5GLXA

Crystal structure of a glycoside hydrolase from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
AEFASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
total genus 71
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glxA00
4JP7A 3X2HA 3CZBA 3X2MA 2G6GA 3SUJA 3X2PA 1OA7A 3X2GA 2ENGA 1BW3A 1BW4A 2PICA 1HD5A 3X2LA 5GM9A 2AE0X 3M3GA 2KQAA 2PJJA 4JP6A 4JJOA 5GLYA 3ENGA 4FG4A 3X2OA 4FFTA 2HCZX 3D30A 4FG2A 1WC2A 3SUKA 1L8FA 4ZM7A 1OA9A 2G5DA 3SULA 2PNWA 4L48A 3SUMA 4FERA 3X2KA 3X2NA 2BH0A 2GAEA 2PI8A 5GLXA 3X2IA 5H4UA 1N10A 4JCWA 4ENGA 4AVRA 3X2JA 4JS7A
chains in the Genus database with same CATH superfamily
3HKZA 3X2HA 1YLEA 2WB1A 1SMYD 4KDLA 2DMRA 3SUJA 3X2PA 5C1BA 1S3SA 1BW4A 2PJHB 1UHDA 2BE5D 4GA6A 2VPXA 2VPZA 3GTGA 2WAQA 4AOKB 2E2IA 2YUJA 3M3GA 1E18A 1YNJD 2JIQA 4JJOA 2R7ZA 1UHEA 4FG4A 1H0HA 1TWFA 3X2OA 4FFTA 1KQGA 1I3QA 2IV2X 4KDIA 4ZM7A 4CS0A 1CR5A 1DMSA 3GTLA 3HU2A 4FERA 2JIRA 1E32A 1AA6A 3X2NA 2KI8A 1I50A 2PI8A 4CRYG 5H4UA 4JCWA 3HU1A 1Y1VA 1ZC1A 1TWHA 2Y0SA 2E7ZA 2VPYA 4D7ZB 1PT0A 2JIPA 5FTNA 2JA6A 4JP7A 1OGYA 4DMRA 1PYUB 5FTKA 1QCSA 1PQHA 3X2GA 1BW3A 1E61A 2A6HD 2YU9A 1HD5A 2V45A 5FTMA 3X2LA 1PT1A 2NVXA 2JA7A 1R7RA 3IR7A 5T5MD 2PJJA 5FTJA 1E5VA 2V3VA 3IR6A 5B6CA 4FG2A 3QWZA 1CZ5A 3SUKA 1L8FA 3GTQA 2G5DA 1AW8B 4NOHA 1TWAA 1WCMA 2PNWA 5DYGA 1CZ4A 3HU3A 3SULA 2VUMA 2BH0A 2GAEA 3GTKA 3X2IA 4AZDA 4GA5A 2A6ED 5EPPA 5DYIA 1G8JA 2R92A 1E60A 4C2MA 1Y5IA 4KO8A 3GTJA 1TWCA 1ZYRD 4KLNA 2ENGA 1TMOA 2NYAA 2A68D 1QDNA 2C45A 5GM9A 5GLFA 2AE0X 2VPWA 1KQFA 5GLYA 4AYBA 1FDIA 5T5ID 2E2HA 1WLFA 2HCZX 1WC2A 1PQFA 3O5AA 3TM7B 3PLXB 1PQEA 2A69D 4RV0A 1Q16A 3CF2A 1R27A 2EEOB 3ML1A 3SUMA 4L48A 1IW7D 2O5JD 3X2KA 2B63A 1DMRA 3FKIA 1EU1A 4AONB 1N10A 1G8KA 1PPYA 1TWGA 1SFOA 4ENGA 1YNND 4AVRA 4AAYA 1Y1WA 3X2JA 3H0GA 3QQ7A 1Y4ZA 3CZBA 3X2MA 2G6GA 3CQZA 3QC8A 1OA7A 3IR5A 2PMZA 2PICA 1PYQA 2JA5A 4KODA 3TIWA 1K83A 2JIMA 4JP6A 2KQAA 1SIWA 3ENGA 4CRZA 5C18A 1R9TA 3D30A 2CW0D 3QQ8A 2R93A 1VC3B 2NVYA 3GTMA 1OA9A 3OUGA 1FDOA 5GLXA 3GTOA 4QIWA 2JIOA 3DMRA 5FTLA 2NAPA 1H5NA 4JS7A 3GTPA
chains in the Genus database with same CATH topology
4JP7A 3X2HA 3CZBA 3X2MA 2G6GA 3SUJA 3X2PA 1OA7A 3X2GA 2ENGA 1BW3A 1BW4A 2PICA 1HD5A 3X2LA 5GM9A 2AE0X 3M3GA 2KQAA 2PJJA 4JP6A 4JJOA 5GLYA 3ENGA 4FG4A 3X2OA 4FFTA 2HCZX 3D30A 4FG2A 1WC2A 3SUKA 1L8FA 4ZM7A 1OA9A 2G5DA 3SULA 2PNWA 4L48A 3SUMA 4FERA 3X2KA 3X2NA 2BH0A 2GAEA 2PI8A 5GLXA 3X2IA 5H4UA 1N10A 4JCWA 4ENGA 4AVRA 3X2JA 4JS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP7 A;  3X2H A;  3CZB A;  3X2M A;  2G6G A;  3SUJ A;  3X2P A;  1OA7 A;  3X2G A;  2ENG A;  1BW3 A;  1BW4 A;  2PIC A;  1HD5 A;  3X2L A;  5GM9 A;  2AE0 X;  3M3G A;  2KQA A;  2PJJ A;  4JP6 A;  4JJO A;  5GLY A;  3ENG A;  4FG4 A;  3X2O A;  4FFT A;  2HCZ X;  3D30 A;  4FG2 A;  1WC2 A;  3SUK A;  1L8F A;  4ZM7 A;  1OA9 A;  2G5D A;  3SUL A;  2PNW A;  4L48 A;  3SUM A;  4FER A;  3X2K A;  3X2N