA 2NAPA 1TWHA 2E7ZA 2JA7A 5C18A 1CR5A 4KDLA 3GTMA 4KO8A 1R7RA 1DMSA 3IR6A 1H5NA 1I50A 1QDNA 1Y1VA 1K83A 1QCSA 2E2HA 2VPWA 1FDOA 1IW7D 1R27A 2WAQA 2PJHB 3QC8A 1CZ5A 4KODA 3FKIA 3OUGA 2NYAA 1TWFA 3QQ7A 3PLXB 3GTOA 3O5AA 1E18A 1Y1WA 1SIWA 2EEOB 2JIOA 4C2MA 1WCMA 2Y0SA 1E5VA 1Y5IA 3TM7B 2E2IA 1TWGA 1TWCA 2C45A 1TWAA 1PQFA 3GTLA 3H0GA 1TMOA 3GTJA 2VPXA 4CS0A 5FTKA 1EU1A 3GTPA 2R93A 2JIQA 5FTNA 1I3QA 1H0HA 3IR7A 5C1BA 1PQEA 1E32A 2JA5A 1FDIA 1PT1A 4AONB 1S3SA 3HU3A 2V45A 1Q16A 5GLFA 1PT0A 2IV2X 2VPZA 3CQZA 1CZ4A 4AYBA 2WB1A 5DYGA 3CF2A 3QQ8A 2JIRA 5EPPA 3TIWA 3GTGA 1PYQA 3DMRA 2YU9A 1YLEA 3IR5A 5FTJA 2R92A 2NVXA 4AAYA 2NVYA 1PQHA 5FTLA 4QIWA 3QWZA 2JA6A 1KQGA 2PMZA 4GA5A 3HU2A 2KI8A 1AA6A 1E60A 3HU1A 2R7ZA 2JIPA 1VC3B 1E61A 2DMRA 1PPYA 2VPYA 3GTQA 4AOKB 2V3VA 5T5MD 1Y4ZA 1G8JA 1G8KA 2VUMA 4CRZA 1UHEA 1R9TA
chains in the Genus database with same CATH superfamily
1SMYD 2PJJA 2AE0X 2O5JD 1KQFA 3HKZA 1PYUB 5T5ID 3GTKA 5FTMA 4CRYG 1UHDA 4AZDA 4GA6A 4RV0A 1SFOA 1DMRA 4ENGA 2A6HD 3ML1A 5B6CA 5DYIA 4D7ZB 1AW8B 1WLFA 4DMRA 4KDIA 3X2PA 2JIMA 2B63A 4FG4A 1OGYA 4KLNA 2NAPA 1TWHA 2E7ZA 3D30A 4JJOA 2JA7A 5C18A 1CR5A 4KDLA 3GTMA 4KO8A 1R7RA 1DMSA 3IR6A 1H5NA 1I50A 1QDNA 1Y1VA 1K83A 1QCSA 2E2HA 2VPWA 1FDOA 1YNJD 1IW7D 2GAEA 1R27A 2WAQA 2PJHB 3QC8A 1CZ5A 4KODA 1ZC1A 2KQAA 3FKIA 1YNND 3OUGA 2NYAA 1TWFA 3QQ7A 3PLXB 3GTOA 2G5DA 3O5AA 3X2LA 1E18A 1Y1WA 1SIWA 1L8FA 2EEOB 2JIOA 4C2MA 1WCMA 2Y0SA 1E5VA 3M3GA 1Y5IA 3TM7B 2A68D 1TWGA 1TWCA 2C45A 1TWAA 1PQFA 3GTLA 2E2IA 3H0GA 5H4UA 1TMOA 3GTJA 2VPXA 4CS0A 5FTKA 1EU1A 3GTPA 2R93A 1ZYRD 3SULA 2JIQA 5FTNA 1I3QA 1H0HA 3IR7A 3X2HA 5C1BA 1PQEA 1OA7A 2PI8A 1E32A 2JA5A 1FDIA 1PT1A 4AONB 1S3SA 2PICA 3HU3A 2V45A 3X2OA 2A6ED 1Q16A 2A69D 4JP7A 5GLFA 1PT0A 2IV2X 4FFTA 2VPZA 3CQZA 1CZ4A 4AVRA 4AYBA 2WB1A 4FG2A 5DYGA 3CF2A 3QQ8A 2JIRA 3X2MA 5GLYA 5EPPA 5GM9A 2CW0D 4JCWA 2YUJA 3TIWA 3GTGA 1PYQA 3DMRA 1WC2A 4FERA 2YU9A 1YLEA 3IR5A 5FTJA 3X2KA 2R92A 3X2GA 2NVXA 2HCZX 3SUKA 2NVYA 1PQHA 4AAYA 5FTLA 4QIWA 2G6GA 3QWZA 2JA6A 2ENGA 2PMZA 1KQGA 2BE5D 4GA5A 5GLXA 4L48A 3HU2A 1BW4A 2KI8A 4ZM7A 3SUMA 1AA6A 3SUJA 1E60A 3HU1A 4JP6A 2R7ZA 2BH0A 3ENGA 2PNWA 2JIPA 3X2JA 1VC3B 4JS7A 1E61A 2DMRA 1PPYA 1N10A 2VPYA 3GTQA 3X2IA 4AOKB 2V3VA 5T5MD 1Y4ZA 4NOHA 1G8JA 1HD5A 1BW3A 1G8KA 1OA9A 4CRZA 2VUMA 1UHEA 1R9TA 3X2NA 3CZBA
