4D7ZB

E. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVQGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
molecule tags Lyase
source organism Escherichia coli
publication title The Structure of the E. Coli L-Aspartate-Alpha-Decarboxylase Mutant N72Q to a Resolution of 1.9 Angstroms
rcsb
total genus 22
structure length 94
sequence length 94
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4d7zB00
1AA6A 1G8KA 1EU1A 2PMZA 3GTGA 1G8JA 2KI8A 1PT0A 2NVYA 3H0GA 3QQ8A 5T5MD 4AOKB 3GTQA 1PPYA 1PQHA 5T5ID 1UHEA 3DMRA 1AW8B 2E2IA 2JIQA 1I3QA 3HU2A 4KO8A 1E60A 2VUMA 4GA5A 1CR5A 2JA7A 3CF2A 2PJHB 2JIMA 2C45A 1UHDA 1S3SA 1E32A 4GA6A 1E5VA 1CZ4A 1Y4ZA 1H0HA 1DMSA 5B6CA 3FKIA 3GTPA 1DMRA 1TWFA 1R9TA 1R7RA 3QWZA 1YLEA 2JIPA 3QC8A 2NVXA 2YU9A 1I50A 1K83A 1TWAA 4AZDA 1PQFA 3TIWA 2VPYA 1IW7D 1R27A 5C1BA 2DMRA 4AONB 3PLXB 2JIOA 2VPWA 5FTJA 2VPZA 1SIWA 3IR7A 3O5AA 2V45A 2E2HA 4CRZA 1VC3B 3CQZA 2R7ZA 5EPPA 2R92A 2NAPA 1E18A 1PQEA 5GLFA 1KQGA 5DYIA 3HU3A 3QQ7A 3GTOA 5FTNA 1WLFA 5FTLA 4AYBA 3GTKA 2EEOB 2JIRA 4AAYA 3GTJA 2JA6A 2B63A 2JA5A 1PYQA 4KDLA 4CS0A 3OUGA 1PYUB 1TWCA 3HU1A 4CRYG 3ML1A 1FDOA 2E7ZA 1KQFA 2Y0SA 1H5NA 1QDNA 4KLNA 5C18A 1PT1A 5FTMA 1FDIA 2VPXA 5DYGA 3GTLA 3GTMA 2NYAA 2V3VA 2WB1A 4QIWA 3TM7B 4DMRA 1E61A 1QCSA 1Q16A 1SFOA 2R93A 1OGYA 1TWGA 3IR6A 2IV2X 2WAQA 1CZ5A 1TMOA 4C2MA 4KDIA 1Y1VA 1Y5IA 1TWHA 1WCMA 3HKZA 4KODA 1Y1WA 4RV0A 3IR5A 4D7ZB 5FTKA
chains in the Genus database with same CATH superfamily
1AA6A 1G8KA 2O5JD 3X2HA 2YUJA 1EU1A 3SUJA 2PMZA 3GTGA 1G8JA 2KI8A 1PT0A 2NVYA 3H0GA 3QQ8A 5T5MD 4AOKB 3GTQA 1PPYA 1PQHA 5T5ID 1N10A 1UHEA 1AW8B 3DMRA 2E2IA 2A6ED 2JIQA 4JP7A 5GLYA 1I3QA 3HU2A 4KO8A 4FG4A 1E60A 2VUMA 4GA5A 1ZC1A 1CR5A 2JA7A 2PJHB 3CF2A 2JIMA 2C45A 1UHDA 1S3SA 1E32A 2ENGA 1E5VA 4GA6A 3SULA 1CZ4A 1Y4ZA 1H0HA 1DMSA 5B6CA 1WC2A 3FKIA 3GTPA 1DMRA 3X2PA 2BH0A 1TWFA 1R9TA 4JP6A 4JCWA 1R7RA 3QWZA 1YLEA 2JIPA 3QC8A 