4AVRA

Crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
MDTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRINDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA4485
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pa01
molecule tags Unknown function
total genus 34
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4avrA00
3SUKA 3D30A 4JS7A 4JP6A 2KQAA 3X2OA 3SUMA 4JJOA 1L8FA 4FG4A 2PJJA 1HD5A 1WC2A 2G5DA 5GLXA 3X2LA 2BH0A 2ENGA 1OA7A 5H4UA 4ZM7A 4FG2A 4JCWA 1BW4A 4ENGA 2G6GA 4JP7A 3X2MA 1N10A 3M3GA 3X2GA 2AE0X 2HCZX 3ENGA 4L48A 5GLYA 4AVRA 3CZBA 4FERA 2PNWA 2GAEA 2PI8A 1OA9A 3X2JA 2PICA 4FFTA 5GM9A 3SUJA 3X2NA 3SULA 3X2PA 3X2IA 3X2KA 1BW3A 3X2HA
chains in the Genus database with same CATH superfamily
1K83A 5GLFA 2WAQA 4KLNA 5DYGA 3SUMA 1E60A 2JIRA 2V3VA 5B6CA 1L8FA 5FTNA 4AOKB 2PJJA 1HD5A 1ZYRD 5T5MD 1SFOA 2BE5D 5T5ID 2ENGA 3HU2A 4RV0A 5H4UA 4ZM7A 5EPPA 4KDLA 4KO8A 1CZ5A 5DYIA 4KODA 4ENGA 1AA6A 2WB1A 5FTLA 2VPXA 3HU1A 1FDOA 1Q16A 2JA7A 3M3GA 2NVXA 1PQHA 1CZ4A 4DMRA 3CZBA 5FTMA 3QQ8A 3X2JA 1PQEA 3GTLA 1YNND 3X2NA 1Y1WA 3SULA 2C45A 2JIPA 3X2HA 3GTQA 1SIWA 1H0HA 3D30A 3O5AA 1PQFA 3H0GA 2VUMA 1DMSA 1YNJD 3HU3A 2VPZA 1WC2A 1PT1A 1UHEA 2PJHB 4AZDA 3GTPA 1E32A 1OA7A 2YUJA 2JIOA 1TWFA 1S3SA 2VPWA 1IW7D 4JCWA 1BW4A 2G6GA 3DMRA 1AW8B 2KI8A 3OUGA 3X2GA 1CR5A 4L48A 4NOHA 5GLYA 2E2IA 4AVRA 4CS0A 1TWGA 1R7RA 2GAEA 2VPYA 1TWCA 1OA9A 2IV2X 2PICA 4FFTA 3IR5A 1VC3B 1PYUB 3X2PA 1PYQA 2Y0SA 3X2KA 1BW3A 1E61A 3SUKA 1I50A 2JIMA 1Y1VA 3GTGA 1OGYA 2KQAA 3X2OA 1WLFA 4AONB 4AYBA 3ML1A 4JJOA 3HKZA 4FG4A 4GA5A 3PLXB 2EEOB 1EU1A 1QDNA 1PT0A 2JIQA 2A6ED 2B63A 4JP7A 5FTKA 2NAPA 3X2MA 1R27A 1N10A 1YLEA 4CRZA 1TWAA 1ZC1A 1DMRA 1E18A 3IR6A 3ENGA 2NVYA 1KQFA 1PPYA 2A6HD 1SMYD 2R7ZA 3CF2A 1E5VA 3SUJA 5GM9A 2DMRA 5C1BA 1QCSA 2CW0D 2V45A 4D7ZB 4QIWA 3GTJA 4JS7A 3TM7B 1Y5IA 4JP6A 1TWHA 2A68D 1G8KA 2PMZA 1I3QA 1R9TA 2G5DA 5GLXA 3X2LA 3FKIA 2BH0A 3QWZA 4GA6A 4KDIA 3GTOA 1WCMA 2JA5A 2YU9A 3IR7A 4FG2A 2E7ZA 1FDIA 5FTJA 4CRYG 2A69D 3QC8A 2E2HA 1G8JA 2AE0X 2HCZX 3CQZA 2R92A 4FERA 1H5NA 2PNWA 5C18A 2JA6A 2PI8A 3GTKA 1UHDA 2NYAA 1KQGA 3GTMA 4C2MA 4AAYA 3TIWA 3X2IA 1Y4ZA 2R93A 2O5JD 1TMOA 3QQ7A
