1AW8B

Pyruvoyl dependent aspartate decarboxylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASPARTATE-ALPHA-DECARBOXYLASE
molecule tags Decarboxylase
source organism Escherichia coli
publication title Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
pubmed doi rcsb
total genus 21
structure length 90
sequence length 90
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 1997-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aw8B00
4CRYG 3GTQA 2JIRA 1PYUB 1S3SA 3H0GA 4GA6A 2DMRA 5FTJA 2YU9A 4AZDA 4KDLA 1TWHA 1QDNA 3HU3A 3IR6A 1Y1WA 2Y0SA 3CF2A 5GLFA 1E61A 5T5ID 2VPZA 5FTMA 2NYAA 1UHEA 1TWGA 3GTMA 1DMSA 1PPYA 2E2IA 3GTKA 1E32A 1R9TA 4AONB 1SFOA 2JA6A 2JIOA 1OGYA 1PT1A 4AOKB 4CS0A 3GTGA 1CZ4A 1E18A 3PLXB 3OUGA 4AAYA 3HU1A 1R7RA 4KO8A 1CR5A 1Y1VA 1G8JA 1I50A 1Q16A 1DMRA 3TIWA 2JIMA 2V45A 1TWCA 3QQ8A 1R27A 1H0HA 2NVXA 1WLFA 5FTKA 5DYIA 3GTPA 4RV0A 2VPWA 2WAQA 4KLNA 2JIPA 1Y5IA 2IV2X 5T5MD 2R7ZA 3CQZA 5DYGA 2JIQA 5C1BA 4DMRA 3IR7A 1K83A 3HU2A 1UHDA 2E7ZA 3DMRA 2NVYA 3GTLA 2V3VA 1PQFA 4D7ZB 1YLEA 2VPXA 5FTNA 1I3QA 2PMZA 4QIWA 3IR5A 1AA6A 5B6CA 1E5VA 1PT0A 1TWAA 1SIWA 1IW7D 3GTJA 3HKZA 2C45A 1EU1A 1AW8B 1CZ5A 1WCMA 3QWZA 5EPPA 1QCSA 5C18A 2EEOB 2R93A 5FTLA 4KDIA 1G8KA 2KI8A 3QQ7A 3ML1A 1TWFA 2VPYA 4CRZA 2R92A 3QC8A 3O5AA 2VUMA 2JA7A 1KQGA 1PQEA 1VC3B 1H5NA 4KODA 1E60A 2E2HA 1FDOA 3GTOA 3TM7B 1FDIA 4GA5A 2NAPA 3FKIA 1KQFA 2PJHB 1Y4ZA 2JA5A 2WB1A 4AYBA 4C2MA 1PQHA 1PYQA 1TMOA 2B63A
chains in the Genus database with same CATH superfamily
2ENGA 2PICA 4CRYG 3GTQA 2BE5D 2YUJA 1N10A 2JIRA 1PYUB 1S3SA 1YNND 3H0GA 2DMRA 4GA6A 1OA9A 4JP6A 5FTJA 4KDLA 1TWHA 1QDNA 3HU3A 3IR6A 4FG2A 2Y0SA 3CF2A 5GLFA 1E61A 5T5ID 3SUMA 4ENGA 2VPZA 3X2LA 3M3GA 5FTMA 2NYAA 3X2HA 1UHEA 1TWGA 3GTMA 1DMSA 3X2KA 4JCWA 1PPYA 2E2IA 2A68D 3GTKA 1E32A 1R9TA 4AONB 1SFOA 2JA6A 1ZYRD 2JIOA 1OGYA 1PT1A 4AOKB 4CS0A 4FERA 3X2JA 3GTGA 2PI8A 2PNWA 1Y1WA 1CZ4A 1E18A 3PLXB 2HCZX 