4D7ZB

E. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVQGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the E. Coli L-Aspartate-Alpha-Decarboxylase Mutant N72Q to a Resolution of 1.9 Angstroms
rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
total genus 22
structure length 94
sequence length 94
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4d7zB00
1Y4ZA 1EU1A 3CQZA 3GTQA 3HKZA 3GTLA 1AA6A 4AAYA 2V45A 4AONB 2Y0SA 4CRYG 2JIOA 2IV2X 2DMRA 2EEOB 1TWCA 2NVXA 3QQ8A 1UHDA 1E5VA 1I50A 1PYQA 2E7ZA 2JIMA 2NAPA 4KLNA 2KI8A 2WB1A 2NVYA 2E2IA 1FDIA 1PQFA 3HU2A 1H0HA 1OGYA 3TIWA 1SFOA 5FTMA 4AOKB 3HU3A 3IR7A 2WAQA 5T5ID 1TWAA 3PLXB 2VPZA 2R92A 1G8JA 5FTJA 2E2HA 3IR5A 1KQGA 1PT0A 4C2MA 3QQ7A 1WCMA 4GA6A 3FKIA 1PPYA 2B63A 1E32A 1CR5A 1IW7D 1Y1WA 1I3QA 5FTNA 1E61A 1KQFA 4KODA 3GTPA 4AYBA 3QC8A 1TMOA 1S3SA 2R7ZA 5DYGA 1PT1A 1TWFA 3GTJA 3GTMA 1PQHA 5B6CA 3H0GA 2VUMA 2JA6A 1VC3B 1CZ5A 1Y1VA 1PQEA 3CF2A 2JA7A 1FDOA 2JIRA 4KDIA 3QWZA 5C18A 2PJHB 1AW8B 5C1BA 1DMSA 1DMRA 1E60A 5DYIA 4KDLA 1TWHA 3GTOA 2JA5A 5EPPA 5GLFA 2NYAA 1R7RA 2YU9A 3OUGA 1Y5IA 2R93A 1QCSA 5FTLA 1YLEA 2V3VA 3ML1A 4GA5A 4CRZA 4D7ZB 1H5NA 1WLFA 1QDNA 1R27A 2C45A 1R9TA 2JIPA 5T5MD 3HU1A 3GTGA 1SIWA 4KO8A 1UHEA 2VPYA 5FTKA 3IR6A 1Q16A 4AZDA 1CZ4A 1G8KA 1PYUB 3GTKA 4RV0A 4QIWA 2JIQA 2VPXA 3DMRA 1K83A 2PMZA 1E18A 2VPWA 3O5AA 4DMRA 3TM7B 1TWGA 4CS0A
chains in the Genus database with same CATH superfamily
1Y4ZA 3SUMA 1EU1A 3X2KA 3X2HA 1N10A 3CQZA 4JP7A 3GTQA 3HKZA 3GTLA 1AA6A 2BH0A 1L8FA 4AAYA 1ZYRD 2V45A 4AONB 2Y0SA 4CRYG 2G5DA 2JIOA 2IV2X 2DMRA 3X2LA 2A68D 4FG4A 1SMYD 2EEOB 1TWCA 2NVXA 3QQ8A 1UHDA 1E5VA 2YUJA 1I50A 4JCWA 1PYQA 3X2IA 2E7ZA 4NOHA 2BE5D 2JIMA 2NAPA 4KLNA 2KI8A 2WB1A 2AE0X 1OA9A 2NVYA 2E2IA 1FDIA 1PQFA 3HU2A 2A69D 4L48A 1H0HA 1BW3A 1OGYA 2PICA 3TIWA 1BW4A 2PJJA 1SFOA 5FTMA 4AOKB 3HU3A 3IR7A 2WAQA 5T5ID 1TWAA 3PLXB 2VPZA 2R92A 1G8JA 2HCZX 5FTJA 