4AVRA

Crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
b'MDTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRINDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA4485
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pa01
molecule tags Unknown function
total genus 34
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4avrA00
2ENGA 2PJJA 5GM9A 3X2PA 3X2GA 3X2JA 4FERA 3X2MA 3CZBA 3SUJA 4FG2A 3SUKA 3X2OA 1N10A 3SULA 4JS7A 3X2NA 2HCZX 2G6GA 2KQAA 2PNWA 4AVRA 5H4UA 4JP6A 4JJOA 4FFTA 5GLYA 3SUMA 1BW4A 4ZM7A 3X2HA 1HD5A 1WC2A 3M3GA 3X2KA 2BH0A 2GAEA 4FG4A 3X2IA 2PI8A 4L48A 2G5DA 3ENGA 4JP7A 2PICA 3D30A 4JCWA 2AE0X 4ENGA 3X2LA 1L8FA 5GLXA 1OA7A 1BW3A 1OA9A
chains in the Genus database with same CATH superfamily
2ENGA 5GM9A 2JA7A 1KQFA 1EU1A 2VPZA 1I3QA 4FERA 3X2MA 3CZBA 3SUJA 2VPWA 1H0HA 5GLFA 3TM7B 3X2OA 1N10A 3SULA 2WAQA 4JS7A 1TWGA 5FTKA 2PNWA 2A6HD 4KO8A 4AAYA 3GTLA 1FDIA 2NYAA 2NVXA 5T5MD 3ENGA 2O5JD 1K83A 2PICA 3TIWA 4CRZA 2IV2X 2YU9A 3GTOA 5GLXA 1PYUB 1Y1WA 1OA9A 2PJJA 1TWHA 1DMSA 3X2PA 5C1BA 3X2GA 2NVYA 1UHEA 3QWZA 1VC3B 1YNJD 3IR5A 4AOKB 3X2JA 1PPYA 1ZC1A 2VUMA 1R7RA 5FTJA 1YNND 4RV0A 2R7ZA 4AONB 4FG2A 2HCZX 3OUGA 3QQ8A 3HU1A 5H4UA 4KDLA 1G8KA 5EPPA 1BW4A 4ZM7A 1Y1VA 1WC2A 1Y4ZA 1OGYA 2JIMA 4GA5A 4KDIA 4D7ZB 1E18A 2BH0A 3X2KA 5FTLA 1E32A 1KQGA 1ZYRD 2JIOA 1Y5IA 3CF2A 3O5AA 2YUJA 4C2MA 1CZ4A 3H0GA 2E2IA 4JCWA 1TWFA 4AZDA 5FTMA 2VPXA 1L8FA 1FDOA 1OA7A 2JIRA 5DYGA 4ENGA 5C18A 2JA6A 1SIWA 1QDNA 5DYIA 1AA6A 1E5VA 2WB1A 1QCSA 5B6CA 1WLFA 1IW7D 1S3SA 2JIQA 2KI8A 2NAPA 1WCMA 2KQAA 4AVRA 1TMOA 1H5NA 5FTNA 5T5ID 1E60A 4JJOA 1PQFA 3IR6A 1R9TA 3HKZA 5GLYA 2R93A 1PQHA 1TWCA 3M3GA 1YLEA 2GAEA 2A69D 4FG4A 2JA5A 2PMZA 3QQ7A 4QIWA 4NOHA 1G8JA 3CQZA 4JP7A 3HU2A 1DMRA 4KLNA 1I50A 3GTPA 3IR7A 4CS0A 1CR5A 2CW0D 2AE0X 1SFOA 3HU3A 2JIPA 2V3VA 3ML1A 4CRYG 3X2IA 2DMRA 1PYQA 2C45A 2R92A 4DMRA 3GTGA 3GTQA 3PLXB 2A68D 4KODA 3SUKA 1Q16A 1PT0A 1TWAA 3X2NA 2G6GA 4JP6A 2B63A 1CZ5A 1SMYD 4FFTA 2A6ED 2PJHB 3SUMA 1E61A 2E7ZA 3X2HA 1HD5A 3GTMA 2EEOB 2E2HA 2BE5D 2Y0SA 1AW8B 1R27A 2PI8A 2V45A 4L48A 2G5DA 3FKIA 3GTJA 3DMRA 1PQEA 4AYBA 1UHDA 3D30A 2VPYA 3QC8A 3X2LA 3GTKA 4GA6A 1BW3A 1PT1A
