4D7ZB

E. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVQGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
publication title The Structure of the E. Coli L-Aspartate-Alpha-Decarboxylase Mutant N72Q to a Resolution of 1.9 Angstroms
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 22
structure length 94
sequence length 94
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4d7zB00
3TM7B 1QCSA 1AW8B 1YLEA 4CRZA 1R9TA 1R7RA 2PJHB 4KODA 1TWCA 2KI8A 3ML1A 1DMRA 5DYGA 4AONB 3HU2A 2PMZA 3IR5A 1PYUB 2VUMA 1H5NA 1TWHA 3GTGA 1PYQA 1CZ5A 2IV2X 1SIWA 1E61A 1E5VA 3CQZA 2JA7A 2V3VA 2B63A 2E2HA 1IW7D 3QC8A 3HU3A 3PLXB 3HU1A 5FTJA 3DMRA 5EPPA 1TWAA 4CRYG 5T5MD 2YU9A 1R27A 1K83A 1PT1A 1TMOA 1Y4ZA 4D7ZB 2VPWA 4GA6A 1Q16A 4C2MA 2JIRA 4RV0A 1CR5A 1PQHA 3GTOA 3GTPA 1UHEA 5FTLA 4KDIA 1I50A 3GTLA 1PQEA 5FTMA 1E32A 5C1BA 1Y5IA 1FDOA 1DMSA 4KLNA 3TIWA 1PPYA 3OUGA 4GA5A 2R92A 5C18A 1WCMA 1G8JA 2WB1A 4AAYA 1CZ4A 2DMRA 2R7ZA 3GTKA 4AOKB 1TWFA 2VPYA 4AZDA 1PQFA 1G8KA 3GTQA 3QQ7A 5T5ID 2EEOB 3GTMA 5FTNA 1H0HA 1Y1VA 1Y1WA 3QQ8A 2NAPA 1TWGA 3CF2A 1UHDA 1WLFA 2WAQA 2JA5A 4AYBA 3IR7A 1SFOA 1E60A 2JIMA 1VC3B 2Y0SA 1EU1A 2JA6A 2JIPA 5GLFA 2R93A 4KDLA 2NYAA 1KQFA 5DYIA 3QWZA 3O5AA 1OGYA 4QIWA 3GTJA 5FTKA 2VPZA 2NVXA 1AA6A 3H0GA 1KQGA 1E18A 3IR6A 5B6CA 2E7ZA 4CS0A 4DMRA 1QDNA 2E2IA 3HKZA 2C45A 3FKIA 2V45A 2VPXA 1I3QA 1PT0A 2JIQA 1FDIA 2JIOA 2NVYA 4KO8A 1S3SA
chains in the Genus database with same CATH superfamily
3X2JA 3TM7B 1QCSA 1AW8B 1OA7A 1YLEA 2AE0X 2G6GA 2PI8A 4CRZA 1ZC1A 1R9TA 1R7RA 2PJHB 3ENGA 4KODA 1TWCA 1OA9A 2KI8A 3ML1A 1DMRA 2ENGA 5DYGA 3SUJA 4AONB 2PICA 3HU2A 2PMZA 3IR5A 1PYUB 2VUMA 4JS7A 1H5NA 1TWHA 3GTGA 1SMYD 2PNWA 4ZM7A 3X2IA 1PYQA 1CZ5A 2IV2X 2HCZX 5GM9A 1SIWA 1E61A 1E5VA 3CQZA 2JA7A 2V3VA 2G5DA 2B63A 2E2HA 1IW7D 2GAEA 3QC8A 3HU3A 3X2NA 3PLXB 3X2GA 3HU1A 5FTJA 3DMRA 5EPPA 1TWAA 4CRYG 5T5MD 2YU9A 1R27A 1K83A 1PT1A 1TMOA 1Y4ZA 4D7ZB 