2E2HA 4ENGA 3IR5A 1KQGA 1PT0A 4C2MA 3QQ7A 1WCMA 4GA6A 4FERA 3FKIA 1PPYA 2B63A 1E32A 1CR5A 1IW7D 1WC2A 1Y1WA 1I3QA 5FTNA 1E61A 3CZBA 1KQFA 4JP6A 4KODA 3GTPA 4AYBA 3QC8A 3SUJA 1TMOA 4FFTA 1S3SA 2R7ZA 5DYGA 1YNND 1PT1A 1TWFA 3GTJA 2ENGA 3GTMA 2KQAA 1PQHA 3X2GA 4JJOA 5B6CA 2PI8A 3H0GA 2VUMA 2JA6A 1VC3B 1CZ5A 1Y1VA 1PQEA 3CF2A 2JA7A 1FDOA 2JIRA 4KDIA 3QWZA 5C18A 2PJHB 1AW8B 2A6ED 4ZM7A 5C1BA 1DMSA 5GM9A 2GAEA 1DMRA 1E60A 1YNJD 3X2JA 5DYIA 5GLYA 4KDLA 1TWHA 1OA7A 3X2PA 3GTOA 2JA5A 5EPPA 5GLFA 2NYAA 1HD5A 3X2MA 1R7RA 2YU9A 3X2OA 3OUGA 3X2NA 1Y5IA 2R93A 1QCSA 3SUKA 5FTLA 1YLEA 2V3VA 3ML1A 4GA5A 4CRZA 4D7ZB 1H5NA 1WLFA 1QDNA 1R27A 2C45A 3M3GA 1R9TA 2JIPA 2CW0D 4JS7A 5T5MD 3HU1A 5H4UA 1SIWA 3GTGA 4KO8A 5GLXA 1UHEA 2VPYA 5FTKA 1ZC1A 1Q16A 3IR6A 2A6HD 4AZDA 1CZ4A 1G8KA 1PYUB 4AVRA 3GTKA 4FG2A 4RV0A 4QIWA 2JIQA 2O5JD 2PNWA 2VPXA 3DMRA 1K83A 3TM7B 3D30A 2G6GA 2PMZA 3ENGA 1E18A 2VPWA 3O5AA 4DMRA 3SULA 1TWGA 4CS0A
chains in the Genus database with same CATH topology
1Y4ZA 1EU1A 3CQZA 3GTQA 3HKZA 3GTLA 1AA6A 4AAYA 1ZYRD 2V45A 4AONB 2Y0SA 4CRYG 2G5DA 2JIOA 2IV2X 2DMRA 2A68D 1SMYD 2EEOB 1TWCA 2NVXA 3QQ8A 1UHDA 1E5VA 2YUJA 1I50A 1PYQA 2E7ZA 4NOHA 2BE5D 2JIMA 2NAPA 4KLNA 2KI8A 2WB1A 2AE0X 2NVYA 2E2IA 1FDIA 1PQFA 3HU2A 2A69D 1H0HA 1OGYA 2PICA 3TIWA 2PJJA 1SFOA 5FTMA 4AOKB 3HU3A 3IR7A 2WAQA 5T5ID 1TWAA 3PLXB 2VPZA 2R92A 1G8JA 5FTJA 2E2HA 3IR5A 1KQGA 1PT0A 4C2MA 3QQ7A 1WCMA 4GA6A 3FKIA 1PPYA 2B63A 1E32A 1CR5A 1IW7D 1Y1WA 1I3QA 5FTNA 1E61A 3CZBA 1KQFA 4KODA 3GTPA 4AYBA 3QC8A 1TMOA 1S3SA 2R7ZA 5DYGA 1YNND 1PT1A 1TWFA 3GTJA 3GTMA 1PQHA 5B6CA 2PI8A 3H0GA 2VUMA 2JA6A 1VC3B 1CZ5A 1Y1VA 1PQEA 3CF2A 2JA7A 1FDOA 2JIRA 4KDIA 3QWZA 5C18A 2PJHB 1AW8B 2A6ED 5C1BA 1DMSA 2GAEA 1DMRA 1E60A 1YNJD 5DYIA 4KDLA 1TWHA 3GTOA 2JA5A 5EPPA 5GLFA 2NYAA 1R7RA 2YU9A 3OUGA 1Y5IA 2R93A 1QCSA 5FTLA 1YLEA 2V3VA 3ML1A 4GA5A 4CRZA 4D7ZB 1H5NA 1WLFA 1QDNA 1R27A 2C45A 1R9TA 2JIPA 