1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE H
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
5EPPA 3GTQA 3CQZA 3HU1A 2NYAA 3OUGA 5FTMA 3QWZA 1PT0A 2VPWA 1SIWA 1PT1A 2JIQA 1VC3B 3ML1A 2C45A 5DYGA 1DMSA 2NAPA 1Y5IA 2JA5A 1Y1WA 1R7RA 1G8KA 3H0GA 2JIPA 2PJHB 1AJYA 1AW8B 2JIRA 1QDNA 2R93A 1QCSA 4DMRA 1R27A 4CRYG 3GTLA 1E18A 1Q16A 1PQFA 5FTKA 3IR6A 1TWAA 4KODA 4AYBA 2B63A 2JA7A 1G8JA 2KI8A 3GTOA 1E61A 1TWGA 2VUMA 1UHDA 3IR7A 2YU9A 2IVFA 5C18A 1UHEA 4AAYA 5FTLA 2R92A 3O5AA 1K83A 1PQHA 3QC8A 4GA5A 1Y4ZA 1E32A 1KQFA 3QQ7A 2WB1A 1CR5A 2E2HA 3TM7B 2WAQA 2JIMA 3GTJA 2JA6A 2IV2X 1EU1A 2V45A 2E2IA 1YLEA 4KDIA 1WLFA 5C1BA 1TMOA 1AA6A 3HU3A 3HU2A 3CF2A 4D7ZB 4AONB 1WCMA 1CZ5A 3PLXB 5FTJA 4CRZA 1E5VA 4AZDA 1IW7D 1H0HA 4GA6A 1OMIA 3H25A 1I50A 3DMRA 1PYUB 5T5MD 3GTMA 1E60A 4KO8A 1KQGA 2JIOA 4C2MA 4KDLA 1R9TA 2NVXA 4RV0A 4CS0A 3IR5A 5GLFA 2Y0SA 1ZMEC 3GTGA 1PYQA 2E7ZA 4QIWA 3GTKA 3GTPA 2V3VA 2P10A 2VPYA 4AOKB 1PQEA 1TWHA 2G8YA 3HKZA 3O6QA 1Y1VA 1H5NA 2NVYA 3EWKA 2PMZA 1TWFA 4KLNA 5FTNA 1WMKA 1FDOA 5B6CA 2EEOB 2VPXA 2VPZA 3TIWA 1CZ4A 1OGYA 2DMRA 1FDIA 1DMRA 3IN6A 1PPYA 2R7ZA 1I3QA 1SFOA 1S3SA 5DYIA 3FKIA 1TWCA 3QQ8A 5T5ID
chains in the Genus database with same CATH superfamily
3GJ8A 3HR7A 1T3ZA 1VM6A 3TZBA 2BBWA 1PWXA 1RAHA 4C2TA 1YB6A 4X3PA 3VDXA 3TSCA 1WXFA 4ZKEA 2AEMA 1ELOA 3VU1A 1URQB 3FB4A 1EK0A 1Q19A 4JBYA 2EWVA 3QF7A 1HTLC 2NO6A 1G3MA 2ZZMA 3UAVA 1FYFA 3UJBA 2Z57A 3J80b 2E89A 3K0KA 3IEVA 1H8EA 2BRUC 2VN8A 2Y0BA 1P9RA 3RODA 4J2TA 1G21B 3DA8A 4CKBA 5C51B 4OLAA 1SQBG 4M99A 3SZUA 4K9QA 3AY7A 4L3VA 3R20A 2Q3HA 3EGCA 4ER5A 3QWHA 2XUPA 2G1UA 1JLHA 1OLSA 4A3MI 3GBSA 3I92A 3ZDZB 4PPQA 4E3ZA 3F8TA 3HCRA 5ALVA 1YJN1 4E14A 2FEMA 4IV5A 3EFOA 2KQAA 4EP1A 1FL9A 5EZ5A 3VO2A 4DUGD 4RA9B 3Q0EA 2LV8A 5DKFA 4RH0A 5AO9A 2Q2VA 3RUDA 1DOAA 2FH5B 4EECA 5KHOC 3CVYA 1HE4A 1XDDA 1JEJA 1ISPA 1XROA 2VEDA 2R65A 3EIFA 1BG6A 3QELB 4I55A 4JUCA 4U2FA 1WL8A 3EVDA 4IH4A 3T5CA 3TX2A 1ZGHA 1TDJA 4MZXA 1CUUA 2QE7D 3CGGA 3CKKA 3H8JA 4UMVA 3UKJA 1YIJP 4YHHB 1VHQA 4MX8A 4BLWA 1ZLYA 3ECSA 4XFDA 1VQL1 3VNQA 1QAMA 4JC0A 1O94C 5CM9C 1FSSA 2CLSA 3ED1A 4MI3A 1SFCA 5K09A 4WH0A 3PFGA 4CF6A 1FTGA 5F73A 2H2DA 3U48A 2VHEA 3N6VA 1CUZA 4PHGA 8MHTA 2GA1A 2REQA 2Z1NA 2DPGA 3P0FA 4UHBA 4NBGA 2C9MA 4NNJA 3OE5A 1PW5A 4XYLA 