2PJJA 2VPWA 4GA6A 1Q16A 4C2MA 2JIRA 3X2LA 4RV0A 1CR5A 1PQHA 3GTOA 2KQAA 1UHEA 4NOHA 5FTLA 3GTPA 4KDIA 1I50A 3GTLA 1BW4A 1PQEA 2BH0A 5FTMA 2YUJA 1E32A 1ZYRD 5C1BA 1Y5IA 1FDOA 3X2OA 1DMSA 4KLNA 3TIWA 1PPYA 3OUGA 4GA5A 2R92A 5C18A 4FG2A 1YNND 1G8JA 1WCMA 2WB1A 1CZ4A 2DMRA 3M3GA 4AAYA 2R7ZA 1L8FA 3X2KA 3GTKA 4AOKB 1TWFA 3X2HA 2VPYA 4AZDA 1PQFA 1G8KA 3GTQA 3QQ7A 5T5ID 2EEOB 3GTMA 5FTNA 1H0HA 1Y1VA 1Y1WA 3QQ8A 2NAPA 1TWGA 3CF2A 1UHDA 1WLFA 2WAQA 4JJOA 2JA5A 2CW0D 4AYBA 3IR7A 1SFOA 1E60A 2JIMA 1VC3B 2A69D 4L48A 4FFTA 2Y0SA 1EU1A 3X2MA 2JA6A 2JIPA 2A6ED 5GLXA 2A6HD 5H4UA 5GLFA 3D30A 2R93A 3SUMA 4KDLA 1N10A 2NYAA 2O5JD 2A68D 1KQFA 5DYIA 4JCWA 4JP7A 3QWZA 2BE5D 1OGYA 3O5AA 4QIWA 3GTJA 5FTKA 2VPZA 1BW3A 2NVXA 1AA6A 3H0GA 4FG4A 4JP6A 1HD5A 5GLYA 1KQGA 1E18A 3IR6A 3CZBA 5B6CA 1WC2A 2E7ZA 3SUKA 4CS0A 4DMRA 1QDNA 2E2IA 1YNJD 3HKZA 2C45A 3FKIA 2V45A 3X2PA 3SULA 2VPXA 1I3QA 4ENGA 1PT0A 4FERA 2JIQA 1FDIA 4AVRA 2JIOA 2NVYA 4KO8A 1S3SA
chains in the Genus database with same CATH topology
3TM7B 1QCSA 1AW8B 1YLEA 2AE0X 2G6GA 2PI8A 4CRZA 1ZC1A 1R9TA 1R7RA 2PJHB 4KODA 1TWCA 2KI8A 3ML1A 1DMRA 5DYGA 4AONB 2PICA 3HU2A 2PMZA 3IR5A 1PYUB 2VUMA 1H5NA 1TWHA 3GTGA 1SMYD 2PNWA 1PYQA 1CZ5A 2IV2X 1SIWA 1E61A 1E5VA 3CQZA 2JA7A 2V3VA 2G5DA 2B63A 2E2HA 1IW7D 2GAEA 3QC8A 3HU3A 3PLXB 3HU1A 5FTJA 3DMRA 5EPPA 1TWAA 4CRYG 5T5MD 2YU9A 1R27A 1K83A 1PT1A 1TMOA 1Y4ZA 4D7ZB 2PJJA 2VPWA 4GA6A 1Q16A 4C2MA 2JIRA 4RV0A 1CR5A 1PQHA 3GTOA 3GTPA 1UHEA 4NOHA 5FTLA 4KDIA 1I50A 3GTLA 1PQEA 5FTMA 2YUJA 1E32A 1ZYRD 5C1BA 1Y5IA 1FDOA 1DMSA 4KLNA 3TIWA 1PPYA 3OUGA 4GA5A 2R92A 5C18A 1YNND 1G8JA 1WCMA 2WB1A 1CZ4A 2DMRA 4AAYA 2R7ZA 3GTKA 4AOKB 1TWFA 2VPYA 4AZDA 1PQFA 1G8KA 3GTQA 3QQ7A 5T5ID 2EEOB 3GTMA 5FTNA 1H0HA 1Y1VA 1Y1WA 3QQ8A 2NAPA 1TWGA 3CF2A 1UHDA 1WLFA 2WAQA 2JA5A 2CW0D 4AYBA 3IR7A 1SFOA 1E60A 2JIMA 1VC3B 2A69D 2Y0SA 1EU1A 2JA6A 2JIPA 2A6ED 2A6HD 5GLFA 2R93A 4KDLA 2NYAA 2O5JD 2A68D 