chains in the Genus database with same CATH topology
2ENGA 2PJJA 5GM9A 3X2PA 3X2GA 3X2JA 4FERA 3X2MA 3CZBA 3SUJA 4FG2A 3SUKA 3X2OA 1N10A 3SULA 4JS7A 3X2NA 2HCZX 2G6GA 2KQAA 2PNWA 4AVRA 5H4UA 4JP6A 4JJOA 4FFTA 5GLYA 3SUMA 1BW4A 4ZM7A 3X2HA 1HD5A 1WC2A 3M3GA 3X2KA 2BH0A 2GAEA 4FG4A 3X2IA 2PI8A 4L48A 2G5DA 3ENGA 4JP7A 2PICA 3D30A 4JCWA 2AE0X 4ENGA 3X2LA 1L8FA 5GLXA 1OA7A 1BW3A 1OA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENG A;  2PJJ A;  5GM9 A;  3X2P A;  3X2G A;  3X2J A;  4FER A;  3X2M A;  3CZB A;  3SUJ A;  4FG2 A;  3SUK A;  3X2O A;  1N10 A;  3SUL A;  4JS7 A;  3X2N A;  2HCZ X;  2G6G A;  2KQA A;  2PNW A;  4AVR A;  5H4U A;  4JP6 A;  4JJO A;  4FFT A;  5GLY A;  3SUM A;  1BW4 A;  4ZM7 A;  3X2H A;  1HD5 A;  1WC2 A;  3M3G A;  3X2K A;  2BH0 A;  2GAE A;  4FG4 A;  3X2I A;  2PI8 A;  4L48 A;  2G5D A;  3ENG A;  4JP7 A;  2PIC A;  3D30 A;  4JCW A;  2AE0 X;  4ENG A;  3X2L A;  1L8F A;  5GLX A;  1OA7 A;  1BW3 A;  1OA9 A; 
#chains in the Genus database with same CATH topology
 2ENG A;  5GM9 A;  2JA7 A;  1KQF A;  1EU1 A;  2VPZ A;  1I3Q A;  4FER A;  3X2M A;  3CZB A;  3SUJ A;  2VPW A;  1H0H A;  5GLF A;  3TM7 B;  3X2O A;  1N10 A;  3SUL A;  2WAQ A;  4JS7 A;  1TWG A;  5FTK A;  2PNW A;  2A6H D;  4KO8 A;  4AAY A;  3GTL A;  1FDI A;  2NYA A;  2NVX A;  5T5M D;  3ENG A;  2O5J D;  1K83 A;  2PIC A;  3TIW A;  4CRZ A;  2IV2 X;  2YU9 A;  3GTO A;  5GLX A;  1PYU B;  1Y1W A;  1OA9 A;  2PJJ A;  1TWH A;  1DMS A;  3X2P A;  5C1B A;  3X2G A;  2NVY A;  1UHE A;  3QWZ A;  1VC3 B;  1YNJ D;  3IR5 A;  4AOK B;  3X2J A;  1PPY A;  1ZC1 A;  2VUM A;  1R7R A;  5FTJ A;  1YNN D;  4RV0 A;  2R7Z A;  4AON B;  4FG2 A;  2HCZ X;  3OUG A;  3QQ8 A;  3HU1 A;  5H4U A;  4KDL A;  1G8K A;  5EPP A;  1BW4 A;  4ZM7 A;  1Y1V A;  1WC2 A;  1Y4Z A;  1OGY A;  2JIM