4AVRA

Crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
MDTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRINDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pa01
molecule tags Unknown function
molecule keywords PA4485
total genus 34
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4avrA00
1L8FA 4JP7A 3X2GA 3X2NA 3D30A 1BW3A 2G6GA 4JS7A 2GAEA 2PICA 2ENGA 2BH0A 2AE0X 1N10A 1OA9A 1OA7A 2KQAA 4JCWA 3X2HA 4FERA 2PNWA 4FG2A 4FG4A 3SULA 5GLYA 4JP6A 3X2JA 5H4UA 4JJOA 4FFTA 1HD5A 2PI8A 5GM9A 3X2IA 1WC2A 3X2MA 4AVRA 3X2LA 4ZM7A 2G5DA 1BW4A 4ENGA 3X2KA 3X2PA 3SUMA 5GLXA 3CZBA 3ENGA 3SUKA 3M3GA 2HCZX 2PJJA 4L48A 3SUJA 3X2OA
chains in the Genus database with same CATH superfamily
4JP7A 1PYQA 3X2GA 1AW8B 3X2NA 3CQZA 1KQFA 1PT0A 1Y4ZA 4JS7A 3GTKA 2KQAA 3X2HA 1OA7A 1PPYA 5FTNA 2A6HD 3QWZA 4FERA 3SULA 2E2HA 1AA6A 1CZ4A 1PT1A 5FTKA 3GTGA 2NVXA 3X2JA 2YUJA 4KDIA 4JJOA 4FFTA 4AZDA 1SFOA 4AVRA 1ZC1A 3X2LA 1TWFA 2G5DA 1H0HA 1QCSA 2A69D 2Y0SA 3HU2A 1BW4A 1E5VA 2YU9A 3TIWA 3X2PA 1YNND 1CZ5A 1FDOA 5DYIA 4KLNA 2IV2X 1Y1WA 1EU1A 2VPWA 2HCZX 2PJJA 4C2MA 1E60A 3O5AA 2VPYA 2EEOB 2V45A 5FTMA 3D30A 2JA5A 5C1BA 1SMYD 1N10A 2A68D 2NVYA 2JA6A 2NAPA 2WAQA 4AAYA 3GTLA 1R7RA 2PNWA 4FG2A 2WB1A 4FG4A 4D7ZB 1IW7D 3GTOA 3GTPA 2PI8A 2E7ZA 4ZM7A 2VPXA 3GTMA 4ENGA 1QDNA 5B6CA 4AYBA 4AOKB 1KQGA 5GLXA 1H5NA 1G8JA 1FDIA 3CZBA 1S3SA 3HU1A 2E2IA 2PJHB 1L8FA 3H0GA 2BE5D 2R92A 3IR6A 4KODA 3TM7B 1TWHA 1PQEA 1BW3A 3ML1A 2A6ED 1ZYRD 1YNJD 2BH0A 1OA9A 1R27A 2PICA 4JCWA 4JP6A 4KDLA 1I3QA 3GTJA 2VUMA 1DMRA 5GLYA 5C18A 1E32A 1G8KA 5H4UA 5FTJA 1E18A 3SUJA 1HD5A 4AONB 5GLFA 4CS0A 2R93A 3X2IA 1WC2A 3X2MA 1OGYA 1Q16A 2JIMA 1PQHA 3X2KA 1I50A 2PMZA 2CW0D 4DMRA 1SIWA 1E61A 1UHEA 2C45A 2R7ZA 4KO8A 5DYGA 2O5JD 3DMRA 4QIWA 1PQFA 2VPZA 3X2OA 4CRZA 2B63A 5T5ID 5FTLA 1WLFA 3CF2A 2G6GA 3QC8A 2GAEA 2AE0X 2ENGA 1R9TA 1K83A 4CRYG 1TMOA 3PLXB 4GA5A 5T5MD 3QQ7A 2JIRA 3OUGA 3FKIA 2JIOA 1UHDA 5GM9A 3GTQA 4NOHA 4RV0A 2JIPA 1VC3B 2JIQA 3HKZA 1PYUB 3QQ8A 2JA7A 4GA6A 1Y5IA 3SUMA 1TWAA 1CR5A 1DMSA 1TWGA 2V3VA 2KI8A 3HU3A 1TWCA 3ENGA 3IR7A 3IR5A 3SUKA 3M3GA 2DMRA 1YLEA 1WCMA 4L48A 1Y1VA 2NYAA 5EPPA
