5GLXA

Crystal structure of a glycoside hydrolase from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
AEFASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
total genus 71
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glxA00
3M3GA 4JJOA 3X2NA 4L48A 5GM9A 3CZBA 3X2KA 2KQAA 2AE0X 1BW3A 1OA7A 2G6GA 1N10A 2PJJA 2G5DA 2PI8A 5H4UA 5GLYA 1HD5A 4FG2A 3X2OA 2GAEA 3SUKA 3X2GA 3X2JA 4AVRA 4ZM7A 1L8FA 4JCWA 1BW4A 2PICA 3SUJA 4FFTA 2ENGA 2HCZX 4JP7A 3SULA 3X2LA 2BH0A 3X2MA 3D30A 2PNWA 4FG4A 4FERA 4JP6A 3X2HA 4ENGA 5GLXA 3X2PA 1WC2A 4JS7A 3ENGA 3X2IA 1OA9A 3SUMA
chains in the Genus database with same CATH superfamily
3CZBA 2KQAA 4NOHA 2AE0X 5C1BA 2PJHB 2EEOB 5FTLA 1WLFA 1YNJD 2R93A 3QQ7A 3X2JA 5C18A 4ZM7A 1KQFA 1ZC1A 1BW4A 2PICA 3O5AA 5FTNA 1IW7D 1E32A 3SUJA 4FFTA 1SMYD 3PLXB 4AONB 2HCZX 1OA9A 4JP7A 4CS0A 2C45A 2E2HA 1AW8B 4C2MA 2JA7A 4JP6A 3FKIA 4AZDA 1SIWA 2VPZA 1CZ5A 2E2IA 3X2PA 1E18A 2O5JD 5DYGA 4JJOA 2Y0SA 3QWZA 5GM9A 2BE5D 1AA6A 1SFOA 1Y5IA 1G8KA 1CR5A 5FTJA 5T5ID 4GA5A 4CRZA 1N10A 4CRYG 2R7ZA 1TMOA 2G5DA 2PJJA 2VPWA 2A6HD 4FG2A 4KO8A 5B6CA 3TM7B 1QDNA 3SUKA 2PMZA 1WCMA 2IV2X 1I3QA 2JA6A 5GLFA 1G8JA 5T5MD 1R9TA 2WAQA 3DMRA 3QC8A 1PYUB 4RV0A 4D7ZB 1E60A 3HU2A 1QCSA 2JA5A 3X2MA 1R27A 2JIPA 5FTKA 1KQGA 4FERA 1PQEA 2NVYA 3TIWA 3GTKA 1UHEA 2WB1A 4KDLA 2NVXA 1PQFA 5EPPA 3ENGA 4AVRA 3ML1A 3X2NA 4L48A 1I50A 3HU3A 3X2KA 2YUJA 2V3VA 1OA7A 1PT1A 1Y1VA 2G6GA 2VPYA 3GTQA 1EU1A 2YU9A 5DYIA 2PI8A 5H4UA 1UHDA 2A6ED 1HD5A 2V45A 1ZYRD 2NYAA 1DMRA 2GAEA 1TWAA 3X2GA 3CQZA 1E61A 4JCWA 1TWHA 2R92A 2JIMA 1YNND 2ENGA 1FDOA 3CF2A 3SULA 3X2LA 2CW0D 1H5NA 2PNWA 1Q16A 2A68D 2A69D 1YLEA 4KODA 2JIRA 3X2HA 4AYBA 4ENGA 2NAPA 3IR7A 2JIQA 1PT0A 5GLXA 3M3GA 1R7RA 3GTPA 1CZ4A 1VC3B 1BW3A 4AAYA 3HU1A 1TWCA 1TWGA 1H0HA 1S3SA 2VUMA 1PYQA 4DMRA 3GTGA 3GTOA 5GLYA 1OGYA 3QQ8A 3X2OA 3H0GA 4AOKB 2JIOA 1DMSA 3GTMA 1L8FA 3HKZA 4QIWA 5FTMA 3OUGA 2B63A 1E5VA 3GTJA 1FDIA 1PQHA 1Y1WA 4KLNA 2E7ZA 2BH0A 1TWFA 3D30A 3IR6A 4FG4A 3GTLA 1Y4ZA 4KDIA 1K83A 2KI8A 4GA6A 2VPXA 3IR5A 1WC2A 4JS7A 3X2IA 2DMRA 1PPYA 3SUMA