2PLAA 3SFDC 3C3JA 3IHTA 4EB8A 2J0QA 4QX6A 4UE6A 3UM9A 4GLLA 3UW3A 4MKHA 2H2WA 1C3OA 3GJ4A 3REQB 2B89A 2W27A 3SVTA 2XNDA 3QKSB 5DGHA 1BOOA 1FFAA 2A84A 4QJIA 4L7VA 1EWYA 1X14A 2QRZA 3STVA 1OH7A 1T0IA 4DCVA 3K4HA 3S1AB 4AMBA 4AL4A 3CCLP 4EMTA 3HJUA 1EVQA 5ADVA 1LX7A 1SFCD 4RTNA 2YNMA 4WPGA 2Q9IA 4XIIA 2JASA 1SOVA 1JEOA 2EL7A 2ZJZA 3F74A 3VUFA 4ASUD 2C0WA 3H1EA 1SQVJ 1LPSA 1SXJD 1WUIS 1NUIA 5EI5A 1IY1A 2ZBVA 3TTYA 5FOXA 3H1LJ 1KMHB 3NDRA 4OOEA 3PXEA 4DJFC 3ASUA 4AX8A 4FFBB 4QUKA 1NU1K 1UCFA 2DH6A 3GJZA 5KJ7C 2EXXA 4MVJM 1KAMA 2VPYA 3M4YA 2LIPA 2D54A 2G88A 1SBYA 3B2QA 3DW3X 5C1OA 4K9DA 4NBFA 3U3MA 1YI2P 1G8SA 3PXCX 3ZCRA 3VR4D 3G6E1 4IQ4A 3L79A 1T8WA 1NQTA 1QU2A 4WNIA 2OLKA 4S2UA 5K5EA 2OV1A 3ICEA 4Y9TA 2VF7A 2QSJA 1FDOA 4K86A 3JWHA 1FQWA 2AH5A 2WU1A 1VQ8Z 4H3SA 1Q5PA 4HAWA 4QRDA 2AJCA 3WB1A 4Y9RA 4ZWNA 2BPOA 3DZKA 1Z37A 1DTWB 4C3OB 1Q1EA 3BF8A 1PVOA 3K9BA 4JITA 4ZVKA 3B20A 1LD3A 2NVYI 2IPPA 3BCCD 3IUEA 2I4IA 5GINE 2JWAA 1JHXA 4CR7A 2IDMA 5H3LA 5A9SB 1TECE 1YUAA 1NN0A 3D2BA 3SUJA 2Z2XA 2XDQA 3JAKA 3R6LA 2AI3A 4O33A 1QO9A 2ZVNB 2R4QA 3GX1A 3HS3A 2DUUA 3L4BC 1TUEA 3C6ZA 1K75A 2JIDA 4EEZA 4FPXA 2KI7B 4UBKA 1AVOA 3EHDA 4G1UC 4LSZA 4MW2A 1X70A 2ZROA 5BSVA 4O2RA 3SLKA 2WJGA 4QBIA 2RKBA 3H83A 4TS9A 2D8MA 1XZJA 4PV1B 2FFAA 2R751 3DGEC 2GETA 4GKJB 3GTMI 1ESDA 1TB4A 2X1HA 1COWA 5KDLA 3RDPA 2GZMA 1QXFA 2MSLA 4BNDB 3DLHA 1ICEA 1SEPA 3ZJUA 1Y6QA 2P3SA 1C7QA 3QYPA 4KPEC 5B7QA 3AONB 1XLWA 2PJDA 4ZYWA 1F9EA 2PT7A 2ZQYA 3DKKA 5J2UB 2R6HA 2XEDA 1IXYA 3DUFB 3PENA 1Z7GA 2JEEA 4BN4A 2UWJE 3BBPA 4LWZA 3BDVA 2FSVA 2XITA 2R7AA 3HCBA 5I48A 2GKOA 3Q6IA 3T41A 1R9JA 1QZUA 1CIJA 4MW7A 1J0CA 2BI8A 3MUOA 3WQBA 2ZSIA 3LCRA 3LGXA 4RDHA 1B2LA 2ZAYA 3KYDB 3FHOA 1UT8A 4HX9A 5DXAA 4C07A 1COWD 3GTJA 3PUXA 4LXXA 4CN8A 1I80A 1SZJG 1EU1A 3UMSA 2BBTA 3G6WA 3U3JA 1LDBA 2OV3A 1S8OA 4PZ0A 3JQBC 1Z88A 5HIKA 1JMYA 4QYXA 5FBWB 5JFGA 2ACWA 1TRKA 2RH5A 4EWCA 3FF1A 1KE2A 5LR6A 4BLOA 3EISA 3FGAD 2ZAEB 2L18A 2CZGA 1D7MA 1KI6A 4CF4A 2Y9YA 3FPEA 3BWYA 1QG6A 1RXYA 2R66A 2GTPA 1YBFA 2JJQA 2PX8A 1NSYA 4C0JA 1SKYE 4RKQA 5EJ5A 3P52A 4J7XA 4EA9A 2PJJA 1YKSA 2V6MA 4II2A 1QH1B 2FVXA 3KD3A 3THXB 1YQ3C 2B1GA 2R7LA 2P9QA 2WLTA 1JGTA 2AMJA 1HYGA 2XUZA 4G41A 4YJGB 4BPBA 5EUCA 4TTAA 3KZCA 5ALNA 3ROQA 3RR2A 2OGWA 1RJWA 1M6EX 3QX8A 4LGVA 2Z95A 3ETNA 