chains in the Genus database with same CATH topology
1SMYD 2PJJA 2AE0X 2O5JD 1KQFA 3HKZA 1PYUB 5T5ID 3GTKA 5FTMA 4CRYG 1UHDA 4AZDA 4GA6A 4RV0A 1SFOA 1DMRA 2A6HD 3ML1A 5B6CA 5DYIA 4D7ZB 1AW8B 1WLFA 4DMRA 4KDIA 2JIMA 2B63A 1OGYA 4KLNA 2NAPA 1TWHA 2E7ZA 2JA7A 5C18A 1CR5A 4KDLA 3GTMA 4KO8A 1R7RA 1DMSA 3IR6A 1H5NA 1I50A 1QDNA 1Y1VA 1K83A 1QCSA 2E2HA 2VPWA 1FDOA 1YNJD 1IW7D 2GAEA 1R27A 2WAQA 2PJHB 3QC8A 1CZ5A 4KODA 1ZC1A 3FKIA 1YNND 3OUGA 2NYAA 1TWFA 3QQ7A 3PLXB 3GTOA 2G5DA 3O5AA 1E18A 1Y1WA 1SIWA 2EEOB 2JIOA 4C2MA 1WCMA 2Y0SA 1E5VA 1Y5IA 3TM7B 2A68D 1TWGA 1TWCA 2C45A 1TWAA 1PQFA 3GTLA 2E2IA 3H0GA 1TMOA 3GTJA 2VPXA 4CS0A 5FTKA 1EU1A 3GTPA 2R93A 1ZYRD 2JIQA 5FTNA 1I3QA 1H0HA 3IR7A 5C1BA 1PQEA 2PI8A 1E32A 2JA5A 1FDIA 1PT1A 4AONB 1S3SA 2PICA 3HU3A 2V45A 2A6ED 1Q16A 2A69D 5GLFA 1PT0A 2IV2X 2VPZA 3CQZA 1CZ4A 4AYBA 2WB1A 5DYGA 3CF2A 3QQ8A 2JIRA 5EPPA 2CW0D 2YUJA 3TIWA 3GTGA 1PYQA 3DMRA 2YU9A 1YLEA 3IR5A 5FTJA 2R92A 2NVXA 4AAYA 2NVYA 1PQHA 5FTLA 4QIWA 2G6GA 3QWZA 2JA6A 1KQGA 2PMZA 2BE5D 4GA5A 3HU2A 2KI8A 1AA6A 1E60A 3HU1A 2R7ZA 2PNWA 2JIPA 1VC3B 1E61A 2DMRA 1PPYA 2VPYA 3GTQA 4AOKB 2V3VA 5T5MD 1Y4ZA 4NOHA 1G8JA 1G8KA 2VUMA 4CRZA 1UHEA 1R9TA 3CZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQF A;  3HKZ A;  1PYU B;  5T5I D;  3GTK A;  5FTM A;  4CRY G;  1UHD A;  4AZD A;  4GA6 A;  4RV0 A;  1SFO A;  1DMR A;  3ML1 A;  5B6C A;  5DYI A;  4D7Z B;  1AW8 B;  1WLF A;  4DMR A;  4KDI A;  2JIM A;  2B63 A;  1OGY A;  4KLN A;  2NAP A;  1TWH A;  2E7Z A;  2JA7 A;  5C18 A;  1CR5 A;  4KDL A;  3GTM A;  4KO8 A;  1R7R A;  1DMS A;  3IR6 A;  1H5N A;  1I50 A;  1QDN A;  1Y1V A;  1K83 A;  1QCS A;  2E2H A;  2VPW A;  1FDO A;  1IW7 D;  1R27 A;  2WAQ A;  2PJH B;  3QC8 A;  1CZ5 A;  4KOD A;  3FKI A;  3OUG A;  2NYA A;  1TWF A;  3QQ7 A;  3PLX B;  3GTO A;  3O5A A;  1E18 A;  1Y1W A;  1SIW A;  2EEO B;  2JIO A;  4C2M A;  1WCM A;  2Y0S A;  1E5V A;  1Y5I A;  3TM7 B;  2E2I A;  1TWG A;  1TWC A;  2C45 A;  1TWA A;  1PQF A;  3GTL A;  3H0G A;  1TMO A;  3GTJ A;  2VPX A;  4CS0 A;  5FTK A;  1EU1 A;  3GTP A;  2R93 A;  2JIQ A;  5FTN A;  1I3Q A;  1H0H A;  3IR7 A;  5C1B A;  1PQE A;  1E32 A;  2JA5 A;  1FDI A;  1PT1 A;  4AON B;  1S3S A;  3HU3 A;  2V45 A;  1Q16 