chains in the Genus database with same CATH topology
3M3GA 4JJOA 3X2NA 4L48A 5GM9A 3CZBA 3X2KA 2KQAA 2AE0X 1BW3A 1OA7A 2G6GA 1N10A 2PJJA 2G5DA 2PI8A 5H4UA 5GLYA 1HD5A 4FG2A 3X2OA 2GAEA 3SUKA 3X2GA 3X2JA 4AVRA 4ZM7A 1L8FA 4JCWA 1BW4A 2PICA 3SUJA 4FFTA 2ENGA 2HCZX 4JP7A 3SULA 3X2LA 2BH0A 3X2MA 3D30A 2PNWA 4FG4A 4FERA 4JP6A 3X2HA 4ENGA 5GLXA 3X2PA 1WC2A 4JS7A 3ENGA 3X2IA 1OA9A 3SUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3G A;  4JJO A;  3X2N A;  4L48 A;  5GM9 A;  3CZB A;  3X2K A;  2KQA A;  2AE0 X;  1BW3 A;  1OA7 A;  2G6G A;  1N10 A;  2PJJ A;  2G5D A;  2PI8 A;  5H4U A;  5GLY A;  1HD5 A;  4FG2 A;  3X2O A;  2GAE A;  3SUK A;  3X2G A;  3X2J A;  4AVR A;  4ZM7 A;  1L8F A;  4JCW A;  1BW4 A;  2PIC A;  3SUJ A;  4FFT A;  2ENG A;  2HCZ X;  4JP7 A;  3SUL A;  3X2L A;  2BH0 A;  3X2M A;  3D30 A;  2PNW A;  4FG4 A;  4FER A;  4JP6 A;  3X2H A;  4ENG A;  5GLX A;  3X2P A;  1WC2 A;  4JS7 A;  3ENG A;  3X2I A;  1OA9 A;  3SUM A; 
#chains in the Genus database with same CATH topology
 3CZB A;  2KQA A;  4NOH A;  2AE0 X;  5C1B A;  2PJH B;  2EEO B;  5FTL A;  1WLF A;  1YNJ D;  2R93 A;  3QQ7 A;  3X2J A;  5C18 A;  4ZM7 A;  1KQF A;  1ZC1 A;  1BW4 A;  2PIC A;  3O5A A;  5FTN A;  1IW7 D;  1E32 A;  3SUJ A;  4FFT A;  1SMY D;  3PLX B;  4AON B;  2HCZ X;  1OA9 A;  4JP7 A;  4CS0 A;  2C45 A;  2E2H A;  1AW8 B;  4C2M A;  2JA7 A;  4JP6 A;  3FKI A;  4AZD A;  1SIW A;  2VPZ A;  1CZ5 A;  2E2I A;  3X2P A;  1E18 A;  2O5J D;  5DYG A;  4JJO A;  2Y0S A;  3QWZ A;  5GM9 A;  2BE5 D;  1AA6 A;  1SFO A;  1Y5I A;  1G8K A;  1CR5 A;  5FTJ A;  5T5I D;  4GA5 A;  4CRZ A;  1N10 A;  4CRY G;  2R7Z A;  1TMO A;  2G5D A;  2PJJ A;  2VPW A;  2A6H D;  4FG2 A;  4KO8 A;  5B6C A;  3TM7 B;  1QDN A;  3SUK A;  2PMZ A;  1WCM A;  2IV2 X;  1I3Q A;  2JA6 A;  5GLF A;  1G8J A;  5T5M D;  1R9T A;  2WAQ A;  3DMR