1Q50A 2FZWA 2O53A 1C29B 1XD9A 5IJAA 1E3TA 4U7DA 3IQXA 5ELXA 2X22A 5A05A 1CERA 1W36B 1NWCA 1M2KA 3GT7A 4XUDA 4OHZA 1ZRSA 3TE6A 1A7UA 3X1XA 4YRSA 2VHTA 5HUJA 2QEXZ 1BQ4A 3OQIA 2HQRA 4RDXA 1OXSC 1DKPA 4M9ZA 3QE3A 2G5GX 3GRZA 4L6IA 5EWMA 1KL7A 1VE9A 2C0PA 4GP7A 1J56A 3JALB 3LKVA 4DGLA 4XGNA 3WP0A 4I19A 3B13B 1AIPA 3AKCA 4IDNA 4PYJA 3T9DA 1RE4A 2QM0A 1M90Q 2JGEA 1KJJA 2HZ7A 16PKA 4V0SA 5CCBA 1ST3A 4LNHA 3BRVB 4QQFA 5CTJA 2O8CB 4B31A 1MFTA 2NTJA 4L0DA 4QSHA 2R96A 5DMXA 4Y1FA 5FV4A 1K97A 2WUGA 4MARA 4KR0A 1ZM9A 3P9XA 3KL2A 4LEIA 1M8KA 1MNQA 5BNZA 2ZJSE 1EP3B 4PZZA 1G98A 4YRTA 1PHPA 3N53A 4AI6A 3FTNA 1WW8A 5APQA 3G6EP 3MWJA 4M87A 3B9BA 4ZI5A 4DG9A 2PJRA 2D3TA 3RU3A 2B5WA 1R8XA 5G0TA 4H6VA 4QPJC 4DHEA 5D85A 1DV2A 1VDFA 2A5JA 3LZDA 3ANXA 2W42A 3C2QA 3UUWA 1KZ4A 1U2RA 3ZW9A 2C45A 2YKPA 2Z5FA 1GNLA 2IITA 3L41A 4BNKA 2HNAA 3GFOA 2XV5A 1PUIA 1PDVA 5CH5A 4DLUA 1K8A2 1SHLA 5C39A 1E3EA 3Q2YA 2FMKA 5GONB 5I51A 3U4GA 4M54A 4P86A 4K6OA 2CJXA 1KB9D 3D70A 3PBKA 1NPTO 3QXCA 5JI2E 2K9YA 2WFZA 2O8NA 2GCEA 1ZJWA 3H1LE 3IPAA 3HEBA 4FDUA 5TQ2B 2PM8A 4M1WA 1B0PA 2B1QA 2BMEA 2CVHA 3NGMA 1I0LA 1UJMA 1H2YA 2DQZA 2HHCA 2OG1A 3FWPA 4FVTA 5FFMA 4YREA 4EY3A 3IOMA 5KYGA 1HXHA 4B7CA 3EG5A 1YE8A 4TX1A 1PFQA 3TBHA 2H7VA 5CDYA 3G7SA 2BONA 4IJMA 3WYFA 1SCUA 1PT8A 2CLEB 4FI3F 2F1OA 4DCCA 4CIBA 4I4LA 4EVSA 2RHWA 1CIPA 4HEJA 2BVNA 1GTSA 2O3SA 2JLQA 4O4JF 3HDYA 5K9ZA 1YHNA 3A1UA 4DRXA 3AEZA 5CA0B 2CSUA 2WTXA 2VQ6A 3GAZA 4RETA 1IUPA 2E85A 1DELA 5K8VA 1MO2A 1E1QA 5I4BA 3QYAA 4EVQA 2VJAA 1MB9A 5DHSA 2PMCA 3EZLA 3W2HA 4CIWA 3M3DA 1TEXA 1JEYB 2H1HA 2PKQP 4Q3LA 4F45A 2ZXFA 4KWEA 4N03A 1YDMA 3I56P 2BFPA 2HWUA 2JW5A 1ZY2A 2CDAA 2ZIXA 1VCHA 4TKMA 2AG5A 1NTMK 3ZXUB 2B0JA 4F3KA 1CQJA 1PL7A 4N18A 3OP4A 2QS9A 1TLLA 2CHGA 2W4QA 4JLJA 1UAAA 2C00A 3DPSA 4XYBA 4H7DA 1Y1RA 1XCGB 1L2TA 5LYJA 1E4EB 5A0VA 3NQ41 2WY2D 1U11A 4AKSA 3X1DA 2Z6UA 4MUYA 3QZUA 5K2MA 3OQNA 4M6WB 2N1TB 1DG3A 3K5HA 4EKEA 1UJ5A 4EJSA 1MVNA 1C9MA 3PE4A 1V8OA 4KN9S 4OKNA 4UZEA 1OOEA 4F8JA 2G5DA 1GZ4A 5CLJA 3OESA 3KCQA 1I7NA 4UTNA 2NSYA 1TXGA 2CNKA 4Z9YA 5GLFA 4HT3B 1YWGO 1IK6A 4PLYA 5DLPA 1FJHA 1QYXA 3T61A 4BIMA 3GB9A 2N1TC 4ETMA 1TT5B 2VHYA 5JDIC 3DCNA 1R6DA 3ZIAA 3AWIA 2RC6A 3WGGA 1QV9A 1CI6A 2Q5UA 3H3JA 4WW0A 4XSHA 4DWWA 3E7KA 4U7JA 1KQSZ 4WXPA 4ZAYA 3F1KA 2JGMA 