2CW0D 5T5MD 3HU1A 3GTGA 1SIWA 4KO8A 1UHEA 2VPYA 5FTKA 1ZC1A 1Q16A 3IR6A 2A6HD 4AZDA 1CZ4A 1G8KA 1PYUB 3GTKA 4RV0A 4QIWA 2JIQA 2O5JD 2PNWA 2VPXA 3DMRA 1K83A 2G6GA 2PMZA 1E18A 2VPWA 3O5AA 4DMRA 3TM7B 1TWGA 4CS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4Z A;  1EU1 A;  3CQZ A;  3GTQ A;  3HKZ A;  3GTL A;  1AA6 A;  4AAY A;  2V45 A;  4AON B;  2Y0S A;  4CRY G;  2JIO A;  2IV2 X;  2DMR A;  2EEO B;  1TWC A;  2NVX A;  3QQ8 A;  1UHD A;  1E5V A;  1I50 A;  1PYQ A;  2E7Z A;  2JIM A;  2NAP A;  4KLN A;  2KI8 A;  2WB1 A;  2NVY A;  2E2I A;  1FDI A;  1PQF A;  3HU2 A;  1H0H A;  1OGY A;  3TIW A;  1SFO A;  5FTM A;  4AOK B;  3HU3 A;  3IR7 A;  2WAQ A;  5T5I D;  1TWA A;  3PLX B;  2VPZ A;  2R92 A;  1G8J A;  5FTJ A;  2E2H A;  3IR5 A;  1KQG A;  1PT0 A;  4C2M A;  3QQ7 A;  1WCM A;  4GA6 A;  3FKI A;  1PPY A;  2B63 A;  1E32 A;  1CR5 A;  1IW7 D;  1Y1W A;  1I3Q A;  5FTN A;  1E61 A;  1KQF A;  4KOD A;  3GTP A;  4AYB A;  3QC8 A;  1TMO A;  1S3S A;  2R7Z A;  5DYG A;  1PT1 A;  1TWF A;  3GTJ A;  3GTM A;  1PQH A;  5B6C A;  3H0G A;  2VUM A;  2JA6 A;  1VC3 B;  1CZ5 A;  1Y1V A;  1PQE A;  3CF2 A;  2JA7 A;  1FDO A;  2JIR A;  4KDI A;  3QWZ A;  5C18 A;  2PJH B;  1AW8 B;  5C1B A;  1DMS A;  1DMR A;  1E60 A;  5DYI A;  4KDL A;  1TWH A;  3GTO A;  2JA5 A;  5EPP A;  5GLF A;  2NYA A;  1R7R A;  2YU9 A;  3OUG A;  1Y5I A;  2R93 A;  1QCS A;  5FTL A;  1YLE A;  2V3V A;  3ML1 A;  4GA5 A;  4CRZ A;  4D7Z B;  1H5N A;  1WLF A;  1QDN A;  1R27 A;  2C45 A;  1R9T A;  2JIP A;  5T5M D;  3HU1 A;  3GTG A;  1SIW A;  4KO8 A;  1UHE A;  2VPY A;  5FTK A;  3IR6 A;  1Q16 A;  4AZD A;  1CZ4 A;  1G8K A;  1PYU B;  3GTK A;  4RV0 A;  4QIW A;  2JIQ A;  2VPX A;  3DMR A;  1K83 A;  2PMZ A;  1E18 A;  2VPW A;  3O5A A;  4DMR A;  3TM7 B;  1TWG A;  4CS0 A; 
#chains in the Genus database with same CATH topology