3OUGA 4AAYA 1BW3A 3HU1A 1R7RA 4KO8A 1CR5A 1Y1VA 1G8JA 3X2MA 1Q16A 1I50A 1DMRA 3TIWA 3X2PA 2JIMA 2V45A 1TWCA 3QQ8A 1R27A 1H0HA 2NVXA 5H4UA 4JS7A 1WLFA 4JP7A 5FTKA 5GLXA 5DYIA 3GTPA 4RV0A 2VPWA 2PJJA 2WAQA 4KLNA 2GAEA 2JIPA 1Y5IA 2IV2X 5T5MD 3X2IA 2R7ZA 4AZDA 3CQZA 5DYGA 2JIQA 5C1BA 4DMRA 1HD5A 3IR7A 1K83A 3HU2A 1UHDA 3X2GA 2E7ZA 3DMRA 2NVYA 3GTLA 2V3VA 1PQFA 4D7ZB 2BH0A 4ZM7A 2A6ED 1YLEA 2VPXA 3X2OA 2O5JD 5FTNA 1I3QA 2PMZA 4QIWA 1BW4A 3SUJA 3IR5A 1AA6A 1SMYD 5B6CA 1E5VA 1PT0A 4L48A 1TWAA 1SIWA 3X2NA 1IW7D 2G6GA 3GTJA 5GLYA 5GM9A 1L8FA 3HKZA 1OA7A 1WC2A 2C45A 3D30A 1EU1A 1AW8B 2YU9A 1CZ5A 1WCMA 3QWZA 2KQAA 5EPPA 1QCSA 3SUKA 5C18A 3CZBA 2EEOB 2R93A 5FTLA 4KDIA 1G8KA 4NOHA 2KI8A 3SULA 3QQ7A 3ML1A 1TWFA 2VPYA 4FFTA 4CRZA 2R92A 3QC8A 2A69D 2A6HD 3O5AA 2VUMA 2JA7A 1KQGA 1PQEA 2AE0X 1VC3B 1H5NA 4FG4A 4KODA 1E60A 2E2HA 1FDOA 3GTOA 3ENGA 3TM7B 1FDIA 1ZC1A 4GA5A 2NAPA 3FKIA 4AVRA 2PJHB 1Y4ZA 1KQFA 2CW0D 2JA5A 2WB1A 4AYBA 4C2MA 2G5DA 4JJOA 1PQHA 1PYQA 1TMOA 2B63A 1YNJD
chains in the Genus database with same CATH topology
2PICA 4CRYG 3GTQA 2BE5D 2YUJA 2JIRA 1PYUB 1S3SA 1YNND 3H0GA 2DMRA 4GA6A 5FTJA 4AZDA 2YU9A 4KDLA 1TWHA 1QDNA 3HU3A 3IR6A 1Y1WA 2Y0SA 3CF2A 5GLFA 1E61A 5T5ID 2VPZA 5FTMA 2NYAA 1UHEA 1TWGA 3GTMA 1DMSA 1PPYA 2E2IA 2A68D 3GTKA 1E32A 1R9TA 4AONB 1SFOA 2JA6A 1ZYRD 2JIOA 1OGYA 1PT1A 4AOKB 4CS0A 3GTGA 2PNWA 2PI8A 1CZ4A 1E18A 3PLXB 3OUGA 4AAYA 3HU1A 1R7RA 4KO8A 1CR5A 1Y1VA 1G8JA 1I50A 1Q16A 1DMRA 3TIWA 2JIMA 2V45A 1TWCA 3QQ8A 1R27A 1H0HA 2NVXA 1WLFA 5FTKA 5DYIA 3GTPA 4RV0A 2VPWA 2PJJA 2WAQA 4KLNA 2GAEA 2JIPA 1Y5IA 2IV2X 5T5MD 2R7ZA 3CQZA 5DYGA 2JIQA 5C1BA 4DMRA 3IR7A 1K83A 3HU2A 1UHDA 2E7ZA 3DMRA 2NVYA 3GTLA 2V3VA 1PQFA 4D7ZB 2A6ED 1YLEA 2VPXA 2O5JD 5FTNA 1I3QA 2PMZA 4QIWA 3IR5A 1AA6A 1SMYD 5B6CA 1E5VA 1PT0A 1TWAA 1SIWA 1IW7D 2G6GA 3GTJA 3HKZA 2C45A 1EU1A 1AW8B 1CZ5A 1WCMA 3QWZA 5EPPA 1QCSA 5C18A 3CZBA 2EEOB 2R93A 5FTLA 4KDIA 1G8KA 4NOHA 2KI8A 