5G3YA 4R1LA 5JMTA 1WQ4A 1JAIA 1UOEA 2K5UA 3HXTA 4EITA 1XT6A 3BCHA 4Z99A 3X3HA 1JXAA 1NJI2 3DQPA 1Z5NA 1REQA 2QL6A 3BK2A 3E2PA 1EFVA 4UBIA 5AHWA 5KOJA 4BQEA 4B83A 2ORVA 1Z13A 2WMOB 2XMGA 1JDSA 4H27A 1PZHA 1Q3KA 1U0FA 3CNBA 2FPUA 3N8GA 4E5NA 4RE5A 2OARA 3HGQA 4C0QC 1RP1A 2OD9A 5JEEA 4JLSA 1EZ4A 4FFNA 4BJ5A 2AWNA 4L9SA 4M1QA 4PC3A 4PSCA 1A4IA 4A1OA 2K1AA 3DYVA 4TQ9A 2ZVOB 1IM5A 1OJ7A 1XEXA 3VMIA 1V3VA 3C4QA 4KL8S 2JFOA 3CLSD 1N0HA 3B6ZA 3OZIA 4EUHA 3LUKA 1E2JA 4Q3OA 5FA8A 3RJTA 2C0QA 2VH2A 2WWXA 1XZAA 3LV8A 3E18A 2RJ3A 3ENQA 1KFBB 3D5QA 3KKLA 2ODQA 5IFKA 5D3ZA 3E1IA 3B6EA 5KTBA 1R9MA 3QXHA 2BD0A 2IE8A 4S04A 1SKBA 3R0QA 5EIBC 3AB8A 1GL6A 4IFIA 3HY6A 1N7GA 3O84A 5D1HA 3COVA 4BQQA 1D0IA 2XODA 3PNKA 4A16A 1VRWA 3RADC 1CUVA 4O25A 2WILA 2FWMX 4BZXA 3W1EA 1LLFA 4TN5A 2E76C 1YR6A 4F11A 1J5PA 3DKPA 1E2LA 3DHWC 4L8VA 2GJAA 3ORHA 4XQ9A 4D8YA 4B9AA 3H1JG 1TU3A 3CT4A 1OT3A 3G49A 2FWAA 3M6LA 1LZLA 4Q7LA 1NKSA 1Q17A 2OXFA 1XCPA 1CJVC 2DH5A 2YU9I 5TQ2A 1F7UA 2YMLA 1Q7Y1 2ZP1A 3O91A 2PV0A 2KLVA 3NHFA 3TMYA 4CU2A 5JHGB 4RVDA 2VOEA 4KMSA 2PA0A 4YK7A 4GC9A 2PQMA 3V4ZA 3KX2A 4C4ZA 3V32A 5F3RA 4C1NA 4JL8A 4MVJE 1KRWA 1QAQA 2ZI7A 2PO7A 1YASA 4GLOA 5AUOB 4WBAA 5HHTA 5HQ3A 1DEHA 5KAFE 2ZETA 2XNSA 2VJMA 4LK2A 4DCKA 2QJFA 4A0HA 3T6KA 1E94E 5J4HA 4ND8B 2P6PA 1N5MA 3BMCA 3EBOA 3PL5A 4MV3A 4ZCIA 2VWQA 2FYNC 3T0IA 2WSBA 2YFHA 3C7DB 4JMPA 1NVKA 3GHGB 4JLPA 2F1IA 3UJ7A 2WMDA 2HBQA 3RNLA 1NN1A 2PGJA 2GCNA 3LBFA 5E1OA 2ENUA 3UCFA 4N3CA 3SJ7A 4JJKA 5U9CA 2CY0A 2SBTA 4JI2B 5GQSA 3W2TA 4MI9A 1ZHOA 3O90A 3I37X 3JAWB 3KLNA 4X6AI 2PVSA 4LDQA 4NBNA 4CKWB 4R1TA 1FYDA 2W6ID 1SELA 3VC3A 1W30A 5EIOA 3TTXA 5JC8A 3I39X 5L51A 2JA1A 4OHRA 2FPLA 1DLJA 2ORYA 3W5DA 3T3MB 4IDHA 5AOAA 1X1AA 4JH0A 2R8RA 4UAVA 3SNHA 1CZOA 4ZN6A 5KLVG 2R97A 3DXXA 3H1IJ 2H5IA 4GVPA 2HSZA 2OGTA 2CV0A 3VR2D 3NMUF 3RK3B 3OCYA 1N8RQ 4JWTA 1HTTA 4QDOA 2GUVA 1CB0A 2XR1A 2QEXP 2GEFA 3GRPA 4OH1A 3KT8A 2XT9A 5K4GA 2FF5A 3G71Z 1GAQA 2W93A 4FTWA 4AN4A 1ZV8A 4DIKA 3AF0A 3V1TC 2VAXA 1C7RA 3ITNA 1EAMA 3JWJA 3MGCA 4HWTA 3VR6A 5AW3A 3AWDA 2PMZA 2J4DA 1YE3A 4JQSA 4P36A 1MJGA 4UPEA 4BQRA 4CT5A 2WWYA 5EE9A 3G0BA 8LDHA 5KKZC 2CVQA 5AJUA 3IEUA 5BSMA 3L01A 4TYNA 1I2CA 3KR0A 3X2PA 2VPXA 5DOZA 2QREB 3QX3A 2RGGA 1I30A 2VHUA 2J3QA 4YRNA 4QPPA 1N6NA 4BKQA 4QU5A 3RBVA 5DYIA 