A;  3QC8 A;  1PYU B;  4RV0 A;  4D7Z B;  1E60 A;  3HU2 A;  1QCS A;  2JA5 A;  3X2M A;  1R27 A;  2JIP A;  5FTK A;  1KQG A;  4FER A;  1PQE A;  2NVY A;  3TIW A;  3GTK A;  1UHE A;  2WB1 A;  4KDL A;  2NVX A;  1PQF A;  5EPP A;  3ENG A;  4AVR A;  3ML1 A;  3X2N A;  4L48 A;  1I50 A;  3HU3 A;  3X2K A;  2YUJ A;  2V3V A;  1OA7 A;  1PT1 A;  1Y1V A;  2G6G A;  2VPY A;  3GTQ A;  1EU1 A;  2YU9 A;  5DYI A;  2PI8 A;  5H4U A;  1UHD A;  2A6E D;  1HD5 A;  2V45 A;  1ZYR D;  2NYA A;  1DMR A;  2GAE A;  1TWA A;  3X2G A;  3CQZ A;  1E61 A;  4JCW A;  1TWH A;  2R92 A;  2JIM A;  1YNN D;  2ENG A;  1FDO A;  3CF2 A;  3SUL A;  3X2L A;  2CW0 D;  1H5N A;  2PNW A;  1Q16 A;  2A68 D;  2A69 D;  1YLE A;  4KOD A;  2JIR A;  3X2H A;  4AYB A;  4ENG A;  2NAP A;  3IR7 A;  2JIQ A;  1PT0 A;  5GLX A;  3M3G A;  1R7R A;  3GTP A;  1CZ4 A;  1VC3 B;  1BW3 A;  4AAY A;  3HU1 A;  1TWC A;  1TWG A;  1H0H A;  1S3S A;  2VUM A;  1PYQ A;  4DMR A;  3GTG A;  3GTO A;  5GLY A;  1OGY A;  3QQ8 A;  3X2O A;  3H0G A;  4AOK B;  2JIO A;  1DMS A;  3GTM A;  1L8F A;  3HKZ A;  4QIW A;  5FTM A;  3OUG A;  2B63 A;  1E5V A;  3GTJ A;  1FDI A;  1PQH A;  1Y1W A;  4KLN A;  2E7Z A;  2BH0 A;  1TWF A;  3D30 A;  3IR6 A;  4FG4 A;  3GTL A;  1Y4Z A;  4KDI A;  1K83 A;  2KI8 A;  4GA6 A;  2VPX A;  3IR5 A;  1WC2 A;  4JS7 A;  3X2I A;  2DMR A;  1PPY A;  3SUM A; 
#chains in the Genus database with same CATH homology
 3M3G A;  4JJO A;  3X2N A;  4L48 A;  5GM9 A;  3CZB A;  3X2K A;  2KQA A;  2AE0 X;  1BW3 A;  1OA7 A;  2G6G A;  1N10 A;  2PJJ A;  2G5D A;  2PI8 A;  5H4U A;  5GLY A;  1HD5 A;  4FG2 A;  3X2O A;  2GAE A;  3SUK A;  3X2G A;  3X2J A;  4AVR A;  4ZM7 A;  1L8F A;  4JCW A;  1BW4 A;  2PIC A;  3SUJ A;  4FFT A;  2ENG A;  2HCZ X;  4JP7 A;  3SUL A;  3X2L A;  2BH0 A;  3X2M A;  3D30 A;  2PNW A;  4FG4 A;  4FER A;  4JP6 A;  3X2H A;  4ENG A;  5GLX A;  3X2P A;  1WC2 A;  4JS7 A;  3ENG A;  3X2I A;  1OA9 A;  3SUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...