1AW8B

Pyruvoyl dependent aspartate decarboxylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Decarboxylase
molecule keywords L-ASPARTATE-ALPHA-DECARBOXYLASE
total genus 21
structure length 90
sequence length 90
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 1997-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aw8B00
3HU1A 5FTNA 3GTJA 1CR5A 1DMSA 1TMOA 5T5ID 1FDIA 4DMRA 2NAPA 2E7ZA 3H0GA 3FKIA 1SFOA 2R92A 1R9TA 1SIWA 4KODA 3GTGA 2JA5A 1DMRA 2WB1A 1Q16A 4KO8A 2R7ZA 1TWCA 4AZDA 2V45A 5B6CA 1TWGA 3HU3A 1UHEA 4CRYG 4CS0A 2KI8A 1IW7D 2JIRA 3CF2A 2JA7A 1E61A 4AONB 1Y1VA 1CZ4A 1I3QA 1KQGA 1QCSA 1E18A 1TWAA 5T5MD 4AAYA 2JIOA 4KDIA 3GTPA 5C18A 3GTQA 2R93A 4AOKB 2WAQA 2JIPA 1H5NA 4C2MA 2B63A 3GTOA 2PJHB 5FTMA 1CZ5A 1Y5IA 1R27A 1Y4ZA 4CRZA 1WLFA 3HU2A 1K83A 2VPWA 1PQHA 3QWZA 1UHDA 5EPPA 2PMZA 4QIWA 1TWFA 1KQFA 1G8JA 2E2IA 2E2HA 2JA6A 1PPYA 3QQ8A 5C1BA 1S3SA 5FTJA 2VPZA 3QC8A 1OGYA 1PT0A 1E5VA 1WCMA 1EU1A 2VPYA 3O5AA 3DMRA 3HKZA 1PT1A 2V3VA 3TIWA 4KLNA 2NYAA 1PQEA 4GA6A 3TM7B 2C45A 2VUMA 4AYBA 1I50A 5DYIA 5GLFA 2DMRA 1R7RA 2JIMA 3GTMA 4RV0A 3GTKA 5FTLA 4D7ZB 1VC3B 2EEOB 1H0HA 2NVXA 3IR7A 4GA5A 1TWHA 3QQ7A 5DYGA 2NVYA 5FTKA 1PYQA 3GTLA 3PLXB 2YU9A 1PYUB 2Y0SA 3IR5A 3ML1A 2IV2X 1PQFA 4KDLA 1YLEA 2JIQA 2VPXA 1G8KA 1E32A 1AA6A 1QDNA 1Y1WA 1AW8B 1E60A 3IR6A 3OUGA 1FDOA 3CQZA
chains in the Genus database with same CATH superfamily
3HU1A 5FTNA 3GTJA 4FFTA 1CR5A 1DMSA 1TMOA 5GM9A 4ZM7A 5T5ID 1FDIA 3X2HA 4DMRA 4JJOA 2NAPA 2E7ZA 3H0GA 4JCWA 3FKIA 1SFOA 2R92A 2ENGA 3X2LA 1R9TA 1SIWA 4KODA 2CW0D 3GTGA 2JA5A 1DMRA 3D30A 3X2MA 2WB1A 3X2PA 1Q16A 4KO8A 2A69D 2R7ZA 1TWCA 4AZDA 2YUJA 2V45A 5B6CA 2PI8A 1TWGA 3HU3A 1UHEA 2HCZX 4CRYG 1L8FA 4CS0A 2KI8A 2O5JD 1IW7D 2JIRA 3CF2A 2JA7A 1E61A 4AONB 1Y1VA 5GLXA 4JS7A 1CZ4A 4L48A 1I3QA 4JP6A 1KQGA 1SMYD 1QCSA 1E18A 1TWAA 1ZYRD 1YNND 5T5MD 3SUJA 3ENGA 4AAYA 2PNWA 1OA9A 2JIOA 4KDIA 3GTPA 