A;  5GLF A;  1PT0 A;  2IV2 X;  2VPZ A;  3CQZ A;  1CZ4 A;  4AYB A;  2WB1 A;  5DYG A;  3CF2 A;  3QQ8 A;  2JIR A;  5EPP A;  3TIW A;  3GTG A;  1PYQ A;  3DMR A;  2YU9 A;  1YLE A;  3IR5 A;  5FTJ A;  2R92 A;  2NVX A;  4AAY A;  2NVY A;  1PQH A;  5FTL A;  4QIW A;  3QWZ A;  2JA6 A;  1KQG A;  2PMZ A;  4GA5 A;  3HU2 A;  2KI8 A;  1AA6 A;  1E60 A;  3HU1 A;  2R7Z A;  2JIP A;  1VC3 B;  1E61 A;  2DMR A;  1PPY A;  2VPY A;  3GTQ A;  4AOK B;  2V3V A;  5T5M D;  1Y4Z A;  1G8J A;  1G8K A;  2VUM A;  4CRZ A;  1UHE A;  1R9T A; 
#chains in the Genus database with same CATH topology
 1SMY D;  2PJJ A;  2AE0 X;  2O5J D;  1KQF A;  3HKZ A;  1PYU B;  5T5I D;  3GTK A;  5FTM A;  4CRY G;  1UHD A;  4AZD A;  4GA6 A;  4RV0 A;  1SFO A;  1DMR A;  4ENG A;  2A6H D;  3ML1 A;  5B6C A;  5DYI A;  4D7Z B;  1AW8 B;  1WLF A;  4DMR A;  4KDI A;  3X2P A;  2JIM A;  2B63 A;  4FG4 A;  1OGY A;  4KLN A;  2NAP A;  1TWH A;  2E7Z A;  3D30 A;  4JJO A;  2JA7 A;  5C18 A;  1CR5 A;  4KDL A;  3GTM A;  4KO8 A;  1R7R A;  1DMS A;  3IR6 A;  1H5N A;  1I50 A;  1QDN A;  1Y1V A;  1K83 A;  1QCS A;  2E2H A;  2VPW A;  1FDO A;  1YNJ D;  1IW7 D;  2GAE A;  1R27 A;  2WAQ A;  2PJH B;  3QC8 A;  1CZ5 A;  4KOD A;  1ZC1 A;  2KQA A;  3FKI A;  1YNN D;  3OUG A;  2NYA A;  1TWF A;  3QQ7 A;  3PLX B;  3GTO A;  2G5D A;  3O5A A;  3X2L A;  1E18 A;  1Y1W A;  1SIW A;  1L8F A;  2EEO B;  2JIO A;  4C2M A;  1WCM A;  2Y0S A;  1E5V A;  3M3G A;  1Y5I A;  3TM7 B;  2A68 D;  1TWG A;  1TWC A;  2C45 A;  1TWA A;  1PQF A;  3GTL A;  2E2I A;  3H0G A;  5H4U A;  1TMO A;  3GTJ A;  2VPX A;  4CS0 A;  5FTK A;  1EU1 A;  3GTP A;  2R93 A;  1ZYR D;  3SUL A;  2JIQ A;  5FTN A;  1I3Q A;  1H0H A;  3IR7 A;  3X2H A;  5C1B A;  1PQE A;  1OA7 A;  2PI8 A;  1E32 A;  2JA5 A;  1FDI A;  1PT1 A;  4AON B;  1S3S A;  2PIC A;  3HU3 A;  2V45 A;  3X2O A;  2A6E D;  1Q16 A;  2A69 D;  4JP7 A;  5GLF A;  1PT0 A;  2IV2 X;  4FFT A;  2VPZ A;  3CQZ A;  1CZ4 A;  4AVR A;  4AYB A;  2WB1 A;  4FG2 A;  5DYG A;  3CF2 A;  3QQ8 A;  2JIR A;  3X2M A;  5GLY A;  5EPP A;  5GM9 A;  2CW0 D;  4JCW A;  2YUJ A;  3TIW A;  3GTG A;  1PYQ A;  3DMR A;  1WC2 A;  4FER A;  2YU9 A;  1YLE A;  3IR5 A;  5FTJ A;  3X2K A;  2R92 A;  3X2G A;  2NVX A;  2HCZ X;  3SUK A;  2NVY A;  1PQH A;  4AAY A;  5FTL A;  4QIW A;  2G6G A;  3QWZ A;  2JA6 