1KQFA 5DYIA 3QWZA 2BE5D 1OGYA 3O5AA 4QIWA 3GTJA 5FTKA 2VPZA 2NVXA 1AA6A 3H0GA 1KQGA 1E18A 3IR6A 3CZBA 5B6CA 2E7ZA 4CS0A 4DMRA 1QDNA 2E2IA 1YNJD 3HKZA 2C45A 3FKIA 2V45A 2VPXA 1I3QA 1PT0A 2JIQA 1FDIA 2JIOA 2NVYA 4KO8A 1S3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TM7 B;  1QCS A;  1AW8 B;  1YLE A;  4CRZ A;  1R9T A;  1R7R A;  2PJH B;  4KOD A;  1TWC A;  2KI8 A;  3ML1 A;  1DMR A;  5DYG A;  4AON B;  3HU2 A;  2PMZ A;  3IR5 A;  1PYU B;  2VUM A;  1H5N A;  1TWH A;  3GTG A;  1PYQ A;  1CZ5 A;  2IV2 X;  1SIW A;  1E61 A;  1E5V A;  3CQZ A;  2JA7 A;  2V3V A;  2B63 A;  2E2H A;  1IW7 D;  3QC8 A;  3HU3 A;  3PLX B;  3HU1 A;  5FTJ A;  3DMR A;  5EPP A;  1TWA A;  4CRY G;  5T5M D;  2YU9 A;  1R27 A;  1K83 A;  1PT1 A;  1TMO A;  1Y4Z A;  4D7Z B;  2VPW A;  4GA6 A;  1Q16 A;  4C2M A;  2JIR A;  4RV0 A;  1CR5 A;  1PQH A;  3GTO A;  3GTP A;  1UHE A;  5FTL A;  4KDI A;  1I50 A;  3GTL A;  1PQE A;  5FTM A;  1E32 A;  5C1B A;  1Y5I A;  1FDO A;  1DMS A;  4KLN A;  3TIW A;  1PPY A;  3OUG A;  4GA5 A;  2R92 A;  5C18 A;  1WCM A;  1G8J A;  2WB1 A;  4AAY A;  1CZ4 A;  2DMR A;  2R7Z A;  3GTK A;  4AOK B;  1TWF A;  2VPY A;  4AZD A;  1PQF A;  1G8K A;  3GTQ A;  3QQ7 A;  5T5I D;  2EEO B;  3GTM A;  5FTN A;  1H0H A;  1Y1V A;  1Y1W A;  3QQ8 A;  2NAP A;  1TWG A;  3CF2 A;  1UHD A;  1WLF A;  2WAQ A;  2JA5 A;  4AYB A;  3IR7 A;  1SFO A;  1E60 A;  2JIM A;  1VC3 B;  2Y0S A;  1EU1 A;  2JA6 A;  2JIP A;  5GLF A;  2R93 A;  4KDL A;  2NYA A;  1KQF A;  5DYI A;  3QWZ A;  3O5A A;  1OGY A;  4QIW A;  3GTJ A;  5FTK A;  2VPZ A;  2NVX A;  1AA6 A;  3H0G A;  1KQG A;  1E18 A;  3IR6 A;  5B6C A;  2E7Z A;  4CS0 A;  4DMR A;  1QDN A;  2E2I A;  3HKZ A;  2C45 A;  3FKI A;  2V45 A;  2VPX A;  1I3Q A;  1PT0 A;  2JIQ A;  1FDI A;  2JIO A;  2NVY A;  4KO8 A;  1S3S A; 
#chains in the Genus database with same CATH topology