5C18A 3GTQA 2R93A 3SULA 3X2OA 2WAQA 4AOKB 2JIPA 1H5NA 3X2GA 3SUMA 4C2MA 3GTOA 2B63A 2PJJA 2PJHB 5FTMA 1CZ5A 1Y5IA 2KQAA 1R27A 1Y4ZA 4CRZA 1WLFA 3HU2A 1K83A 2VPWA 4FERA 5GLYA 2BH0A 4JP7A 1PQHA 3QWZA 3X2IA 1UHDA 5EPPA 2PMZA 4QIWA 2A6ED 1TWFA 1KQFA 1G8JA 2E2IA 2G6GA 2E2HA 2JA6A 1OA7A 1PPYA 3QQ8A 1S3SA 5FTJA 5C1BA 1BW3A 2VPZA 3QC8A 1OGYA 1PT0A 1E5VA 5H4UA 1WCMA 1EU1A 2VPYA 2A6HD 3O5AA 3DMRA 1HD5A 3HKZA 1PT1A 1WC2A 2V3VA 1N10A 3TIWA 4ENGA 4KLNA 2NYAA 1PQEA 4GA6A 1BW4A 3TM7B 2C45A 2VUMA 4FG2A 4AYBA 3CZBA 3X2NA 1I50A 4FG4A 5DYIA 5GLFA 2DMRA 1R7RA 2JIMA 3X2KA 4RV0A 4AVRA 3GTKA 5FTLA 3GTMA 4D7ZB 1VC3B 2EEOB 1H0HA 2NVXA 3IR7A 4GA5A 1TWHA 3QQ7A 2A68D 5DYGA 2AE0X 2NVYA 2BE5D 5FTKA 1PYQA 2G5DA 3PLXB 1YNJD 1PYUB 2Y0SA 2GAEA 3ML1A 3IR5A 2YU9A 3GTLA 2PICA 3X2JA 4NOHA 2IV2X 1PQFA 4KDLA 1YLEA 2JIQA 3SUKA 2VPXA 1G8KA 1E32A 3M3GA 1AA6A 1QDNA 1ZC1A 1Y1WA 1AW8B 1E60A 3IR6A 3OUGA 1FDOA 3CQZA
chains in the Genus database with same CATH topology
3HU1A 5FTNA 3GTJA 1CR5A 1DMSA 1TMOA 5T5ID 1FDIA 4DMRA 2NAPA 2E7ZA 3H0GA 3FKIA 1SFOA 2R92A 1R9TA 1SIWA 4KODA 2CW0D 3GTGA 2JA5A 1DMRA 2WB1A 1Q16A 4KO8A 2A69D 2R7ZA 1TWCA 4AZDA 2YUJA 2V45A 5B6CA 2PI8A 1TWGA 3HU3A 1UHEA 4CRYG 4CS0A 2KI8A 2O5JD 1IW7D 2JIRA 3CF2A 2JA7A 1E61A 4AONB 1Y1VA 1CZ4A 1I3QA 1KQGA 1SMYD 1QCSA 1E18A 1TWAA 1ZYRD 1YNND 5T5MD 4AAYA 2PNWA 2JIOA 4KDIA 3GTPA 5C18A 3GTQA 2R93A 4AOKB 2WAQA 2JIPA 1H5NA 4C2MA 2B63A 3GTOA 2PJJA 2PJHB 5FTMA 1CZ5A 1Y5IA 1R27A 1Y4ZA 4CRZA 1WLFA 3HU2A 1K83A 2VPWA 1PQHA 3QWZA 1UHDA 5EPPA 2PMZA 4QIWA 2A6ED 1TWFA 1KQFA 1G8JA 2E2IA 2G6GA 2E2HA 2JA6A 1PPYA 3QQ8A 5C1BA 1S3SA 5FTJA 2VPZA 3QC8A 1OGYA 1PT0A 1E5VA 1WCMA 1EU1A 2VPYA 2A6HD 3O5AA 3DMRA 3HKZA 1PT1A 2V3VA 3TIWA 4KLNA 2NYAA 1PQEA 4GA6A 3TM7B 2C45A 2VUMA 4AYBA 3CZBA 1I50A 5DYIA 5GLFA 2DMRA 1R7RA 2JIMA 3GTMA 4RV0A 3GTKA 5FTLA 4D7ZB 1VC3B 2EEOB 1H0HA 2NVXA 3IR7A 4GA5A 1TWHA 3QQ7A 2A68D 5DYGA 2AE0X 2NVYA 2BE5D 5FTKA 