chains in the Genus database with same CATH topology
3SUKA 3D30A 4JS7A 4JP6A 2KQAA 3X2OA 3SUMA 4JJOA 1L8FA 4FG4A 2PJJA 1HD5A 1WC2A 2G5DA 5GLXA 3X2LA 2BH0A 2ENGA 1OA7A 5H4UA 4ZM7A 4FG2A 4JCWA 1BW4A 4ENGA 2G6GA 4JP7A 3X2MA 1N10A 3M3GA 3X2GA 2AE0X 2HCZX 3ENGA 4L48A 5GLYA 4AVRA 3CZBA 4FERA 2PNWA 2GAEA 2PI8A 1OA9A 3X2JA 2PICA 4FFTA 5GM9A 3SUJA 3X2NA 3SULA 3X2PA 3X2IA 3X2KA 1BW3A 3X2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUK A;  3D30 A;  4JS7 A;  4JP6 A;  2KQA A;  3X2O A;  3SUM A;  4JJO A;  1L8F A;  4FG4 A;  2PJJ A;  1HD5 A;  1WC2 A;  2G5D A;  5GLX A;  3X2L A;  2BH0 A;  2ENG A;  1OA7 A;  5H4U A;  4ZM7 A;  4FG2 A;  4JCW A;  1BW4 A;  4ENG A;  2G6G A;  4JP7 A;  3X2M A;  1N10 A;  3M3G A;  3X2G A;  2AE0 X;  2HCZ X;  3ENG A;  4L48 A;  5GLY A;  4AVR A;  3CZB A;  4FER A;  2PNW A;  2GAE A;  2PI8 A;  1OA9 A;  3X2J A;  2PIC A;  4FFT A;  5GM9 A;  3SUJ A;  3X2N A;  3SUL A;  3X2P A;  3X2I A;  3X2K A;  1BW3 A;  3X2H A; 
#chains in the Genus database with same CATH topology
 1K83 A;  5GLF A;  2WAQ A;  4KLN A;  5DYG A;  3SUM A;  1E60 A;  2JIR A;  2V3V A;  5B6C A;  1L8F A;  5FTN A;  4AOK B;  2PJJ A;  1HD5 A;  1ZYR D;  5T5M D;  1SFO A;  2BE5 D;  5T5I D;  2ENG A;  3HU2 A;  4RV0 A;  5H4U A;  4ZM7 A;  5EPP A;  4KDL A;  4KO8 A;  1CZ5 A;  5DYI A;  4KOD A;  4ENG A;  1AA6 A;  2WB1 A;  5FTL A;  2VPX A;  3HU1 A;  1FDO A;  1Q16 A;  2JA7 A;  3M3G A;  2NVX A;  1PQH A;  1CZ4 A;  4DMR A;  3CZB A;  5FTM A;  3QQ8 A;  3X2J A;  1PQE A;  3GTL A;  1YNN D;  3X2N A;  1Y1W A;  3SUL A;  2C45 A;  2JIP A;  3X2H A;  3GTQ A;  1SIW A;  1H0H A;  3D30 A;  3O5A A;  1PQF A;  3H0G A;  2VUM A;  1DMS A;  1YNJ D;  3HU3 A;  2VPZ A;  1WC2 A;  1PT1 A;  1UHE A;  2PJH B;  4AZD A;  3GTP A;  1E32 A;  1OA7 A;  2YUJ A;  2JIO A;  1TWF A;  1S3S A;  2VPW