A;  2BH0 A;  2GAE A;  2PI8 A;  5GLX A;  3X2I A;  5H4U A;  1N10 A;  4JCW A;  4ENG A;  4AVR A;  3X2J A;  4JS7 A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  3X2H A;  1YLE A;  2WB1 A;  1SMY D;  4KDL A;  2DMR A;  3SUJ A;  3X2P A;  5C1B A;  1S3S A;  1BW4 A;  2PJH B;  1UHD A;  2BE5 D;  4GA6 A;  2VPX A;  2VPZ A;  3GTG A;  2WAQ A;  4AOK B;  2E2I A;  2YUJ A;  3M3G A;  1E18 A;  1YNJ D;  2JIQ A;  4JJO A;  2R7Z A;  1UHE A;  4FG4 A;  1H0H A;  1TWF A;  3X2O A;  4FFT A;  1KQG A;  1I3Q A;  2IV2 X;  4KDI A;  4ZM7 A;  4CS0 A;  1CR5 A;  1DMS A;  3GTL A;  3HU2 A;  4FER A;  2JIR A;  1E32 A;  1AA6 A;  3X2N A;  2KI8 A;  1I50 A;  2PI8 A;  4CRY G;  5H4U A;  4JCW A;  3HU1 A;  1Y1V A;  1ZC1 A;  1TWH A;  2Y0S A;  2E7Z A;  2VPY A;  4D7Z B;  1PT0 A;  2JIP A;  5FTN A;  2JA6 A;  4JP7 A;  1OGY A;  4DMR A;  1PYU B;  5FTK A;  1QCS A;  1PQH A;  3X2G A;  1BW3 A;  1E61 A;  2A6H D;  2YU9 A;  1HD5 A;  2V45 A;  5FTM A;  3X2L A;  1PT1 A;  2NVX A;  2JA7 A;  1R7R A;  3IR7 A;  5T5M D;  2PJJ A;  5FTJ A;  1E5V A;  2V3V A;  3IR6 A;  5B6C A;  4FG2 A;  3QWZ A;  1CZ5 A;  3SUK A;  1L8F A;  3GTQ A;  2G5D A;  1AW8 B;  4NOH A;  1TWA A;  1WCM A;  2PNW A;  5DYG A;  1CZ4 A;  3HU3 A;  3SUL A;  2VUM A;  2BH0 A;  2GAE A;  3GTK A;  3X2I A;  4AZD A;  4GA5 A;  2A6E D;  5EPP A;  5DYI A;  1G8J A;  2R92 A;  1E60 A;  4C2M A;  1Y5I A;  4KO8 A;  3GTJ A;  1TWC A;  1ZYR D;  4KLN A;  2ENG A;  1TMO A;  2NYA A;  2A68 D;  1QDN A;  2C45 A;  5GM9 A;  5GLF A;  2AE0 X;  2VPW A;  1KQF A;  5GLY A;  4AYB A;  1FDI A;  5T5I D;  2E2H A;  1WLF A;  2HCZ X;  1WC2 A;  1PQF A;  3O5A A;  3TM7 B;  3PLX B;  1PQE A;  2A69 D;  4RV0 A;  1Q16 A;  3CF2 A;  1R27 A;  2EEO B;  3ML1 A;  3SUM A;  4L48 A;  1IW7 D;  2O5J D;  3X2K A;  2B63 A;  1DMR A;  3FKI A;  1EU1 A;  4AON B;  1N10 A;  1G8K A;  1PPY A;  1TWG A;  1SFO A;  4ENG A;  1YNN D;  4AVR A;  4AAY A;  1Y1W A;  3X2J A;  3H0G A;  3QQ7 A;  1Y4Z A;  3CZB A;  3X2M A;  2G6G A;  3CQZ A;  3QC8 A;  1OA7 A;  3IR5 A;  2PMZ A;  2PIC A;  1PYQ A;  2JA5 A;  4KOD A;  3TIW A;  1K83 A;  2JIM A;  4JP6 A;  2KQA A;  1SIW A;  3ENG A;  4CRZ A;  5C18 A;  1R9T A;  3D30 A;  2CW0 D;  3QQ8 A;  2R93 A;  1VC3 B;  2NVY A;  3GTM A;  1OA9 A;  3OUG A;  1FDO A;  5GLX A;  3GTO A;  4QIW A;  2JIO A;  3DMR A;  5FTL A;  2NAP A;  1H5N A;  4JS7 A;  3GTP A; 
#chains in the Genus database with same CATH homology
 4JP7 A;  3X2H A;  3CZB A;  3X2M A;  2G6G A;  3SUJ A;  3X2P A;  1OA7 A;  3X2G A;  2ENG A;  1BW3 A;  1BW4 A;  2PIC A;  1HD5 A;  3X2L A;  5GM9 A;  2AE0 X;  3M3G A;  2KQA A;  2PJJ A;  4JP6 A;  4JJO A;  5GLY A;  3ENG A;  4FG4 A;  3X2O A;  4FFT A;  2HCZ X;  3D30 A;  4FG2 A;  1WC2 A;  3SUK A;  1L8F A;  4ZM7 A;  1OA9 A;  2G5D A;  3SUL A;  2PNW A;  4L48 A;  3SUM A;  4FER A;  3X2K A;  3X2N A;  2BH0 A;  2GAE A;  2PI8 A;  5GLX A;  3X2I A;  5H4U A;  1N10 A;  4JCW A;  4ENG A;  4AVR A;  3X2J A;  4JS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...