1PYQA 2G5DA 3PLXB 1YNJD 1PYUB 2Y0SA 2GAEA 3ML1A 3IR5A 2YU9A 3GTLA 2PICA 4NOHA 2IV2X 1PQFA 4KDLA 1YLEA 2JIQA 2VPXA 1G8KA 1E32A 1AA6A 1QDNA 1ZC1A 1Y1WA 1AW8B 1E60A 3IR6A 3OUGA 1FDOA 3CQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU1 A;  5FTN A;  3GTJ A;  1CR5 A;  1DMS A;  1TMO A;  5T5I D;  1FDI A;  4DMR A;  2NAP A;  2E7Z A;  3H0G A;  3FKI A;  1SFO A;  2R92 A;  1R9T A;  1SIW A;  4KOD A;  3GTG A;  2JA5 A;  1DMR A;  2WB1 A;  1Q16 A;  4KO8 A;  2R7Z A;  1TWC A;  4AZD A;  2V45 A;  5B6C A;  1TWG A;  3HU3 A;  1UHE A;  4CRY G;  4CS0 A;  2KI8 A;  1IW7 D;  2JIR A;  3CF2 A;  2JA7 A;  1E61 A;  4AON B;  1Y1V A;  1CZ4 A;  1I3Q A;  1KQG A;  1QCS A;  1E18 A;  1TWA A;  5T5M D;  4AAY A;  2JIO A;  4KDI A;  3GTP A;  5C18 A;  3GTQ A;  2R93 A;  4AOK B;  2WAQ A;  2JIP A;  1H5N A;  4C2M A;  2B63 A;  3GTO A;  2PJH B;  5FTM A;  1CZ5 A;  1Y5I A;  1R27 A;  1Y4Z A;  4CRZ A;  1WLF A;  3HU2 A;  1K83 A;  2VPW A;  1PQH A;  3QWZ A;  1UHD A;  5EPP A;  2PMZ A;  4QIW A;  1TWF A;  1KQF A;  1G8J A;  2E2I A;  2E2H A;  2JA6 A;  1PPY A;  3QQ8 A;  5C1B A;  1S3S A;  5FTJ A;  2VPZ A;  3QC8 A;  1OGY A;  1PT0 A;  1E5V A;  1WCM A;  1EU1 A;  2VPY A;  3O5A A;  3DMR A;  3HKZ A;  1PT1 A;  2V3V A;  3TIW A;  4KLN A;  2NYA A;  1PQE A;  4GA6 A;  3TM7 B;  2C45 A;  2VUM A;  4AYB A;  1I50 A;  5DYI A;  5GLF A;  2DMR A;  1R7R A;  2JIM A;  3GTM A;  4RV0 A;  3GTK A;  5FTL A;  4D7Z B;  1VC3 B;  2EEO B;  1H0H A;  2NVX A;  3IR7 A;  4GA5 A;  1TWH A;  3QQ7 A;  5DYG A;  2NVY A;  5FTK A;  1PYQ A;  3GTL A;  3PLX B;  2YU9 A;  1PYU B;  2Y0S A;  3IR5 A;  3ML1 A;  2IV2 X;  1PQF A;  4KDL A;  1YLE A;  2JIQ A;  2VPX A;  1G8K A;  1E32 A;  1AA6 A;  1QDN A;  1Y1W A;  1AW8 B;  1E60 A;  3IR6 A;  3OUG A;  1FDO A;  3CQZ A; 
#chains in the Genus database with same CATH topology