3QQ7A 3ML1A 1TWFA 2VPYA 4CRZA 2R92A 3QC8A 2A69D 2A6HD 3O5AA 2VUMA 2JA7A 1KQGA 1PQEA 2AE0X 1VC3B 1H5NA 4KODA 1E60A 2E2HA 1FDOA 3GTOA 3TM7B 1FDIA 1ZC1A 4GA5A 2NAPA 3FKIA 1KQFA 2PJHB 1Y4ZA 2CW0D 2JA5A 2WB1A 4AYBA 4C2MA 2G5DA 1PQHA 1PYQA 1TMOA 2B63A 1YNJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRY G;  3GTQ A;  2JIR A;  1PYU B;  1S3S A;  3H0G A;  4GA6 A;  2DMR A;  5FTJ A;  2YU9 A;  4AZD A;  4KDL A;  1TWH A;  1QDN A;  3HU3 A;  3IR6 A;  1Y1W A;  2Y0S A;  3CF2 A;  5GLF A;  1E61 A;  5T5I D;  2VPZ A;  5FTM A;  2NYA A;  1UHE A;  1TWG A;  3GTM A;  1DMS A;  1PPY A;  2E2I A;  3GTK A;  1E32 A;  1R9T A;  4AON B;  1SFO A;  2JA6 A;  2JIO A;  1OGY A;  1PT1 A;  4AOK B;  4CS0 A;  3GTG A;  1CZ4 A;  1E18 A;  3PLX B;  3OUG A;  4AAY A;  3HU1 A;  1R7R A;  4KO8 A;  1CR5 A;  1Y1V A;  1G8J A;  1I50 A;  1Q16 A;  1DMR A;  3TIW A;  2JIM A;  2V45 A;  1TWC A;  3QQ8 A;  1R27 A;  1H0H A;  2NVX A;  1WLF A;  5FTK A;  5DYI A;  3GTP A;  4RV0 A;  2VPW A;  2WAQ A;  4KLN A;  2JIP A;  1Y5I A;  2IV2 X;  5T5M D;  2R7Z A;  3CQZ A;  5DYG A;  2JIQ A;  5C1B A;  4DMR A;  3IR7 A;  1K83 A;  3HU2 A;  1UHD A;  2E7Z A;  3DMR A;  2NVY A;  3GTL A;  2V3V A;  1PQF A;  4D7Z B;  1YLE A;  2VPX A;  5FTN A;  1I3Q A;  2PMZ A;  4QIW A;  3IR5 A;  1AA6 A;  5B6C A;  1E5V A;  1PT0 A;  1TWA A;  1SIW A;  1IW7 D;  3GTJ A;  3HKZ A;  2C45 A;  1EU1 A;  1AW8 B;  1CZ5 A;  1WCM A;  3QWZ A;  5EPP A;  1QCS A;  5C18 A;  2EEO B;  2R93 A;  5FTL A;  4KDI A;  1G8K A;  2KI8 A;  3QQ7 A;  3ML1 A;  1TWF A;  2VPY A;  4CRZ A;  2R92 A;  3QC8 A;  3O5A A;  2VUM A;  2JA7 A;  1KQG A;  1PQE A;  1VC3 B;  1H5N A;  4KOD A;  1E60 A;  2E2H A;  1FDO A;  3GTO A;  3TM7 B;  1FDI A;  4GA5 A;  2NAP A;  3FKI A;  1KQF A;  2PJH B;  1Y4Z A;  2JA5 A;  2WB1 A;  4AYB A;  4C2M A;  1PQH A;  1PYQ A;  1TMO A;  2B63 A; 
#chains in the Genus database with same CATH topology