 1Y4Z A;  3SUM A;  1EU1 A;  3X2K A;  3X2H A;  1N10 A;  3CQZ A;  4JP7 A;  3GTQ A;  3HKZ A;  3GTL A;  1AA6 A;  2BH0 A;  1L8F A;  4AAY A;  1ZYR D;  2V45 A;  4AON B;  2Y0S A;  4CRY G;  2G5D A;  2JIO A;  2IV2 X;  2DMR A;  3X2L A;  2A68 D;  4FG4 A;  1SMY D;  2EEO B;  1TWC A;  2NVX A;  3QQ8 A;  1UHD A;  1E5V A;  2YUJ A;  1I50 A;  4JCW A;  1PYQ A;  3X2I A;  2E7Z A;  4NOH A;  2BE5 D;  2JIM A;  2NAP A;  4KLN A;  2KI8 A;  2WB1 A;  2AE0 X;  1OA9 A;  2NVY A;  2E2I A;  1FDI A;  1PQF A;  3HU2 A;  2A69 D;  4L48 A;  1H0H A;  1BW3 A;  1OGY A;  2PIC A;  3TIW A;  1BW4 A;  2PJJ A;  1SFO A;  5FTM A;  4AOK B;  3HU3 A;  3IR7 A;  2WAQ A;  5T5I D;  1TWA A;  3PLX B;  2VPZ A;  2R92 A;  1G8J A;  2HCZ X;  5FTJ A;  2E2H A;  4ENG A;  3IR5 A;  1KQG A;  1PT0 A;  4C2M A;  3QQ7 A;  1WCM A;  4GA6 A;  4FER A;  3FKI A;  1PPY A;  2B63 A;  1E32 A;  1CR5 A;  1IW7 D;  1WC2 A;  1Y1W A;  1I3Q A;  5FTN A;  1E61 A;  3CZB A;  1KQF A;  4JP6 A;  4KOD A;  3GTP A;  4AYB A;  3QC8 A;  3SUJ A;  1TMO A;  4FFT A;  1S3S A;  2R7Z A;  5DYG A;  1YNN D;  1PT1 A;  1TWF A;  3GTJ A;  2ENG A;  3GTM A;  2KQA A;  1PQH A;  3X2G A;  4JJO A;  5B6C A;  2PI8 A;  3H0G A;  2VUM A;  2JA6 A;  1VC3 B;  1CZ5 A;  1Y1V A;  1PQE A;  3CF2 A;  2JA7 A;  1FDO A;  2JIR A;  4KDI A;  3QWZ A;  5C18 A;  2PJH B;  1AW8 B;  2A6E D;  4ZM7 A;  5C1B A;  1DMS A;  5GM9 A;  2GAE A;  1DMR A;  1E60 A;  1YNJ D;  3X2J A;  5DYI A;  5GLY A;  4KDL A;  1TWH A;  1OA7 A;  3X2P A;  3GTO A;  2JA5 A;  5EPP A;  5GLF A;  2NYA A;  1HD5 A;  3X2M A;  1R7R A;  2YU9 A;  3X2O A;  3OUG A;  3X2N A;  1Y5I A;  2R93 A;  1QCS A;  3SUK A;  5FTL A;  1YLE A;  2V3V A;  3ML1 A;  4GA5 A;  4CRZ A;  4D7Z B;  1H5N A;  1WLF A;  1QDN A;  1R27 A;  2C45 A;  3M3G A;  1R9T A;  2JIP A;  2CW0 D;  4JS7 A;  5T5M D;  3HU1 A;  5H4U A;  1SIW A;  3GTG A;  4KO8 A;  5GLX A;  1UHE A;  2VPY A;  5FTK A;  1ZC1 A;  1Q16 A;  3IR6 A;  2A6H D;  4AZD A;  1CZ4 A;  1G8K A;  1PYU B;  4AVR A;  3GTK A;  4FG2 A;  4RV0 A;  4QIW A;  2JIQ A;  2O5J D;  2PNW A;  2VPX A;  3DMR A;  1K83 A;  3TM7 B;  3D30 A;  2G6G A;  2PMZ A;  3ENG A;  1E18 A;  2VPW A;  3O5A A;  4DMR A;  3SUL A;  1TWG A;  4CS0 A; 