2NVXA 2YU9A 1I50A 1K83A 1BW3A 1TWAA 3X2MA 4AZDA 1PQFA 3TIWA 2VPYA 1IW7D 1R27A 5H4UA 5C1BA 2PI8A 2DMRA 3X2GA 4AONB 3X2KA 3PLXB 2JIOA 2VPWA 5FTJA 2VPZA 1SIWA 3IR7A 3O5AA 2V45A 2E2HA 4CRZA 1VC3B 3CQZA 2R7ZA 2G6GA 5EPPA 1OA7A 2R92A 4JS7A 3D30A 4JJOA 2A68D 2NAPA 3X2IA 2KQAA 2HCZX 4FFTA 3ENGA 2PJJA 1E18A 1PQEA 5GLFA 3SUKA 1KQGA 5DYIA 1HD5A 2AE0X 3SUMA 3HU3A 3QQ7A 3GTOA 5FTNA 4FERA 3X2LA 1WLFA 4FG2A 5FTLA 1OA9A 4AYBA 3GTKA 2EEOB 2JIRA 1L8FA 3X2JA 2G5DA 4AAYA 3GTJA 2JA6A 2B63A 2PNWA 2PICA 1PYQA 4KDLA 2JA5A 4CS0A 5GLXA 3OUGA 1PYUB 1TWCA 3HU1A 4ZM7A 4CRYG 3ML1A 1FDOA 2E7ZA 1KQFA 2Y0SA 2A69D 3X2NA 1H5NA 1QDNA 3CZBA 4KLNA 5C18A 1PT1A 1YNND 3M3GA 4ENGA 1BW4A 5FTMA 1FDIA 2VPXA 5DYGA 3GTLA 3GTMA 2BE5D 2NYAA 2V3VA 2WB1A 5GM9A 4QIWA 3TM7B 4NOHA 4AVRA 1YNJD 4DMRA 1E61A 1QCSA 1Q16A 1SFOA 1ZYRD 2R93A 1OGYA 1TWGA 3IR6A 2IV2X 2WAQA 1CZ5A 1TMOA 4L48A 4C2MA 3X2OA 4KDIA 1Y1VA 1Y5IA 1TWHA 1WCMA 2GAEA 2CW0D 3HKZA 4KODA 1Y1WA 1SMYD 4RV0A 3IR5A 4D7ZB 5FTKA 2A6HD
chains in the Genus database with same CATH topology
1AA6A 1G8KA 2O5JD 2YUJA 1EU1A 2PMZA 3GTGA 1G8JA 2KI8A 1PT0A 2NVYA 3H0GA 3QQ8A 5T5MD 4AOKB 3GTQA 1PPYA 1PQHA 5T5ID 1UHEA 3DMRA 1AW8B 2E2IA 2A6ED 2JIQA 1I3QA 3HU2A 4KO8A 1E60A 2VUMA 4GA5A 1ZC1A 1CR5A 2JA7A 2PJHB 3CF2A 2JIMA 2C45A 1UHDA 1S3SA 1E32A 4GA6A 1E5VA 1CZ4A 1Y4ZA 1H0HA 1DMSA 5B6CA 3FKIA 3GTPA 1DMRA 1TWFA 1R9TA 1R7RA 3QWZA 1YLEA 2JIPA 3QC8A 2NVXA 2YU9A 1I50A 1K83A 1TWAA 4AZDA 1PQFA 3TIWA 2VPYA 1IW7D 1R27A 5C1BA 2PI8A 2DMRA 4AONB 3PLXB 2JIOA 2VPWA 5FTJA 2VPZA 1SIWA 3IR7A 3O5AA 2V45A 2E2HA 4CRZA 1VC3B 3CQZA 2R7ZA 2G6GA 5EPPA 2R92A 2A68D 2NAPA 2PJJA 1E18A 1PQEA 5GLFA 1KQGA 5DYIA 2AE0X 3HU3A 3QQ7A 3GTOA 5FTNA 1WLFA 5FTLA 4AYBA 3GTKA 2EEOB 2JIRA 2G5DA 4AAYA 3GTJA 2JA6A 2B63A 2PNWA 2PICA 1PYQA 4KDLA 2JA5A 4CS0A 3OUGA 1PYUB 1TWCA 3HU1A 4CRYG 3ML1A 1FDOA 2E7ZA 1KQFA 2Y0SA 2A69D 1H5NA 1QDNA 3CZBA 4KLNA 5C18A 1PT1A 1YNND 5FTMA 1FDIA 2VPXA 5DYGA 3GTLA 3GTMA 