 3X2J A;  3TM7 B;  1QCS A;  1AW8 B;  1OA7 A;  1YLE A;  2AE0 X;  2G6G A;  2PI8 A;  4CRZ A;  1ZC1 A;  1R9T A;  1R7R A;  2PJH B;  3ENG A;  4KOD A;  1TWC A;  1OA9 A;  2KI8 A;  3ML1 A;  1DMR A;  2ENG A;  5DYG A;  3SUJ A;  4AON B;  2PIC A;  3HU2 A;  2PMZ A;  3IR5 A;  1PYU B;  2VUM A;  4JS7 A;  1H5N A;  1TWH A;  3GTG A;  1SMY D;  2PNW A;  4ZM7 A;  3X2I A;  1PYQ A;  1CZ5 A;  2IV2 X;  2HCZ X;  5GM9 A;  1SIW A;  1E61 A;  1E5V A;  3CQZ A;  2JA7 A;  2V3V A;  2G5D A;  2B63 A;  2E2H A;  1IW7 D;  2GAE A;  3QC8 A;  3HU3 A;  3X2N A;  3PLX B;  3X2G A;  3HU1 A;  5FTJ A;  3DMR A;  5EPP A;  1TWA A;  4CRY G;  5T5M D;  2YU9 A;  1R27 A;  1K83 A;  1PT1 A;  1TMO A;  1Y4Z A;  4D7Z B;  2PJJ A;  2VPW A;  4GA6 A;  1Q16 A;  4C2M A;  2JIR A;  3X2L A;  4RV0 A;  1CR5 A;  1PQH A;  3GTO A;  2KQA A;  1UHE A;  4NOH A;  5FTL A;  3GTP A;  4KDI A;  1I50 A;  3GTL A;  1BW4 A;  1PQE A;  2BH0 A;  5FTM A;  2YUJ A;  1E32 A;  1ZYR D;  5C1B A;  1Y5I A;  1FDO A;  3X2O A;  1DMS A;  4KLN A;  3TIW A;  1PPY A;  3OUG A;  4GA5 A;  2R92 A;  5C18 A;  4FG2 A;  1YNN D;  1G8J A;  1WCM A;  2WB1 A;  1CZ4 A;  2DMR A;  3M3G A;  4AAY A;  2R7Z A;  1L8F A;  3X2K A;  3GTK A;  4AOK B;  1TWF A;  3X2H A;  2VPY A;  4AZD A;  1PQF A;  1G8K A;  3GTQ A;  3QQ7 A;  5T5I D;  2EEO B;  3GTM A;  5FTN A;  1H0H A;  1Y1V A;  1Y1W A;  3QQ8 A;  2NAP A;  1TWG A;  3CF2 A;  1UHD A;  1WLF A;  2WAQ A;  4JJO A;  2JA5 A;  2CW0 D;  4AYB A;  3IR7 A;  1SFO A;  1E60 A;  2JIM A;  1VC3 B;  2A69 D;  4L48 A;  4FFT A;  2Y0S A;  1EU1 A;  3X2M A;  2JA6 A;  2JIP A;  2A6E D;  5GLX A;  2A6H D;  5H4U A;  5GLF A;  3D30 A;  2R93 A;  3SUM A;  4KDL A;  1N10 A;  2NYA A;  2O5J D;  2A68 D;  1KQF A;  5DYI A;  4JCW A;  4JP7 A;  3QWZ A;  2BE5 D;  1OGY A;  3O5A A;  4QIW A;  3GTJ A;  5FTK A;  2VPZ A;  1BW3 A;  2NVX A;  1AA6 A;  3H0G A;  4FG4 A;  4JP6 A;  1HD5 A;  5GLY A;  1KQG A;  1E18 A;  3IR6 A;  3CZB A;  5B6C A;  1WC2 A;  2E7Z A;  3SUK A;  4CS0 A;  4DMR A;  1QDN A;  2E2I A;  1YNJ D;  3HKZ A;  2C45 A;  3FKI A;  2V45 A;  3X2P A;  3SUL A;  2VPX A;  1I3Q A;  4ENG A;  1PT0 A;  4FER A;  2JIQ A;  1FDI A;  4AVR A;  2JIO A;  2NVY A;  4KO8 A;  1S3S A; 