#chains in the Genus database with same CATH homology
 1Y4Z A;  1EU1 A;  3CQZ A;  3GTQ A;  3HKZ A;  3GTL A;  1AA6 A;  4AAY A;  1ZYR D;  2V45 A;  4AON B;  2Y0S A;  4CRY G;  2G5D A;  2JIO A;  2IV2 X;  2DMR A;  2A68 D;  1SMY D;  2EEO B;  1TWC A;  2NVX A;  3QQ8 A;  1UHD A;  1E5V A;  2YUJ A;  1I50 A;  1PYQ A;  2E7Z A;  4NOH A;  2BE5 D;  2JIM A;  2NAP A;  4KLN A;  2KI8 A;  2WB1 A;  2AE0 X;  2NVY A;  2E2I A;  1FDI A;  1PQF A;  3HU2 A;  2A69 D;  1H0H A;  1OGY A;  2PIC A;  3TIW A;  2PJJ A;  1SFO A;  5FTM A;  4AOK B;  3HU3 A;  3IR7 A;  2WAQ A;  5T5I D;  1TWA A;  3PLX B;  2VPZ A;  2R92 A;  1G8J A;  5FTJ A;  2E2H A;  3IR5 A;  1KQG A;  1PT0 A;  4C2M A;  3QQ7 A;  1WCM A;  4GA6 A;  3FKI A;  1PPY A;  2B63 A;  1E32 A;  1CR5 A;  1IW7 D;  1Y1W A;  1I3Q A;  5FTN A;  1E61 A;  3CZB A;  1KQF A;  4KOD A;  3GTP A;  4AYB A;  3QC8 A;  1TMO A;  1S3S A;  2R7Z A;  5DYG A;  1YNN D;  1PT1 A;  1TWF A;  3GTJ A;  3GTM A;  1PQH A;  5B6C A;  2PI8 A;  3H0G A;  2VUM A;  2JA6 A;  1VC3 B;  1CZ5 A;  1Y1V A;  1PQE A;  3CF2 A;  2JA7 A;  1FDO A;  2JIR A;  4KDI A;  3QWZ A;  5C18 A;  2PJH B;  1AW8 B;  2A6E D;  5C1B A;  1DMS A;  2GAE A;  1DMR A;  1E60 A;  1YNJ D;  5DYI A;  4KDL A;  1TWH A;  3GTO A;  2JA5 A;  5EPP A;  5GLF A;  2NYA A;  1R7R A;  2YU9 A;  3OUG A;  1Y5I A;  2R93 A;  1QCS A;  5FTL A;  1YLE A;  2V3V A;  3ML1 A;  4GA5 A;  4CRZ A;  4D7Z B;  1H5N A;  1WLF A;  1QDN A;  1R27 A;  2C45 A;  1R9T A;  2JIP A;  2CW0 D;  5T5M D;  3HU1 A;  3GTG A;  1SIW A;  4KO8 A;  1UHE A;  2VPY A;  5FTK A;  1ZC1 A;  1Q16 A;  3IR6 A;  2A6H D;  4AZD A;  1CZ4 A;  1G8K A;  1PYU B;  3GTK A;  4RV0 A;  4QIW A;  2JIQ A;  2O5J D;  2PNW A;  2VPX A;  3DMR A;  1K83 A;  2G6G A;  2PMZ A;  1E18 A;  2VPW A;  3O5A A;  4DMR A;  3TM7 B;  1TWG A;  4CS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...