4D7ZB

E. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVQGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
publication title The Structure of the E. Coli L-Aspartate-Alpha-Decarboxylase Mutant N72Q to a Resolution of 1.9 Angstroms
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 22
structure length 94
sequence length 94
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4d7zB00
5T5MD 1AA6A 3HU1A 2VPWA 3GTJA 1PT1A 2JA5A 1DMSA 5FTNA 4C2MA 2VPZA 2E2IA 1CZ5A 5FTLA 1I50A 4RV0A 2WAQA 3IR6A 5GLFA 2EEOB 5EPPA 1TWAA 3OUGA 4AONB 2R92A 5T5ID 2WB1A 1TWGA 2JA6A 4KODA 1UHDA 5B6CA 4GA5A 1TWCA 5FTKA 3GTMA 1Y1WA 2NVXA 1S3SA 5C1BA 3QQ8A 3PLXB 1IW7D 4D7ZB 1K83A 1R27A 1CR5A 2NYAA 1UHEA 1PPYA 4QIWA 1H5NA 2R93A 3GTGA 2V45A 4CRYG 3GTPA 2V3VA 4KDLA 4AOKB 3GTKA 1FDOA 3O5AA 2C45A 1H0HA 3GTLA 1E18A 1VC3B 4AAYA 5C18A 3QWZA 2E7ZA 3TIWA 4GA6A 2VPYA 1TWFA 3QQ7A 4DMRA 1AW8B 4KDIA 1PYQA 3IR7A 1PQFA 1SIWA 5DYIA 2JIPA 1OGYA 1PQEA 4KLNA 1SFOA 2R7ZA 2JIQA 3HKZA 2YU9A 1CZ4A 2NVYA 3ML1A 1KQGA 3GTQA 2E2HA 1FDIA 1WCMA 2DMRA 1G8JA 2VPXA 3DMRA 1R7RA 3CF2A 1E32A 4CS0A 4KO8A 2PJHB 2VUMA 1TMOA 1G8KA 1R9TA 3QC8A 2JA7A 4AZDA 1PYUB 3HU3A 1Y5IA 4CRZA 1WLFA 2B63A 1I3QA 2JIRA 1TWHA 2PMZA 1E61A 1QCSA 3CQZA 3TM7B 1Q16A 5FTMA 3FKIA 1KQFA 2JIOA 1PT0A 1Y4ZA 2Y0SA 5FTJA 1E60A 1EU1A 1DMRA 1PQHA 5DYGA 2KI8A 2JIMA 3GTOA 1YLEA 1Y1VA 2IV2X 2NAPA 3H0GA 3HU2A 4AYBA 3IR5A 1E5VA 1QDNA
chains in the Genus database with same CATH superfamily
5T5MD 1AA6A 3HU1A 2A68D 2VPWA 3SUMA 3GTJA 4JJOA 1PT1A 2JA5A 1DMSA 1N10A 5FTNA 4C2MA 2VPZA 2E2IA 1CZ5A 5GM9A 2KQAA 5FTLA 4NOHA 1I50A 4RV0A 2WAQA 3IR6A 2YUJA 5GLFA 2EEOB 5EPPA 1TWAA 3OUGA 4AONB 2R92A 3X2LA 5T5ID 2WB1A 1TWGA 2JA6A 4KODA 1UHDA 5B6CA 2PNWA 4GA5A 1TWCA 1ZC1A 2G5DA 5FTKA 1OA7A 3GTMA 1Y1WA 4ENGA 2NVXA 1S3SA 5C1BA 2AE0X 2BE5D 3CZBA 3QQ8A 3PLXB 1IW7D 4D7ZB 1K83A 1R27A 1CR5A 2NYAA 3X2GA 1UHEA 1SMYD 1PPYA 1WC2A 4QIWA 1H5NA 4ZM7A 2R93A 