1OQAA 2G17A 4HWRA 1XCLA 1MC4A 4WJLA 1KD1Q 3F9CA 3M7IA 1WULS 3FDZB 3V8EA 3WA7A 4UARA 4OI4A 1E2EA 2K37A 1KJZA 3BOSA 4I14A 4LVUA 4TYPA 3VP8A 5LB4A 4QICA 1KOLA 5JDIA 3VR6D 1IXKA 1T34A 3F49S 4FE3A 3Q88A 4A15A 4BMXA 1O97C 3VO9A 4CEJB 4I5GA 3B5NA 3UAOA 1FAVA 1S7CA 1RQXA 1T1IA 4HDCA 3WBJA 1SEVA 3M3HA 1I4WA 3OCWA 5IDWA 2NGRA 3F5DA 5SYAA 1YGYA 1OWOA 1VQ61 1UDAA 3HCEA 3MGAA 3K20A 3CX5I 2JCXA 4KQWA 1RBZA 3PRHA 1A9XB 2H2HA 1SD2A 1ZP0C 2BMVA 3PDIA 1FA9A 3LUHA 5CFQA 4GPIB 1Z22A 5FD8A 1E0DA 3BJRA 1ZUNA 1GA1A 5HCNA 4B79A 2R5BA 1U2PA 2CKDA 1IFJA 4M89A 4TSFD 4KU4A 3UC9A 1LVGA 3A9RA 1SQ0A 3LZ6A 4L5IA 2AFIB 1EK2A 2C8LA 1WSDA 4JGGA 3ZY6A 4EB3A 2CDBA 1E1DA 4TUYB 1J33A 5DT2A 2GSDA 4HDMA 1WXIA 3T1TA 4GQAA 5K3FA 1HGZA 2MR5A 3CRRA 3TQSA 1KP9A 4KVZA 4UU7A 5JZMA 2WV9A 4Y2XA 4A6PA 4TTRA 4YRPA 4J29A 1TWFI 1EK1A 4EY6A 3OHMA 1R64A 4RQUA 4HMPA 2VNAA 1MPTA 1N1MA 4R8MA 2H92A 5DYNA 2R8PA 3OOWA 1BD3A 3H6HA 1GZ3A 4LJ4A 3WQHA 2AWOA 2FUG1 4RTMA 3GG2A 2E4AA 4G86A 4U7WA 5BSUA 5F23A 1ZD4A 1L5GB 1SQPJ 2HFED 1EWRA 1M34E 1VRCA 4N5LA 1I7DA 3M8KA 3FROA 3N2ZB 3NWEA 1TFIA 4IKOA 1DJNA 4M8LA 1S7GA 3D1VA 2QTVA 3OZSA 2AX4A 1W0JD 3VN0A 1QXSA 3PGVA 2WF9A 4JI6B 3VBEA 1JLLB 2DWUA 3HDHA 3CC7Z 3OAAA 1SQPD 5B4VA 4ND8A 5HX7A 1CPYA 3GFFA 1UC8A 5EWLA 2EG5A 1FSZA 2FSIA 1S1MA 1SUIA 2E5FA 1PJZA 4JP7A 2OO5A 3IIMA 4DPLA 5J58A 4LJ5A 3IIEA 4RAQA 3ZWPA 4C29A 5H5JA 2Y77A 1OC2A 3CW9A 5DLEA 5HR5A 4R2HA 2QP9X 1BKSB 4P7BA 1LK0A 1E7WA 1EHCA 2DWQA 1YZHA 1Q95A 3ZJTA 3VU8A 5ERXA 1W85B 3FUCA 3ZK9A 1RE4C 1E0JA 1J2JA 1QLHA 2MTBA 3OUZA 4G5FA 1K5GA 1WNTA 4M0CA 1K7XB 4D4MA 5AKHA 3KLPX 3D6MA 3FDZA 4MV8A 1VJTA 4I1SA 3EVCA 4WINA 1PAUA 4NB8A 2HXYA 3FAZA 1Q3TA 3D0OA 5T4HA 3UMBA 5C4IA 1QP0A 1T8SA 1AUQA 1S6YA 3IIKA 3KD2A 1JILA 1O5IA 1LJ8A 2YH2A 3ORYA 4RZXA 3SBEA 1WVMA 4BCCA 4PR0A 1WZEA 3CXHI 1AVYA 3HXLA 1QVGO 2RI1A 1LV8A 3E2IA 3KKMA 3OSZA 1OR8A 3PT9A 3Q3VA 4LBYA 1XVIA 4MA0A 4X1KB 2BM8A 4O4HA 2FE1A 4B8YA 2R8ZA 3BXFA 1DKNA 4G5RA 3QWUA 2G83A 4PVDA 2YR0A 1RHQA 1VLMA 1QLJA 2X76A 4U5XA 3QVSA 3JQPA 2X0EA 4NEHB 4Z4FA 1CUXA 4CG2A 5F7XA 1DKOA 1ODSA 1MT3A 1ZK0A 5FI3A 2C7RA 1QH9A 3O93A 3LSYA 3ZCXA 3KVOA 1KP2A 2C78A 3QU5A 1HDYA 3N2IA 3D6AA 3AEXA 1SXIA 4F93B 1EA7A 1JSCA 1RLOA 2YO2A 4LF5B 2FUEA 4CEIA 3MJCA 1BGVA 1EDZA 5EERA 2YYSA 2PNFA 3BXEA 5DP2A 1HI9A 4AJJA 4I4CA 1DEBA 3CCL1 