 3HU1 A;  5FTN A;  3GTJ A;  4FFT A;  1CR5 A;  1DMS A;  1TMO A;  5GM9 A;  4ZM7 A;  5T5I D;  1FDI A;  3X2H A;  4DMR A;  4JJO A;  2NAP A;  2E7Z A;  3H0G A;  4JCW A;  3FKI A;  1SFO A;  2R92 A;  2ENG A;  3X2L A;  1R9T A;  1SIW A;  4KOD A;  2CW0 D;  3GTG A;  2JA5 A;  1DMR A;  3D30 A;  3X2M A;  2WB1 A;  3X2P A;  1Q16 A;  4KO8 A;  2A69 D;  2R7Z A;  1TWC A;  4AZD A;  2YUJ A;  2V45 A;  5B6C A;  2PI8 A;  1TWG A;  3HU3 A;  1UHE A;  2HCZ X;  4CRY G;  1L8F A;  4CS0 A;  2KI8 A;  2O5J D;  1IW7 D;  2JIR A;  3CF2 A;  2JA7 A;  1E61 A;  4AON B;  1Y1V A;  5GLX A;  4JS7 A;  1CZ4 A;  4L48 A;  1I3Q A;  4JP6 A;  1KQG A;  1SMY D;  1QCS A;  1E18 A;  1TWA A;  1ZYR D;  1YNN D;  5T5M D;  3SUJ A;  3ENG A;  4AAY A;  2PNW A;  1OA9 A;  2JIO A;  4KDI A;  3GTP A;  5C18 A;  3GTQ A;  2R93 A;  3SUL A;  3X2O A;  2WAQ A;  4AOK B;  2JIP A;  1H5N A;  3X2G A;  3SUM A;  4C2M A;  3GTO A;  2B63 A;  2PJJ A;  2PJH B;  5FTM A;  1CZ5 A;  1Y5I A;  2KQA A;  1R27 A;  1Y4Z A;  4CRZ A;  1WLF A;  3HU2 A;  1K83 A;  2VPW A;  4FER A;  5GLY A;  2BH0 A;  4JP7 A;  1PQH A;  3QWZ A;  3X2I A;  1UHD A;  5EPP A;  2PMZ A;  4QIW A;  2A6E D;  1TWF A;  1KQF A;  1G8J A;  2E2I A;  2G6G A;  2E2H A;  2JA6 A;  1OA7 A;  1PPY A;  3QQ8 A;  1S3S A;  5FTJ A;  5C1B A;  1BW3 A;  2VPZ A;  3QC8 A;  1OGY A;  1PT0 A;  1E5V A;  5H4U A;  1WCM A;  1EU1 A;  2VPY A;  2A6H D;  3O5A A;  3DMR A;  1HD5 A;  3HKZ A;  1PT1 A;  1WC2 A;  2V3V A;  1N10 A;  3TIW A;  4ENG A;  4KLN A;  2NYA A;  1PQE A;  4GA6 A;  1BW4 A;  3TM7 B;  2C45 A;  2VUM A;  4FG2 A;  4AYB A;  3CZB A;  3X2N A;  1I50 A;  4FG4 A;  5DYI A;  5GLF A;  2DMR A;  1R7R A;  2JIM A;  3X2K A;  4RV0 A;  4AVR A;  3GTK A;  5FTL A;  3GTM A;  4D7Z B;  1VC3 B;  2EEO B;  1H0H A;  2NVX A;  3IR7 A;  4GA5 A;  1TWH A;  3QQ7 A;  2A68 D;  5DYG A;  2AE0 X;  2NVY A;  2BE5 D;  5FTK A;  1PYQ A;  2G5D A;  3PLX B;  1YNJ D;  1PYU B;  2Y0S A;  2GAE A;  3ML1 A;  3IR5 A;  2YU9 A;  3GTL A;  2PIC A;  3X2J A;  4NOH A;  2IV2 X;  1PQF A;  4KDL A;  1YLE A;  2JIQ A;  3SUK A;  2VPX A;  1G8K A;  1E32 A;  3M3G A;  1AA6 A;  1QDN A;  1ZC1 A;  1Y1W A;  1AW8 B;  1E60 A;  3IR6 A;  3OUG A;  1FDO A;  3CQZ A; 