3GTGA 2V45A 4CRYG 1BW3A 2GAEA 3X2IA 3GTPA 2V3VA 2O5JD 4KDLA 4AOKB 5H4UA 1FDOA 3O5AA 3GTKA 2C45A 1H0HA 3X2KA 3GTLA 1HD5A 1OA9A 1YNND 3X2PA 1E18A 1VC3B 4AAYA 5C18A 2PI8A 3QWZA 2A6ED 2E7ZA 2HCZX 3TIWA 4GA6A 4FERA 2VPYA 1TWFA 3QQ7A 4DMRA 1AW8B 4FG4A 4KDIA 1PYQA 3IR7A 1PQFA 1SIWA 5DYIA 2JIPA 1OGYA 1PQEA 2A6HD 1ZYRD 4KLNA 1SFOA 2R7ZA 2JIQA 3HKZA 2YU9A 1CZ4A 2NVYA 3X2NA 3ML1A 1KQGA 3GTQA 2E2HA 4FG2A 1FDIA 2A69D 1L8FA 1WCMA 3X2MA 4JP6A 2DMRA 3SUKA 1G8JA 2VPXA 1R7RA 3DMRA 3CF2A 4JS7A 3X2JA 3SUJA 1E32A 4CS0A 2PJJA 4KO8A 2PJHB 3D30A 3ENGA 2PICA 2VUMA 1TMOA 1G8KA 1YNJD 3QC8A 1R9TA 5GLYA 2JA7A 5GLXA 1PYUB 2BH0A 4AZDA 1BW4A 2CW0D 3HU3A 1Y5IA 4CRZA 1WLFA 2B63A 3M3GA 1I3QA 2JIRA 1TWHA 2PMZA 1E61A 2ENGA 1QCSA 3CQZA 3X2OA 3TM7B 1Q16A 4FFTA 5FTMA 3FKIA 4AVRA 1KQFA 2JIOA 1PT0A 1Y4ZA 3X2HA 4L48A 4JP7A 3SULA 2Y0SA 5FTJA 1E60A 1EU1A 1DMRA 1PQHA 5DYGA 2KI8A 2JIMA 3GTOA 1YLEA 1Y1VA 4JCWA 2G6GA 2IV2X 2NAPA 3H0GA 3HU2A 4AYBA 3IR5A 1E5VA 1QDNA
chains in the Genus database with same CATH topology
5T5MD 1AA6A 3HU1A 2A68D 2VPWA 3GTJA 1PT1A 2JA5A 1DMSA 5FTNA 4C2MA 2VPZA 2E2IA 1CZ5A 5FTLA 1I50A 4NOHA 4RV0A 2WAQA 3IR6A 2YUJA 5GLFA 2EEOB 5EPPA 1TWAA 3OUGA 4AONB 2R92A 5T5ID 2WB1A 1TWGA 2JA6A 4KODA 1UHDA 5B6CA 2PNWA 4GA5A 1TWCA 1ZC1A 2G5DA 5FTKA 3GTMA 1Y1WA 2NVXA 1S3SA 5C1BA 2AE0X 2BE5D 3CZBA 3QQ8A 3PLXB 1IW7D 4D7ZB 1K83A 1R27A 1CR5A 2NYAA 1UHEA 1SMYD 1PPYA 4QIWA 1H5NA 2R93A 3GTGA 2V45A 4CRYG 2GAEA 3GTPA 2V3VA 2O5JD 4KDLA 4AOKB 3GTKA 1FDOA 3O5AA 2C45A 1H0HA 3GTLA 1YNND 1E18A 1VC3B 4AAYA 5C18A 2PI8A 3QWZA 2A6ED 2E7ZA 3TIWA 4GA6A 2VPYA 1TWFA 3QQ7A 4DMRA 1AW8B 4KDIA 1PYQA 3IR7A 1PQFA 1SIWA 5DYIA 2JIPA 1OGYA 1PQEA 2A6HD 1ZYRD 4KLNA 1SFOA 2R7ZA 2JIQA 3HKZA 2YU9A 1CZ4A 2NVYA 3ML1A 1KQGA 3GTQA 2E2HA 1FDIA 2A69D 1WCMA 2DMRA 1G8JA 2VPXA 1R7RA 3DMRA 3CF2A 1E32A 4CS0A 2PJJA 4KO8A 2PJHB 2PICA 2VUMA 1TMOA 1G8KA 1YNJD 3QC8A 1R9TA 2JA7A 4AZDA 1PYUB 2CW0D 3HU3A 1Y5IA 4CRZA 1WLFA 