5ADUS 4AKIA 3NWPA 4MJ3A 1MZPA 1ADGA 1RXSA 3DCJA 3HP7A 4I4TA 4FYVA 2F64A 4MZDA 5FYQA 2EFGA 1CNFA 121PA 4ZOBA 3I5XA 4UNQA 3HKCB 3L6UA 5ALIA 3M6FA 3NG1A 3T4UA 1K5PA 4BFXA 1KJ8A 2P9EA 3Q7SA 4KIUA 1YV9A 4R3NA 1ODCA 1FUUA 1KSJA 1DX7A 1L5HA 4PX5A 4YRIA 2EF0A 4HAYA 1BGXT 4IH9A 4Y30A 5JVDB 4J7AA 4GYKA 4DR3B 2JNYA 2ZKIA 1JG7A 5FOUA 3JVUA 4QUHA 3W7AA 2VVTA 2R1VB 2XCLA 4LYGA 3IMGA 2POQX 3OIFA 4MEAA 4Q01A 1J1DB 1A95A 3WWYA 2VATA 5IPFA 1KYXA 3GTOA 3GZ4A 4PYOA 1V5GA 2SKDA 3GDOA 3V33A 3VR4H 4DIMA 3DZIA 2VSYA 2X9NA 4MUJA 4H3HB 3O95A 5DASA 3VOAA 4R98A 5AUPB 3RL0g 5KQLA 3FOFC 1BQ3A 5LP6A 1YVDA 1YS6A 3Q0IA 4RD2A 5KSWB 2X5XA 3FSGD 3KTAA 4YALA 4C88A 1GPMA 5AK0A 1K06A 4N41A 2LEXA 1BRTA 5HKKD 1XFDA 2WV7A 1KQFA 1VQNZ 3GI1A 1GFIA 1ZRTD 2JATA 1H1LB 3FJYA 2XNDH 1PZEA 3CMEP 4GOKA 1DRWA 4OXRA 5JCJD 2UXBB 2OBYA 1NIJA 3L02A 3M82A 4IRXA 4ESEA 4K9LA 1LSOA 2GEUA 2BZSA 3SDSA 1MG0A 5A5EA 3V2QA 3BRTB 1BCSA 2FR1A 4ZZ3A 3ASYA 4ZVNA 4F04A 2UV8A 4FLFA 5AI4A 5K05A 1Y9JA 2EWMA 3GQBA 4Q9DA 4XEHA 1B6GA 1BXKA 1GLNA 3V7YA 1DE0A 3Q85A 1XMPA 5KEIA 1YITP 3U1VA 1OMIA 2EJBA 1XTVA 3UW1A 2BMFA 1I24A 4I5IA 3X2JA 4XQEA 4G0WA 2WUEA 4DMHA 1O7JA 4J1TA 2A45H 2GCOB 1ZU4A 5B58T 3RYIB 5CT8A 1NVVQ 1SQBE 1EXDA 1E60A 3GJRA 3ENVA 2XUOA 4FWIB 4UUMA 1YFJA 1E0AA 2C5SA 5F5XA 2NVXA 1E2PA 4W5OA 5E79E 1MQ8B 4WEQA 2QLLA 3PEFA 4HZUA 4JI1B 2PR2A 5J63A 4LXUA 4G65A 2ZRCA 1XZBA 4BMPB 2WF5A 3JYOA 1H2RS 4NX2A 4UUNA 3KPUA 4HNSA 1TUBA 1VHWA 3L71G 3AG6A 1RJ9B 3D6NB 2OAEA 2ECQA 4BUJA 2RDMA 2BUAA 2GD2A 5EIHA 4NULA 3MTAA 5M29A 1P80A 1XMQB 2A92A 1MOQA 1TZCA 1YJNP 3HNOA 3NWJA 4FEAA 4MYSA 3WHIA 1FSFA 3WR5A 3CWBD 4KQHA 5CGZA 1JH9A 3CNQS 1CZ4A 2XZTA 3IBTA 3NUGA 1GADO 4LYDA 1JHMA 4QEKA 4X1KA 4X6UA 5ECWA 4CBVA 4HY3A 2O8FB 3NALA 2FRVA 1W47A 2UUCB 3GJXC 4DMFA 5ALMA 1UXGA 4Z6KA 5IXJA 4JX8A 4XUCA 3QF4A 4JOSA 2ISSD 3JZAA 2FG5A 1GRQA 3I9V1 2NZVG 2ADFA 2E75D 1QYIA 5G0VA 1QB7A 5K0ZA 5KJFA 1IB6A 1Y3DE 2NPFA 4GP9A 4EATA 2CPBA 2OL4A 3JR7A 2H4JA 4IXTA 4PWYA 3K0AA 3T3NA 1IHYA 5SZHB 1CR0A 1X80B 1Z6GA 2VUTA 1AB5A 1WS6A 2QNRA 3FKSA 4BJ3A 5A2Qf 1YT5A 1KYVA 4RHUA 4FOSA 4J0QA 1ZUHA 3BFPA 4ARZA 1VQ51 2AG0A 3SP1A 3WNQA 4AECA 5CFZA 2OTL1 1OWAA 5JCOC 1H3EA 3JVDA 1QDNA 1A0OA 2G9NA 3WWDA 1FUEA 3KHKA 2QPAA 3FRHA 1Z36A 4FP9A 1JIQA 1E6WA 3DVRX 4E51A 5GOZA 1W4AA 3SBXA 1OREA 2NXWA 1TWAA 3H0CA 2Q3EA 