A;  4GA5 A;  4KDI A;  4D7Z B;  1E18 A;  2BH0 A;  3X2K A;  5FTL A;  1E32 A;  1KQG A;  1ZYR D;  2JIO A;  1Y5I A;  3CF2 A;  3O5A A;  2YUJ A;  4C2M A;  1CZ4 A;  3H0G A;  2E2I A;  4JCW A;  1TWF A;  4AZD A;  5FTM A;  2VPX A;  1L8F A;  1FDO A;  1OA7 A;  2JIR A;  5DYG A;  4ENG A;  5C18 A;  2JA6 A;  1SIW A;  1QDN A;  5DYI A;  1AA6 A;  1E5V A;  2WB1 A;  1QCS A;  5B6C A;  1WLF A;  1IW7 D;  1S3S A;  2JIQ A;  2KI8 A;  2NAP A;  1WCM A;  2KQA A;  4AVR A;  1TMO A;  1H5N A;  5FTN A;  5T5I D;  1E60 A;  4JJO A;  1PQF A;  3IR6 A;  1R9T A;  3HKZ A;  5GLY A;  2R93 A;  1PQH A;  1TWC A;  3M3G A;  1YLE A;  2GAE A;  2A69 D;  4FG4 A;  2JA5 A;  2PMZ A;  3QQ7 A;  4QIW A;  4NOH A;  1G8J A;  3CQZ A;  4JP7 A;  3HU2 A;  1DMR A;  4KLN A;  1I50 A;  3GTP A;  3IR7 A;  4CS0 A;  1CR5 A;  2CW0 D;  2AE0 X;  1SFO A;  3HU3 A;  2JIP A;  2V3V A;  3ML1 A;  4CRY G;  3X2I A;  2DMR A;  1PYQ A;  2C45 A;  2R92 A;  4DMR A;  3GTG A;  3GTQ A;  3PLX B;  2A68 D;  4KOD A;  3SUK A;  1Q16 A;  1PT0 A;  1TWA A;  3X2N A;  2G6G A;  4JP6 A;  2B63 A;  1CZ5 A;  1SMY D;  4FFT A;  2A6E D;  2PJH B;  3SUM A;  1E61 A;  2E7Z A;  3X2H A;  1HD5 A;  3GTM A;  2EEO B;  2E2H A;  2BE5 D;  2Y0S A;  1AW8 B;  1R27 A;  2PI8 A;  2V45 A;  4L48 A;  2G5D A;  3FKI A;  3GTJ A;  3DMR A;  1PQE A;  4AYB A;  1UHD A;  3D30 A;  2VPY A;  3QC8 A;  3X2L A;  3GTK A;  4GA6 A;  1BW3 A;  1PT1 A; 
#chains in the Genus database with same CATH homology
 2ENG A;  2PJJ A;  5GM9 A;  3X2P A;  3X2G A;  3X2J A;  4FER A;  3X2M A;  3CZB A;  3SUJ A;  4FG2 A;  3SUK A;  3X2O A;  1N10 A;  3SUL A;  4JS7 A;  3X2N A;  2HCZ X;  2G6G A;  2KQA A;  2PNW A;  4AVR A;  5H4U A;  4JP6 A;  4JJO A;  4FFT A;  5GLY A;  3SUM A;  1BW4 A;  4ZM7 A;  3X2H A;  1HD5 A;  1WC2 A;  3M3G A;  3X2K A;  2BH0 A;  2GAE A;  4FG4 A;  3X2I A;  2PI8 A;  4L48 A;  2G5D A;  3ENG A;  4JP7 A;  2PIC A;  3D30 A;  4JCW A;  2AE0 X;  4ENG A;  3X2L A;  1L8F A;  5GLX A;  1OA7 A;  1BW3 A;  1OA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...