2B63A 1I3QA 2JIRA 1TWHA 2PMZA 1E61A 1QCSA 3CQZA 3TM7B 1Q16A 5FTMA 3FKIA 1KQFA 2JIOA 1PT0A 1Y4ZA 2Y0SA 5FTJA 1E60A 1EU1A 1DMRA 1PQHA 5DYGA 2KI8A 2JIMA 3GTOA 1YLEA 1Y1VA 2G6GA 2IV2X 2NAPA 3H0GA 3HU2A 4AYBA 3IR5A 1E5VA 1QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T5M D;  1AA6 A;  3HU1 A;  2VPW A;  3GTJ A;  1PT1 A;  2JA5 A;  1DMS A;  5FTN A;  4C2M A;  2VPZ A;  2E2I A;  1CZ5 A;  5FTL A;  1I50 A;  4RV0 A;  2WAQ A;  3IR6 A;  5GLF A;  2EEO B;  5EPP A;  1TWA A;  3OUG A;  4AON B;  2R92 A;  5T5I D;  2WB1 A;  1TWG A;  2JA6 A;  4KOD A;  1UHD A;  5B6C A;  4GA5 A;  1TWC A;  5FTK A;  3GTM A;  1Y1W A;  2NVX A;  1S3S A;  5C1B A;  3QQ8 A;  3PLX B;  1IW7 D;  4D7Z B;  1K83 A;  1R27 A;  1CR5 A;  2NYA A;  1UHE A;  1PPY A;  4QIW A;  1H5N A;  2R93 A;  3GTG A;  2V45 A;  4CRY G;  3GTP A;  2V3V A;  4KDL A;  4AOK B;  3GTK A;  1FDO A;  3O5A A;  2C45 A;  1H0H A;  3GTL A;  1E18 A;  1VC3 B;  4AAY A;  5C18 A;  3QWZ A;  2E7Z A;  3TIW A;  4GA6 A;  2VPY A;  1TWF A;  3QQ7 A;  4DMR A;  1AW8 B;  4KDI A;  1PYQ A;  3IR7 A;  1PQF A;  1SIW A;  5DYI A;  2JIP A;  1OGY A;  1PQE A;  4KLN A;  1SFO A;  2R7Z A;  2JIQ A;  3HKZ A;  2YU9 A;  1CZ4 A;  2NVY A;  3ML1 A;  1KQG A;  3GTQ A;  2E2H A;  1FDI A;  1WCM A;  2DMR A;  1G8J A;  2VPX A;  3DMR A;  1R7R A;  3CF2 A;  1E32 A;  4CS0 A;  4KO8 A;  2PJH B;  2VUM A;  1TMO A;  1G8K A;  1R9T A;  3QC8 A;  2JA7 A;  4AZD A;  1PYU B;  3HU3 A;  1Y5I A;  4CRZ A;  1WLF A;  2B63 A;  1I3Q A;  2JIR A;  1TWH A;  2PMZ A;  1E61 A;  1QCS A;  3CQZ A;  3TM7 B;  1Q16 A;  5FTM A;  3FKI A;  1KQF A;  2JIO A;  1PT0 A;  1Y4Z A;  2Y0S A;  5FTJ A;  1E60 A;  1EU1 A;  1DMR A;  1PQH A;  5DYG A;  2KI8 A;  2JIM A;  3GTO A;  1YLE A;  1Y1V A;  2IV2 X;  2NAP A;  3H0G A;  3HU2 A;  4AYB A;  3IR5 A;  1E5V A;  1QDN A; 
#chains in the Genus database with same CATH topology