A;  1IW7 D;  4JCW A;  1BW4 A;  2G6G A;  3DMR A;  1AW8 B;  2KI8 A;  3OUG A;  3X2G A;  1CR5 A;  4L48 A;  4NOH A;  5GLY A;  2E2I A;  4AVR A;  4CS0 A;  1TWG A;  1R7R A;  2GAE A;  2VPY A;  1TWC A;  1OA9 A;  2IV2 X;  2PIC A;  4FFT A;  3IR5 A;  1VC3 B;  1PYU B;  3X2P A;  1PYQ A;  2Y0S A;  3X2K A;  1BW3 A;  1E61 A;  3SUK A;  1I50 A;  2JIM A;  1Y1V A;  3GTG A;  1OGY A;  2KQA A;  3X2O A;  1WLF A;  4AON B;  4AYB A;  3ML1 A;  4JJO A;  3HKZ A;  4FG4 A;  4GA5 A;  3PLX B;  2EEO B;  1EU1 A;  1QDN A;  1PT0 A;  2JIQ A;  2A6E D;  2B63 A;  4JP7 A;  5FTK A;  2NAP A;  3X2M A;  1R27 A;  1N10 A;  1YLE A;  4CRZ A;  1TWA A;  1ZC1 A;  1DMR A;  1E18 A;  3IR6 A;  3ENG A;  2NVY A;  1KQF A;  1PPY A;  2A6H D;  1SMY D;  2R7Z A;  3CF2 A;  1E5V A;  3SUJ A;  5GM9 A;  2DMR A;  5C1B A;  1QCS A;  2CW0 D;  2V45 A;  4D7Z B;  4QIW A;  3GTJ A;  4JS7 A;  3TM7 B;  1Y5I A;  4JP6 A;  1TWH A;  2A68 D;  1G8K A;  2PMZ A;  1I3Q A;  1R9T A;  2G5D A;  5GLX A;  3X2L A;  3FKI A;  2BH0 A;  3QWZ A;  4GA6 A;  4KDI A;  3GTO A;  1WCM A;  2JA5 A;  2YU9 A;  3IR7 A;  4FG2 A;  2E7Z A;  1FDI A;  5FTJ A;  4CRY G;  2A69 D;  3QC8 A;  2E2H A;  1G8J A;  2AE0 X;  2HCZ X;  3CQZ A;  2R92 A;  4FER A;  1H5N A;  2PNW A;  5C18 A;  2JA6 A;  2PI8 A;  3GTK A;  1UHD A;  2NYA A;  1KQG A;  3GTM A;  4C2M A;  4AAY A;  3TIW A;  3X2I A;  1Y4Z A;  2R93 A;  2O5J D;  1TMO A;  3QQ7 A; 
#chains in the Genus database with same CATH homology
 3SUK A;  3D30 A;  4JS7 A;  4JP6 A;  2KQA A;  3X2O A;  3SUM A;  4JJO A;  1L8F A;  4FG4 A;  2PJJ A;  1HD5 A;  1WC2 A;  2G5D A;  5GLX A;  3X2L A;  2BH0 A;  2ENG A;  1OA7 A;  5H4U A;  4ZM7 A;  4FG2 A;  4JCW A;  1BW4 A;  4ENG A;  2G6G A;  4JP7 A;  3X2M A;  1N10 A;  3M3G A;  3X2G A;  2AE0 X;  2HCZ X;  3ENG A;  4L48 A;  5GLY A;  4AVR A;  3CZB A;  4FER A;  2PNW A;  2GAE A;  2PI8 A;  1OA9 A;  3X2J A;  2PIC A;  4FFT A;  5GM9 A;  3SUJ A;  3X2N A;  3SUL A;  3X2P A;  3X2I A;  3X2K A;  1BW3 A;  3X2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...