2BE5D 2NYAA 2V3VA 2WB1A 4QIWA 3TM7B 4NOHA 4DMRA 1YNJD 1E61A 1QCSA 1Q16A 1SFOA 1ZYRD 2R93A 1OGYA 1TWGA 3IR6A 2IV2X 2WAQA 1CZ5A 1TMOA 4C2MA 4KDIA 1Y1VA 1Y5IA 1TWHA 1WCMA 2GAEA 2CW0D 3HKZA 4KODA 1Y1WA 1SMYD 4RV0A 3IR5A 4D7ZB 5FTKA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA6 A;  1G8K A;  1EU1 A;  2PMZ A;  3GTG A;  1G8J A;  2KI8 A;  1PT0 A;  2NVY A;  3H0G A;  3QQ8 A;  5T5M D;  4AOK B;  3GTQ A;  1PPY A;  1PQH A;  5T5I D;  1UHE A;  3DMR A;  1AW8 B;  2E2I A;  2JIQ A;  1I3Q A;  3HU2 A;  4KO8 A;  1E60 A;  2VUM A;  4GA5 A;  1CR5 A;  2JA7 A;  3CF2 A;  2PJH B;  2JIM A;  2C45 A;  1UHD A;  1S3S A;  1E32 A;  4GA6 A;  1E5V A;  1CZ4 A;  1Y4Z A;  1H0H A;  1DMS A;  5B6C A;  3FKI A;  3GTP A;  1DMR A;  1TWF A;  1R9T A;  1R7R A;  3QWZ A;  1YLE A;  2JIP A;  3QC8 A;  2NVX A;  2YU9 A;  1I50 A;  1K83 A;  1TWA A;  4AZD A;  1PQF A;  3TIW A;  2VPY A;  1IW7 D;  1R27 A;  5C1B A;  2DMR A;  4AON B;  3PLX B;  2JIO A;  2VPW A;  5FTJ A;  2VPZ A;  1SIW A;  3IR7 A;  3O5A A;  2V45 A;  2E2H A;  4CRZ A;  1VC3 B;  3CQZ A;  2R7Z A;  5EPP A;  2R92 A;  2NAP A;  1E18 A;  1PQE A;  5GLF A;  1KQG A;  5DYI A;  3HU3 A;  3QQ7 A;  3GTO A;  5FTN A;  1WLF A;  5FTL A;  4AYB A;  3GTK A;  2EEO B;  2JIR A;  4AAY A;  3GTJ A;  2JA6 A;  2B63 A;  2JA5 A;  1PYQ A;  4KDL A;  4CS0 A;  3OUG A;  1PYU B;  1TWC A;  3HU1 A;  4CRY G;  3ML1 A;  1FDO A;  2E7Z A;  1KQF A;  2Y0S A;  1H5N A;  1QDN A;  4KLN A;  5C18 A;  1PT1 A;  5FTM A;  1FDI A;  2VPX A;  5DYG A;  3GTL A;  3GTM A;  2NYA A;  2V3V A;  2WB1 A;  4QIW A;  3TM7 B;  4DMR A;  1E61 A;  1QCS A;  1Q16 A;  1SFO A;  2R93 A;  1OGY A;  1TWG A;  3IR6 A;  2IV2 X;  2WAQ A;  1CZ5 A;  1TMO A;  4C2M A;  4KDI A;  1Y1V A;  1Y5I A;  1TWH A;  1WCM A;  3HKZ A;  4KOD A;  1Y1W A;  4RV0 A;  3IR5 A;  4D7Z B;  5FTK A; 
#chains in the Genus database with same CATH topology