 5T5M D;  1AA6 A;  3HU1 A;  2A68 D;  2VPW A;  3SUM A;  3GTJ A;  4JJO A;  1PT1 A;  2JA5 A;  1DMS A;  1N10 A;  5FTN A;  4C2M A;  2VPZ A;  2E2I A;  1CZ5 A;  5GM9 A;  2KQA A;  5FTL A;  4NOH A;  1I50 A;  4RV0 A;  2WAQ A;  3IR6 A;  2YUJ A;  5GLF A;  2EEO B;  5EPP A;  1TWA A;  3OUG A;  4AON B;  2R92 A;  3X2L A;  5T5I D;  2WB1 A;  1TWG A;  2JA6 A;  4KOD A;  1UHD A;  5B6C A;  2PNW A;  4GA5 A;  1TWC A;  1ZC1 A;  2G5D A;  5FTK A;  1OA7 A;  3GTM A;  1Y1W A;  4ENG A;  2NVX A;  1S3S A;  5C1B A;  2AE0 X;  2BE5 D;  3CZB A;  3QQ8 A;  3PLX B;  1IW7 D;  4D7Z B;  1K83 A;  1R27 A;  1CR5 A;  2NYA A;  3X2G A;  1UHE A;  1SMY D;  1PPY A;  1WC2 A;  4QIW A;  1H5N A;  4ZM7 A;  2R93 A;  3GTG A;  2V45 A;  4CRY G;  1BW3 A;  2GAE A;  3X2I A;  3GTP A;  2V3V A;  2O5J D;  4KDL A;  4AOK B;  5H4U A;  1FDO A;  3O5A A;  3GTK A;  2C45 A;  1H0H A;  3X2K A;  3GTL A;  1HD5 A;  1OA9 A;  1YNN D;  3X2P A;  1E18 A;  1VC3 B;  4AAY A;  5C18 A;  2PI8 A;  3QWZ A;  2A6E D;  2E7Z A;  2HCZ X;  3TIW A;  4GA6 A;  4FER A;  2VPY A;  1TWF A;  3QQ7 A;  4DMR A;  1AW8 B;  4FG4 A;  4KDI A;  1PYQ A;  3IR7 A;  1PQF A;  1SIW A;  5DYI A;  2JIP A;  1OGY A;  1PQE A;  2A6H D;  1ZYR D;  4KLN A;  1SFO A;  2R7Z A;  2JIQ A;  3HKZ A;  2YU9 A;  1CZ4 A;  2NVY A;  3X2N A;  3ML1 A;  1KQG A;  3GTQ A;  2E2H A;  4FG2 A;  1FDI A;  2A69 D;  1L8F A;  1WCM A;  3X2M A;  4JP6 A;  2DMR A;  3SUK A;  1G8J A;  2VPX A;  1R7R A;  3DMR A;  3CF2 A;  4JS7 A;  3X2J A;  3SUJ A;  1E32 A;  4CS0 A;  2PJJ A;  4KO8 A;  2PJH B;  3D30 A;  3ENG A;  2PIC A;  2VUM A;  1TMO A;  1G8K A;  1YNJ D;  3QC8 A;  1R9T A;  5GLY A;  2JA7 A;  5GLX A;  1PYU B;  2BH0 A;  4AZD A;  1BW4 A;  2CW0 D;  3HU3 A;  1Y5I A;  4CRZ A;  1WLF A;  2B63 A;  3M3G A;  1I3Q A;  2JIR A;  1TWH A;  2PMZ A;  1E61 A;  2ENG A;  1QCS A;  3CQZ A;  3X2O A;  3TM7 B;  1Q16 A;  4FFT A;  5FTM A;  3FKI A;  4AVR A;  1KQF A;  2JIO A;  1PT0 A;  1Y4Z A;  3X2H A;  4L48 A;  4JP7 A;  3SUL A;  2Y0S A;  5FTJ A;  1E60 A;  1EU1 A;  1DMR A;  1PQH A;  5DYG A;  2KI8 A;  2JIM A;  3GTO A;  1YLE A;  1Y1V A;  4JCW A;  2G6G A;  2IV2 X;  2NAP A;  3H0G A;  3HU2 A;  4AYB A;  3IR5 A;  1E5V A;  1QDN A; 