 2ENG A;  2PIC A;  4CRY G;  3GTQ A;  2BE5 D;  2YUJ A;  1N10 A;  2JIR A;  1PYU B;  1S3S A;  1YNN D;  3H0G A;  2DMR A;  4GA6 A;  1OA9 A;  4JP6 A;  5FTJ A;  4KDL A;  1TWH A;  1QDN A;  3HU3 A;  3IR6 A;  4FG2 A;  2Y0S A;  3CF2 A;  5GLF A;  1E61 A;  5T5I D;  3SUM A;  4ENG A;  2VPZ A;  3X2L A;  3M3G A;  5FTM A;  2NYA A;  3X2H A;  1UHE A;  1TWG A;  3GTM A;  1DMS A;  3X2K A;  4JCW A;  1PPY A;  2E2I A;  2A68 D;  3GTK A;  1E32 A;  1R9T A;  4AON B;  1SFO A;  2JA6 A;  1ZYR D;  2JIO A;  1OGY A;  1PT1 A;  4AOK B;  4CS0 A;  4FER A;  3X2J A;  3GTG A;  2PI8 A;  2PNW A;  1Y1W A;  1CZ4 A;  1E18 A;  3PLX B;  2HCZ X;  3OUG A;  4AAY A;  1BW3 A;  3HU1 A;  1R7R A;  4KO8 A;  1CR5 A;  1Y1V A;  1G8J A;  3X2M A;  1Q16 A;  1I50 A;  1DMR A;  3TIW A;  3X2P A;  2JIM A;  2V45 A;  1TWC A;  3QQ8 A;  1R27 A;  1H0H A;  2NVX A;  5H4U A;  4JS7 A;  1WLF A;  4JP7 A;  5FTK A;  5GLX A;  5DYI A;  3GTP A;  4RV0 A;  2VPW A;  2PJJ A;  2WAQ A;  4KLN A;  2GAE A;  2JIP A;  1Y5I A;  2IV2 X;  5T5M D;  3X2I A;  2R7Z A;  4AZD A;  3CQZ A;  5DYG A;  2JIQ A;  5C1B A;  4DMR A;  1HD5 A;  3IR7 A;  1K83 A;  3HU2 A;  1UHD A;  3X2G A;  2E7Z A;  3DMR A;  2NVY A;  3GTL A;  2V3V A;  1PQF A;  4D7Z B;  2BH0 A;  4ZM7 A;  2A6E D;  1YLE A;  2VPX A;  3X2O A;  2O5J D;  5FTN A;  1I3Q A;  2PMZ A;  4QIW A;  1BW4 A;  3SUJ A;  3IR5 A;  1AA6 A;  1SMY D;  5B6C A;  1E5V A;  1PT0 A;  4L48 A;  1TWA A;  1SIW A;  3X2N A;  1IW7 D;  2G6G A;  3GTJ A;  5GLY A;  5GM9 A;  1L8F A;  3HKZ A;  1OA7 A;  1WC2 A;  2C45 A;  3D30 A;  1EU1 A;  1AW8 B;  2YU9 A;  1CZ5 A;  1WCM A;  3QWZ A;  2KQA A;  5EPP A;  1QCS A;  3SUK A;  5C18 A;  3CZB A;  2EEO B;  2R93 A;  5FTL A;  4KDI A;  1G8K A;  4NOH A;  2KI8 A;  3SUL A;  3QQ7 A;  3ML1 A;  1TWF A;  2VPY A;  4FFT A;  4CRZ A;  2R92 A;  3QC8 A;  2A69 D;  2A6H D;  3O5A A;  2VUM A;  2JA7 A;  1KQG A;  1PQE A;  2AE0 X;  1VC3 B;  1H5N A;  4FG4 A;  4KOD A;  1E60 A;  2E2H A;  1FDO A;  3GTO A;  3ENG A;  3TM7 B;  1FDI A;  1ZC1 A;  4GA5 A;  2NAP A;  3FKI A;  4AVR A;  2PJH B;  1Y4Z A;  1KQF A;  2CW0 D;  2JA5 A;  2WB1 A;  4AYB A;  4C2M A;  2G5D A;  4JJO A;  1PQH A;  1PYQ A;  1TMO A;  2B63 A;  1YNJ D; 