#chains in the Genus database with same CATH homology
 3TM7 B;  1QCS A;  1AW8 B;  1YLE A;  2AE0 X;  2G6G A;  2PI8 A;  4CRZ A;  1ZC1 A;  1R9T A;  1R7R A;  2PJH B;  4KOD A;  1TWC A;  2KI8 A;  3ML1 A;  1DMR A;  5DYG A;  4AON B;  2PIC A;  3HU2 A;  2PMZ A;  3IR5 A;  1PYU B;  2VUM A;  1H5N A;  1TWH A;  3GTG A;  1SMY D;  2PNW A;  1PYQ A;  1CZ5 A;  2IV2 X;  1SIW A;  1E61 A;  1E5V A;  3CQZ A;  2JA7 A;  2V3V A;  2G5D A;  2B63 A;  2E2H A;  1IW7 D;  2GAE A;  3QC8 A;  3HU3 A;  3PLX B;  3HU1 A;  5FTJ A;  3DMR A;  5EPP A;  1TWA A;  4CRY G;  5T5M D;  2YU9 A;  1R27 A;  1K83 A;  1PT1 A;  1TMO A;  1Y4Z A;  4D7Z B;  2PJJ A;  2VPW A;  4GA6 A;  1Q16 A;  4C2M A;  2JIR A;  4RV0 A;  1CR5 A;  1PQH A;  3GTO A;  3GTP A;  1UHE A;  4NOH A;  5FTL A;  4KDI A;  1I50 A;  3GTL A;  1PQE A;  5FTM A;  2YUJ A;  1E32 A;  1ZYR D;  5C1B A;  1Y5I A;  1FDO A;  1DMS A;  4KLN A;  3TIW A;  1PPY A;  3OUG A;  4GA5 A;  2R92 A;  5C18 A;  1YNN D;  1G8J A;  1WCM A;  2WB1 A;  1CZ4 A;  2DMR A;  4AAY A;  2R7Z A;  3GTK A;  4AOK B;  1TWF A;  2VPY A;  4AZD A;  1PQF A;  1G8K A;  3GTQ A;  3QQ7 A;  5T5I D;  2EEO B;  3GTM A;  5FTN A;  1H0H A;  1Y1V A;  1Y1W A;  3QQ8 A;  2NAP A;  1TWG A;  3CF2 A;  1UHD A;  1WLF A;  2WAQ A;  2JA5 A;  2CW0 D;  4AYB A;  3IR7 A;  1SFO A;  1E60 A;  2JIM A;  1VC3 B;  2A69 D;  2Y0S A;  1EU1 A;  2JA6 A;  2JIP A;  2A6E D;  2A6H D;  5GLF A;  2R93 A;  4KDL A;  2NYA A;  2O5J D;  2A68 D;  1KQF A;  5DYI A;  3QWZ A;  2BE5 D;  1OGY A;  3O5A A;  4QIW A;  3GTJ A;  5FTK A;  2VPZ A;  2NVX A;  1AA6 A;  3H0G A;  1KQG A;  1E18 A;  3IR6 A;  3CZB A;  5B6C A;  2E7Z A;  4CS0 A;  4DMR A;  1QDN A;  2E2I A;  1YNJ D;  3HKZ A;  2C45 A;  3FKI A;  2V45 A;  2VPX A;  1I3Q A;  1PT0 A;  2JIQ A;  1FDI A;  2JIO A;  2NVY A;  4KO8 A;  1S3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...