4WY4B 3I5CA 4D99A 2PPLA 3RSLA 1KE1A 3ISTA 1ZM7A 3FFXA 5KLVE 1J49A 1NVGA 3G5MA 1UIIA 2JA7A 4EB6B 3UG6A 1K86A 1Z0SA 3FKJA 3MTIA 1GQQA 1QC5A 3KOWA 4KCGA 5JVDA 4W5QA 1GILA 4IGAA 3E0QA 2XMDA 2I6FA 4WZZA 2JFFA 2YNMD 1X13A 1NI4B 1PJLA 1I10A 4ZVSA 3RGGA 3RE1A 2W03A 4A0SA 2BEVA 5K5GB 3JQFC 3HZOA 4PCUA 3K1AA 3DLCA 2KBEA 3TIXB 4BEBA 2BF7A 2J9RA 5DVZA 2W2LA 4UB8H 3QXJA 2AXNA 3PS9A 1YBHA 3ZE9A 4C89A 2YOGA 5G41A 1BE8A 3C7TA 3DB2A 5ICGA 3AUXA 5T4BA 1FRFS 5CLIA 3L9XA 3I2HA 3HDTA 2R11A 3OIDA 1R6AA 3CX8A 3B9QA 3ZCQA 4TLBA 1BQEA 1S4XA 2ONYA 1Q3HA 1EFPB 1MGPA 1VKNA 2OVBA 3B70A 4M7OA 1NP6A 4U2DA 1X7DA 1P74A 1V7CA 3USCS 3LPAA 4WN3A 3SSMA 4B3MB 4RHTA 5J5CA 4CL8A 2BFDA 1E5VA 3G0IA 1U04A 1Z26A 3AVPA 1JPNA 3QVOA 5MGNA 3FWNA 4BP8A 3CUSA 2RGCA 1VLQA 2IFMA 2WWFA 2O6HA 3H2ZA 1YS9A 1YDFA 2HKIA 3IEXA 1GARA 3L2OB 4ZMBA 4BWVA 3DDOA 3L0PA 2JAUA 1F6WA 3AC0A 1FS0E 2M5AA 1PKXA 5FRDA 4B3IA 3L4KA 5EXTA 5T5MD 3FNQA 3IA7A 1I3QI 1CEQA 2QXUA 4ETIA 4H7JA 4KNWA 1UXKA 4JEHA 2IZ7A 2PDAA 1QWOA 2KS1A 4GEGA 4FFPA 2XVXA 1DKLA 1ZSVA 3HEAA 3LF1A 3GW6A 3OPMA 4Y18A 3UHOA 1T36A 4DEVA 2IHYA 2PU7A 4QA9A 1UOOA 2JJLA 4WY8A 1MC1A 4JVSB 3GTPA 2VUUA 3I45A 5CA1A 1Y3IA 1MAAA 3LL7A 4CF3A 2A45G 1TU4A 1Z2NX 1PIWA 3DOEA 3BMNA 4WKBA 3V8BA 4KRFA 2XD9A 2QD5A 3WLFA 1E9BA 4H4DA 3NV9A 3VOBA 1U5AA 2QYTA 5EUBA 2GNAA 1PGJA 3NFZA 1PNRA 4REQB 5AM3A 4MW0A 1I1NA 3OQ6A 1P39A 2HUNA 1KHTA 1RKVA 3DT6A 1NBME 4CM1A 5CT5A 2AZMA 2ZS9A 5KSZA 3N2LA 1O97D 3WS7A 5CXQA 3WDKA 4F5DA 3F3FC 2X4GA 3BL6A 3N2KB 2PZEA 4V2IA 4YHBA 5IC5A 2RI6A 3MCZA 3OEHD 1GNQA 4Q15A 3TD2A 3X2NA 3LQ1A 2R8EA 5DU2A 5DM1A 3VI4B 4KJMA 1USUA 1TT7A 1X87A 3GVCA 4HO1X 2QTHA 1ZS9A 1DIOB 4E1BA 3ANMA 2VYNA 3GF4A 5KDOA 4N5MA 2PBFA 3IL2A 2V7BA 5EXPA 3RANA 3AVTA 3OJAB 3R7WB 3SHFA 2HLHA 1TVMA 5AQ1A 2BKLA 1XV5A 4OREX 1VXRA 3U7QB 4NYMR 3WU2H 1PF7E 1L0LD 3CCQP 3DC7A 4PZYA 2V9ZA 1W75A 2E4VA 3TNDA 3NHMA 3UUGA 3AH8A 4C3UA 3TNUB 4F2PA 1F2UB 4CMEC 3L06A 5KAIE 4O4LB 4TUYF 1SULA 1ZD2P 2OOYB 2KLHA 3CWBG 1Z16A 1ULZA 3AVQA 4TGLA 4WLUA 1ECPA 5L8RJ 1I8TA 2L17A 4EG4A 3VR5A 2X6TA 5JD5A 3PFHA 1NP7A 4YP7A 1Z8NA 4GXRA 1KK3A 4BRWA 1PQUA 5HDQA 4KXXA 5KOHB 1C0KA 1D07A 3KUDA 3HTKA 4P3NA 4WDRA 3HCFA 4RD0A 1K9M2 4KR9A 2RFLA 2GTIA 4DV1B 1FTYA 2YVLA 4PEVA 4ZJZA 2YUIA 2OB2A 4H0NA 1QVAA 5BYJA 4RIGA 3PK0A 2F1JA 2PFSA 1EDKA 1Z4QA 1NVWQ 