#chains in the Genus database with same CATH homology
 3HU1 A;  5FTN A;  3GTJ A;  1CR5 A;  1DMS A;  1TMO A;  5T5I D;  1FDI A;  4DMR A;  2NAP A;  2E7Z A;  3H0G A;  3FKI A;  1SFO A;  2R92 A;  1R9T A;  1SIW A;  4KOD A;  2CW0 D;  3GTG A;  2JA5 A;  1DMR A;  2WB1 A;  1Q16 A;  4KO8 A;  2A69 D;  2R7Z A;  1TWC A;  4AZD A;  2YUJ A;  2V45 A;  5B6C A;  2PI8 A;  1TWG A;  3HU3 A;  1UHE A;  4CRY G;  4CS0 A;  2KI8 A;  2O5J D;  1IW7 D;  2JIR A;  3CF2 A;  2JA7 A;  1E61 A;  4AON B;  1Y1V A;  1CZ4 A;  1I3Q A;  1KQG A;  1SMY D;  1QCS A;  1E18 A;  1TWA A;  1ZYR D;  1YNN D;  5T5M D;  4AAY A;  2PNW A;  2JIO A;  4KDI A;  3GTP A;  5C18 A;  3GTQ A;  2R93 A;  4AOK B;  2WAQ A;  2JIP A;  1H5N A;  4C2M A;  2B63 A;  3GTO A;  2PJJ A;  2PJH B;  5FTM A;  1CZ5 A;  1Y5I A;  1R27 A;  1Y4Z A;  4CRZ A;  1WLF A;  3HU2 A;  1K83 A;  2VPW A;  1PQH A;  3QWZ A;  1UHD A;  5EPP A;  2PMZ A;  4QIW A;  2A6E D;  1TWF A;  1KQF A;  1G8J A;  2E2I A;  2G6G A;  2E2H A;  2JA6 A;  1PPY A;  3QQ8 A;  5C1B A;  1S3S A;  5FTJ A;  2VPZ A;  3QC8 A;  1OGY A;  1PT0 A;  1E5V A;  1WCM A;  1EU1 A;  2VPY A;  2A6H D;  3O5A A;  3DMR A;  3HKZ A;  1PT1 A;  2V3V A;  3TIW A;  4KLN A;  2NYA A;  1PQE A;  4GA6 A;  3TM7 B;  2C45 A;  2VUM A;  4AYB A;  3CZB A;  1I50 A;  5DYI A;  5GLF A;  2DMR A;  1R7R A;  2JIM A;  3GTM A;  4RV0 A;  3GTK A;  5FTL A;  4D7Z B;  1VC3 B;  2EEO B;  1H0H A;  2NVX A;  3IR7 A;  4GA5 A;  1TWH A;  3QQ7 A;  2A68 D;  5DYG A;  2AE0 X;  2NVY A;  2BE5 D;  5FTK A;  1PYQ A;  2G5D A;  3PLX B;  1YNJ D;  1PYU B;  2Y0S A;  2GAE A;  3ML1 A;  3IR5 A;  2YU9 A;  3GTL A;  2PIC A;  4NOH A;  2IV2 X;  1PQF A;  4KDL A;  1YLE A;  2JIQ A;  2VPX A;  1G8K A;  1E32 A;  1AA6 A;  1QDN A;  1ZC1 A;  1Y1W A;  1AW8 B;  1E60 A;  3IR6 A;  3OUG A;  1FDO A;  3CQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...