chains in the Genus database with same CATH topology
1L8FA 4JP7A 3X2GA 3X2NA 3D30A 1BW3A 2G6GA 4JS7A 2GAEA 2PICA 2ENGA 2BH0A 2AE0X 1N10A 1OA9A 1OA7A 2KQAA 4JCWA 3X2HA 4FERA 2PNWA 4FG2A 4FG4A 3SULA 5GLYA 4JP6A 3X2JA 5H4UA 4JJOA 4FFTA 1HD5A 2PI8A 5GM9A 3X2IA 1WC2A 3X2MA 4AVRA 3X2LA 4ZM7A 2G5DA 1BW4A 4ENGA 3X2KA 3X2PA 3SUMA 5GLXA 3CZBA 3ENGA 3SUKA 3M3GA 2HCZX 2PJJA 4L48A 3SUJA 3X2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8F A;  4JP7 A;  3X2G A;  3X2N A;  3D30 A;  1BW3 A;  2G6G A;  4JS7 A;  2GAE A;  2PIC A;  2ENG A;  2BH0 A;  2AE0 X;  1N10 A;  1OA9 A;  1OA7 A;  2KQA A;  4JCW A;  3X2H A;  4FER A;  2PNW A;  4FG2 A;  4FG4 A;  3SUL A;  5GLY A;  4JP6 A;  3X2J A;  5H4U A;  4JJO A;  4FFT A;  1HD5 A;  2PI8 A;  5GM9 A;  3X2I A;  1WC2 A;  3X2M A;  4AVR A;  3X2L A;  4ZM7 A;  2G5D A;  1BW4 A;  4ENG A;  3X2K A;  3X2P A;  3SUM A;  5GLX A;  3CZB A;  3ENG A;  3SUK A;  3M3G A;  2HCZ X;  2PJJ A;  4L48 A;  3SUJ A;  3X2O A; 
#chains in the Genus database with same CATH topology
 4JP7 A;  1PYQ A;  3X2G A;  1AW8 B;  3X2N A;  3CQZ A;  1KQF A;  1PT0 A;  1Y4Z A;  4JS7 A;  3GTK A;  2KQA A;  3X2H A;  1OA7 A;  1PPY A;  5FTN A;  2A6H D;  3QWZ A;  4FER A;  3SUL A;  2E2H A;  1AA6 A;  1CZ4 A;  1PT1 A;  5FTK A;  3GTG A;  2NVX A;  3X2J A;  2YUJ A;  4KDI A;  4JJO A;  4FFT A;  4AZD A;  1SFO A;  4AVR A;  1ZC1 A;  3X2L A;  1TWF A;  2G5D A;  1H0H A;  1QCS A;  2A69 D;  2Y0S A;  3HU2 A;  1BW4 A;  1E5V A;  2YU9 A;  3TIW A;  3X2P A;  1YNN D;  1CZ5 A;  1FDO A;  5DYI A;  4KLN A;  2IV2 X;  1Y1W A;  1EU1 A;  2VPW A;  2HCZ X;  2PJJ A;  4C2M A;  1E60 A;  3O5A A;  2VPY A;  2EEO B;  2V45 A;  5FTM A;  3D30 A;  2JA5 A;  5C1B A;  1SMY D;  1N10 A;  2A68 D;  2NVY A;  2JA6 A;  2NAP A;  2WAQ A;  4AAY A;  3GTL A;  1R7R A;  2PNW A;  4FG2 A;  2WB1 A;  4FG4 A;  