 1AA6 A;  1G8K A;  2O5J D;  3X2H A;  2YUJ A;  1EU1 A;  3SUJ A;  2PMZ A;  3GTG A;  1G8J A;  2KI8 A;  1PT0 A;  2NVY A;  3H0G A;  3QQ8 A;  5T5M D;  4AOK B;  3GTQ A;  1PPY A;  1PQH A;  5T5I D;  1N10 A;  1UHE A;  1AW8 B;  3DMR A;  2E2I A;  2A6E D;  2JIQ A;  4JP7 A;  5GLY A;  1I3Q A;  3HU2 A;  4KO8 A;  4FG4 A;  1E60 A;  2VUM A;  4GA5 A;  1ZC1 A;  1CR5 A;  2JA7 A;  2PJH B;  3CF2 A;  2JIM A;  2C45 A;  1UHD A;  1S3S A;  1E32 A;  2ENG A;  1E5V A;  4GA6 A;  3SUL A;  1CZ4 A;  1Y4Z A;  1H0H A;  1DMS A;  5B6C A;  1WC2 A;  3FKI A;  3GTP A;  1DMR A;  3X2P A;  2BH0 A;  1TWF A;  1R9T A;  4JP6 A;  4JCW A;  1R7R A;  3QWZ A;  1YLE A;  2JIP A;  3QC8 A;  2NVX A;  2YU9 A;  1I50 A;  1K83 A;  1BW3 A;  1TWA A;  3X2M A;  4AZD A;  1PQF A;  3TIW A;  2VPY A;  1IW7 D;  1R27 A;  5H4U A;  5C1B A;  2PI8 A;  2DMR A;  3X2G A;  4AON B;  3X2K A;  3PLX B;  2JIO A;  2VPW A;  5FTJ A;  2VPZ A;  1SIW A;  3IR7 A;  3O5A A;  2V45 A;  2E2H A;  4CRZ A;  1VC3 B;  3CQZ A;  2R7Z A;  2G6G A;  5EPP A;  1OA7 A;  2R92 A;  4JS7 A;  3D30 A;  4JJO A;  2A68 D;  2NAP A;  3X2I A;  2KQA A;  2HCZ X;  4FFT A;  3ENG A;  2PJJ A;  1E18 A;  1PQE A;  5GLF A;  3SUK A;  1KQG A;  5DYI A;  1HD5 A;  2AE0 X;  3SUM A;  3HU3 A;  3QQ7 A;  3GTO A;  5FTN A;  4FER A;  3X2L A;  1WLF A;  4FG2 A;  5FTL A;  1OA9 A;  4AYB A;  3GTK A;  2EEO B;  2JIR A;  1L8F A;  3X2J A;  2G5D A;  4AAY A;  3GTJ A;  2JA6 A;  2B63 A;  2PNW A;  2PIC A;  1PYQ A;  4KDL A;  2JA5 A;  4CS0 A;  5GLX A;  3OUG A;  1PYU B;  1TWC A;  3HU1 A;  4ZM7 A;  4CRY G;  3ML1 A;  1FDO A;  2E7Z A;  1KQF A;  2Y0S A;  2A69 D;  3X2N A;  1H5N A;  1QDN A;  3CZB A;  4KLN A;  5C18 A;  1PT1 A;  1YNN D;  3M3G A;  4ENG A;  1BW4 A;  5FTM A;  1FDI A;  2VPX A;  5DYG A;  3GTL A;  3GTM A;  2BE5 D;  2NYA A;  2V3V A;  2WB1 A;  5GM9 A;  4QIW A;  3TM7 B;  4NOH A;  4AVR A;  1YNJ D;  4DMR A;  1E61 A;  1QCS A;  1Q16 A;  1SFO A;  1ZYR D;  2R93 A;  1OGY A;  1TWG A;  3IR6 A;  2IV2 X;  2WAQ A;  1CZ5 A;  1TMO A;  4L48 A;  4C2M A;  3X2O A;  4KDI A;  1Y1V A;  1Y5I A;  1TWH A;  1WCM A;  2GAE A;  2CW0 D;  3HKZ A;  4KOD A;  1Y1W A;  1SMY D;  4RV0 A;  3IR5 A;  4D7Z B;  5FTK A;  2A6H D; 