A;  2ENG A;  2PMZ A;  1KQG A;  2BE5 D;  4GA5 A;  5GLX A;  4L48 A;  3HU2 A;  1BW4 A;  2KI8 A;  4ZM7 A;  3SUM A;  1AA6 A;  3SUJ A;  1E60 A;  3HU1 A;  4JP6 A;  2R7Z A;  2BH0 A;  3ENG A;  2PNW A;  2JIP A;  3X2J A;  1VC3 B;  4JS7 A;  1E61 A;  2DMR A;  1PPY A;  1N10 A;  2VPY A;  3GTQ A;  3X2I A;  4AOK B;  2V3V A;  5T5M D;  1Y4Z A;  4NOH A;  1G8J A;  1HD5 A;  1BW3 A;  1G8K A;  1OA9 A;  4CRZ A;  2VUM A;  1UHE A;  1R9T A;  3X2N A;  3CZB A; 
#chains in the Genus database with same CATH homology
 1SMY D;  2PJJ A;  2AE0 X;  2O5J D;  1KQF A;  3HKZ A;  1PYU B;  5T5I D;  3GTK A;  5FTM A;  4CRY G;  1UHD A;  4AZD A;  4GA6 A;  4RV0 A;  1SFO A;  1DMR A;  2A6H D;  3ML1 A;  5B6C A;  5DYI A;  4D7Z B;  1AW8 B;  1WLF A;  4DMR A;  4KDI A;  2JIM A;  2B63 A;  1OGY A;  4KLN A;  2NAP A;  1TWH A;  2E7Z A;  2JA7 A;  5C18 A;  1CR5 A;  4KDL A;  3GTM A;  4KO8 A;  1R7R A;  1DMS A;  3IR6 A;  1H5N A;  1I50 A;  1QDN A;  1Y1V A;  1K83 A;  1QCS A;  2E2H A;  2VPW A;  1FDO A;  1YNJ D;  1IW7 D;  2GAE A;  1R27 A;  2WAQ A;  2PJH B;  3QC8 A;  1CZ5 A;  4KOD A;  1ZC1 A;  3FKI A;  1YNN D;  3OUG A;  2NYA A;  1TWF A;  3QQ7 A;  3PLX B;  3GTO A;  2G5D A;  3O5A A;  1E18 A;  1Y1W A;  1SIW A;  2EEO B;  2JIO A;  4C2M A;  1WCM A;  2Y0S A;  1E5V A;  1Y5I A;  3TM7 B;  2A68 D;  1TWG A;  1TWC A;  2C45 A;  1TWA A;  1PQF A;  3GTL A;  2E2I A;  3H0G A;  1TMO A;  3GTJ A;  2VPX A;  4CS0 A;  5FTK A;  1EU1 A;  3GTP A;  2R93 A;  1ZYR D;  2JIQ A;  5FTN A;  1I3Q A;  1H0H A;  3IR7 A;  5C1B A;  1PQE A;  2PI8 A;  1E32 A;  2JA5 A;  1FDI A;  1PT1 A;  4AON B;  1S3S A;  2PIC A;  3HU3 A;  2V45 A;  2A6E D;  1Q16 A;  2A69 D;  5GLF A;  1PT0 A;  2IV2 X;  2VPZ A;  3CQZ A;  1CZ4 A;  4AYB A;  2WB1 A;  5DYG A;  3CF2 A;  3QQ8 A;  2JIR A;  5EPP A;  2CW0 D;  2YUJ A;  3TIW A;  3GTG A;  1PYQ A;  3DMR A;  2YU9 A;  1YLE A;  3IR5 A;  5FTJ A;  2R92 A;  2NVX A;  4AAY A;  2NVY A;  1PQH A;  5FTL A;  4QIW A;  2G6G A;  3QWZ A;  2JA6 A;  1KQG A;  2PMZ A;  2BE5 D;  4GA5 A;  3HU2 A;  2KI8 A;  1AA6 A;  1E60 A;  3HU1 A;  2R7Z A;  2PNW A;  2JIP A;  1VC3 B;  1E61 A;  2DMR A;  1PPY A;  2VPY A;  3GTQ A;  4AOK B;  2V3V A;  5T5M D;  1Y4Z A;  4NOH A;  1G8J A;  1G8K A;  2VUM A;  4CRZ A;  1UHE A;  1R9T A;  3CZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...