4D7Z B;  1IW7 D;  3GTO A;  3GTP A;  2PI8 A;  2E7Z A;  4ZM7 A;  2VPX A;  3GTM A;  4ENG A;  1QDN A;  5B6C A;  4AYB A;  4AOK B;  1KQG A;  5GLX A;  1H5N A;  1G8J A;  1FDI A;  3CZB A;  1S3S A;  3HU1 A;  2E2I A;  2PJH B;  1L8F A;  3H0G A;  2BE5 D;  2R92 A;  3IR6 A;  4KOD A;  3TM7 B;  1TWH A;  1PQE A;  1BW3 A;  3ML1 A;  2A6E D;  1ZYR D;  1YNJ D;  2BH0 A;  1OA9 A;  1R27 A;  2PIC A;  4JCW A;  4JP6 A;  4KDL A;  1I3Q A;  3GTJ A;  2VUM A;  1DMR A;  5GLY A;  5C18 A;  1E32 A;  1G8K A;  5H4U A;  5FTJ A;  1E18 A;  3SUJ A;  1HD5 A;  4AON B;  5GLF A;  4CS0 A;  2R93 A;  3X2I A;  1WC2 A;  3X2M A;  1OGY A;  1Q16 A;  2JIM A;  1PQH A;  3X2K A;  1I50 A;  2PMZ A;  2CW0 D;  4DMR A;  1SIW A;  1E61 A;  1UHE A;  2C45 A;  2R7Z A;  4KO8 A;  5DYG A;  2O5J D;  3DMR A;  4QIW A;  1PQF A;  2VPZ A;  3X2O A;  4CRZ A;  2B63 A;  5T5I D;  5FTL A;  1WLF A;  3CF2 A;  2G6G A;  3QC8 A;  2GAE A;  2AE0 X;  2ENG A;  1R9T A;  1K83 A;  4CRY G;  1TMO A;  3PLX B;  4GA5 A;  5T5M D;  3QQ7 A;  2JIR A;  3OUG A;  3FKI A;  2JIO A;  1UHD A;  5GM9 A;  3GTQ A;  4NOH A;  4RV0 A;  2JIP A;  1VC3 B;  2JIQ A;  3HKZ A;  1PYU B;  3QQ8 A;  2JA7 A;  4GA6 A;  1Y5I A;  3SUM A;  1TWA A;  1CR5 A;  1DMS A;  1TWG A;  2V3V A;  2KI8 A;  3HU3 A;  1TWC A;  3ENG A;  3IR7 A;  3IR5 A;  3SUK A;  3M3G A;  2DMR A;  1YLE A;  1WCM A;  4L48 A;  1Y1V A;  2NYA A;  5EPP A; 
#chains in the Genus database with same CATH homology
 1L8F A;  4JP7 A;  3X2G A;  3X2N A;  3D30 A;  1BW3 A;  2G6G A;  4JS7 A;  2GAE A;  2PIC A;  2ENG A;  2BH0 A;  2AE0 X;  1N10 A;  1OA9 A;  1OA7 A;  2KQA A;  4JCW A;  3X2H A;  4FER A;  2PNW A;  4FG2 A;  4FG4 A;  3SUL A;  5GLY A;  4JP6 A;  3X2J A;  5H4U A;  4JJO A;  4FFT A;  1HD5 A;  2PI8 A;  5GM9 A;  3X2I A;  1WC2 A;  3X2M A;  4AVR A;  3X2L A;  4ZM7 A;  2G5D A;  1BW4 A;  4ENG A;  3X2K A;  3X2P A;  3SUM A;  5GLX A;  3CZB A;  3ENG A;  3SUK A;  3M3G A;  2HCZ X;  2PJJ A;  4L48 A;  3SUJ A;  3X2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...