#chains in the Genus database with same CATH homology
 1AA6 A;  1G8K A;  2O5J D;  2YUJ A;  1EU1 A;  2PMZ A;  3GTG A;  1G8J A;  2KI8 A;  1PT0 A;  2NVY A;  3H0G A;  3QQ8 A;  5T5M D;  4AOK B;  3GTQ A;  1PPY A;  1PQH A;  5T5I D;  1UHE A;  3DMR A;  1AW8 B;  2E2I A;  2A6E D;  2JIQ A;  1I3Q A;  3HU2 A;  4KO8 A;  1E60 A;  2VUM A;  4GA5 A;  1ZC1 A;  1CR5 A;  2JA7 A;  2PJH B;  3CF2 A;  2JIM A;  2C45 A;  1UHD A;  1S3S A;  1E32 A;  4GA6 A;  1E5V A;  1CZ4 A;  1Y4Z A;  1H0H A;  1DMS A;  5B6C A;  3FKI A;  3GTP A;  1DMR A;  1TWF A;  1R9T A;  1R7R A;  3QWZ A;  1YLE A;  2JIP A;  3QC8 A;  2NVX A;  2YU9 A;  1I50 A;  1K83 A;  1TWA A;  4AZD A;  1PQF A;  3TIW A;  2VPY A;  1IW7 D;  1R27 A;  5C1B A;  2PI8 A;  2DMR A;  4AON B;  3PLX B;  2JIO A;  2VPW A;  5FTJ A;  2VPZ A;  1SIW A;  3IR7 A;  3O5A A;  2V45 A;  2E2H A;  4CRZ A;  1VC3 B;  3CQZ A;  2R7Z A;  2G6G A;  5EPP A;  2R92 A;  2A68 D;  2NAP A;  2PJJ A;  1E18 A;  1PQE A;  5GLF A;  1KQG A;  5DYI A;  2AE0 X;  3HU3 A;  3QQ7 A;  3GTO A;  5FTN A;  1WLF A;  5FTL A;  4AYB A;  3GTK A;  2EEO B;  2JIR A;  2G5D A;  4AAY A;  3GTJ A;  2JA6 A;  2B63 A;  2PNW A;  2PIC A;  1PYQ A;  4KDL A;  2JA5 A;  4CS0 A;  3OUG A;  1PYU B;  1TWC A;  3HU1 A;  4CRY G;  3ML1 A;  1FDO A;  2E7Z A;  1KQF A;  2Y0S A;  2A69 D;  1H5N A;  1QDN A;  3CZB A;  4KLN A;  5C18 A;  1PT1 A;  1YNN D;  5FTM A;  1FDI A;  2VPX A;  5DYG A;  3GTL A;  3GTM A;  2BE5 D;  2NYA A;  2V3V A;  2WB1 A;  4QIW A;  3TM7 B;  4NOH A;  4DMR A;  1YNJ D;  1E61 A;  1QCS A;  1Q16 A;  1SFO A;  1ZYR D;  2R93 A;  1OGY A;  1TWG A;  3IR6 A;  2IV2 X;  2WAQ A;  1CZ5 A;  1TMO A;  4C2M A;  4KDI A;  1Y1V A;  1Y5I A;  1TWH A;  1WCM A;  2GAE A;  2CW0 D;  3HKZ A;  4KOD A;  1Y1W A;  1SMY D;  4RV0 A;  3IR5 A;  4D7Z B;  5FTK A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...