#chains in the Genus database with same CATH homology
 2PIC A;  4CRY G;  3GTQ A;  2BE5 D;  2YUJ A;  2JIR A;  1PYU B;  1S3S A;  1YNN D;  3H0G A;  2DMR A;  4GA6 A;  5FTJ A;  4AZD A;  2YU9 A;  4KDL A;  1TWH A;  1QDN A;  3HU3 A;  3IR6 A;  1Y1W A;  2Y0S A;  3CF2 A;  5GLF A;  1E61 A;  5T5I D;  2VPZ A;  5FTM A;  2NYA A;  1UHE A;  1TWG A;  3GTM A;  1DMS A;  1PPY A;  2E2I A;  2A68 D;  3GTK A;  1E32 A;  1R9T A;  4AON B;  1SFO A;  2JA6 A;  1ZYR D;  2JIO A;  1OGY A;  1PT1 A;  4AOK B;  4CS0 A;  3GTG A;  2PNW A;  2PI8 A;  1CZ4 A;  1E18 A;  3PLX B;  3OUG A;  4AAY A;  3HU1 A;  1R7R A;  4KO8 A;  1CR5 A;  1Y1V A;  1G8J A;  1I50 A;  1Q16 A;  1DMR A;  3TIW A;  2JIM A;  2V45 A;  1TWC A;  3QQ8 A;  1R27 A;  1H0H A;  2NVX A;  1WLF A;  5FTK A;  5DYI A;  3GTP A;  4RV0 A;  2VPW A;  2PJJ A;  2WAQ A;  4KLN A;  2GAE A;  2JIP A;  1Y5I A;  2IV2 X;  5T5M D;  2R7Z A;  3CQZ A;  5DYG A;  2JIQ A;  5C1B A;  4DMR A;  3IR7 A;  1K83 A;  3HU2 A;  1UHD A;  2E7Z A;  3DMR A;  2NVY A;  3GTL A;  2V3V A;  1PQF A;  4D7Z B;  2A6E D;  1YLE A;  2VPX A;  2O5J D;  5FTN A;  1I3Q A;  2PMZ A;  4QIW A;  3IR5 A;  1AA6 A;  1SMY D;  5B6C A;  1E5V A;  1PT0 A;  1TWA A;  1SIW A;  1IW7 D;  2G6G A;  3GTJ A;  3HKZ A;  2C45 A;  1EU1 A;  1AW8 B;  1CZ5 A;  1WCM A;  3QWZ A;  5EPP A;  1QCS A;  5C18 A;  3CZB A;  2EEO B;  2R93 A;  5FTL A;  4KDI A;  1G8K A;  4NOH A;  2KI8 A;  3QQ7 A;  3ML1 A;  1TWF A;  2VPY A;  4CRZ A;  2R92 A;  3QC8 A;  2A69 D;  2A6H D;  3O5A A;  2VUM A;  2JA7 A;  1KQG A;  1PQE A;  2AE0 X;  1VC3 B;  1H5N A;  4KOD A;  1E60 A;  2E2H A;  1FDO A;  3GTO A;  3TM7 B;  1FDI A;  1ZC1 A;  4GA5 A;  2NAP A;  3FKI A;  1KQF A;  2PJH B;  1Y4Z A;  2CW0 D;  2JA5 A;  2WB1 A;  4AYB A;  4C2M A;  2G5D A;  1PQH A;  1PYQ A;  1TMO A;  2B63 A;  1YNJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...