#chains in the Genus database with same CATH homology
 5T5M D;  1AA6 A;  3HU1 A;  2A68 D;  2VPW A;  3GTJ A;  1PT1 A;  2JA5 A;  1DMS A;  5FTN A;  4C2M A;  2VPZ A;  2E2I A;  1CZ5 A;  5FTL A;  1I50 A;  4NOH A;  4RV0 A;  2WAQ A;  3IR6 A;  2YUJ A;  5GLF A;  2EEO B;  5EPP A;  1TWA A;  3OUG A;  4AON B;  2R92 A;  5T5I D;  2WB1 A;  1TWG A;  2JA6 A;  4KOD A;  1UHD A;  5B6C A;  2PNW A;  4GA5 A;  1TWC A;  1ZC1 A;  2G5D A;  5FTK A;  3GTM A;  1Y1W A;  2NVX A;  1S3S A;  5C1B A;  2AE0 X;  2BE5 D;  3CZB A;  3QQ8 A;  3PLX B;  1IW7 D;  4D7Z B;  1K83 A;  1R27 A;  1CR5 A;  2NYA A;  1UHE A;  1SMY D;  1PPY A;  4QIW A;  1H5N A;  2R93 A;  3GTG A;  2V45 A;  4CRY G;  2GAE A;  3GTP A;  2V3V A;  2O5J D;  4KDL A;  4AOK B;  3GTK A;  1FDO A;  3O5A A;  2C45 A;  1H0H A;  3GTL A;  1YNN D;  1E18 A;  1VC3 B;  4AAY A;  5C18 A;  2PI8 A;  3QWZ A;  2A6E D;  2E7Z A;  3TIW A;  4GA6 A;  2VPY A;  1TWF A;  3QQ7 A;  4DMR A;  1AW8 B;  4KDI A;  1PYQ A;  3IR7 A;  1PQF A;  1SIW A;  5DYI A;  2JIP A;  1OGY A;  1PQE A;  2A6H D;  1ZYR D;  4KLN A;  1SFO A;  2R7Z A;  2JIQ A;  3HKZ A;  2YU9 A;  1CZ4 A;  2NVY A;  3ML1 A;  1KQG A;  3GTQ A;  2E2H A;  1FDI A;  2A69 D;  1WCM A;  2DMR A;  1G8J A;  2VPX A;  1R7R A;  3DMR A;  3CF2 A;  1E32 A;  4CS0 A;  2PJJ A;  4KO8 A;  2PJH B;  2PIC A;  2VUM A;  1TMO A;  1G8K A;  1YNJ D;  3QC8 A;  1R9T A;  2JA7 A;  4AZD A;  1PYU B;  2CW0 D;  3HU3 A;  1Y5I A;  4CRZ A;  1WLF A;  2B63 A;  1I3Q A;  2JIR A;  1TWH A;  2PMZ A;  1E61 A;  1QCS A;  3CQZ A;  3TM7 B;  1Q16 A;  5FTM A;  3FKI A;  1KQF A;  2JIO A;  1PT0 A;  1Y4Z A;  2Y0S A;  5FTJ A;  1E60 A;  1EU1 A;  1DMR A;  1PQH A;  5DYG A;  2KI8 A;  2JIM A;  3GTO A;  1YLE A;  1Y1V A;  2G6G A;  2IV2 X;  2NAP A;  3H0G A;  3HU2 A;  4AYB A;  3IR5 A;  1E5V A;  1QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...