4I3FA 5I7RA 1Z2EA 2W6PA 3GG9A 4MQUA 5EZQA 1OFCX 2WT7B 1I50I 1QX3A 4FD2A 5F9MA 2C03A 3VNBA 2QI9F 1LT9A 2ZYHA 2VDWA 3KDAA 2QUJA 1FQKA 5KS2A 2O2CA 4RDIA 4LC1A 1YDEA 2XQKA 1YTLA 2NM0A 3IKVA 4JLBA 1VB5A 4L27A 1SXQA 1N2DC 5KNDD 4A8TA 1SQPE 1GD1O 4D8WA 3GUCA 2WD7B 4CKCA 1N0IA 2PMWB 2UVQA 4K9KA 1J0AA 4EO4A 5L3VA 2DHEA 2EP5A 3LKDA 2ZRQA 4M0PA 5HMMA 3LBHA 1WO8A 4EH1A 4DK1A 3F97A 4AG6A 1KBQA 4MO2A 2NUAA 3HUDA 3IEPA 4R3UC 3EFGA 1H8ED 3EZ9A 1FZBA 2PRYA 2W5UA 4RPCA 5LNK1 1Q7CA 5DYTA 5I4KA 3PC4A 2HG5D 1JFFA 2UZAA 5M34A 1O2DA 1L4HA 4MP8A 2E18A 1XDUA 2F48A 1QHSA 2QAGA 1X74A 1VFPA 2BH0A 1D1PA 4RANA 4Y6OA 2RJOA 1MOZA 3ERCA 4EKIA 2XNKA 4KQCA 1FQOA 4EPYA 2XLCA 1W88B 4JVLA 4LMRA 2XY4A 3LCMA 4INOA 1R0LA 3ECAA 1CIVA 2HIAA 1SLQA 3MZLB 1S9DA 5LZ7A 3LNTA 5F1PA 1QKKA 1GNTA 2DUMA 5SYMA 3UV6A 3MAJA 1WKBA 1NG9A 1CS0B 3B7PA 3ZH9B 2C7OA 3ON5A 2X0FA 3EULA 5JXWA 5K8TA 2BM0A 1WMSA 3FPKA 3QFTA 4AZWA 1OKKA 2DHDA 2ZUUA 4ASWA 1PV3A 3NHJA 1UBLS 4I9HA 4B3FX 3ESDA 3GHGA 2ARKA 4HDMB 4DYVA 4HK4A 4OQ4A 2QU8A 4EGFA 2ZT9C 3IVCA 4TQUS 4ZRDA 3AR9A 3F8SA 3WB2A 5JPCA 3GLUA 3PNVA 1CVRA 4XSGA 3VPFA 2Q4ZA 2B9BA 1N4AA 4AJOA 3S99A 3ZXXA 3O4IA 4EI9A 1U2DA 3KP1A 1L4AB 3PXDA 2O8EA 5FA5A 4GSLA 5FO0A 3KIFA 2C1XA 2CLFB 3NXKA 3PPWA 1R7RA 3OLZA 3I5YA 2HJGA 4BJ1A 1BGYE 1UF9A 3TM5A 4XYGA 2V7QD 3AVVA 1N2BA 3KBBA 1PE0A 5BVZA 2OMEA 5TMDA 2RT9A 2DRIA 2B4AA 4B85A 3I4LA 4V02A 1RWQA 5F12A 1OU0A 3L6BA 4DYHA 3ZK8A 3IS3A 5F7JA 5H68A 3P1JA 4X41A 1D5CA 4NLLA 3K9GA 4ZVRA 2Y1EA 4BFUA 4EBFA 5AHKA 1Y3BE 2P6OA 2BEUA 3FNHA 1DD3A 5JYBA 3CMMA 5CM2Z 2GN4A 4QBHA 4IWXA 2Z43A 4PCVA 5HGJA 2NO9A 4UU0A 3WIBA 3WKEA 2V8KA 4YWHA 1M5RA 1PPJE 4R84A 5LYYA 3VX3A 2L19A 2OP0A 5JFOA 5ALEA 4EPWA 3L72E 5JJLA 1RWBA 1VQ41 1HZZC 1K6JA 1YB5A 1M2WA 1ZINA 4IINA 2QMOA 5A7HA 1C9JA 2IHNA 4TV9F 2F3UA 4PQGA 2GD1O 3RVNA 4GA5A 3HVIA 2E5TA 2ENGA 2F1HA 3GA5A 4WAUA 1SCUB 4BASA 3KFLA 3KB1A 3LT2A 4LXGA 5J2TB 3W0LB 2VYND 4WECA 4U63A 1VA5A 1L3IA 1XXLA 2IA5A 2OM2A 3FKQA 3WIVA 2Z4SA 1UK9A 4DGSA 1UBOS 3JARB 3Q5EA 2Q1YA 1SWVA 1R8YA 3HU2A 3NYWA 3ETCA 1WUHS 1GG5A 1MA0A 3K6RA 3OF5A 4RYDA 1T3LA 4N12A 4QT4A 1YAJA 2FSHA 1DC6A 1E2UA 1U0NA 1PLJA 3B85A 1VE6A 5ERGB 3GIWA 5JTUA 1V96A 2PKQO 1CY1A 4P93A 3ZJYA 2C97A 4MMXB 3BCUA 1IY2A 1MTZA 3H9EO 3PQEA 4J0EA 4EVRA 3MK31 4GKAA 3PPXA 2QD4A 3V4SA 1ZA1A 3ZZNA 2QTMA 3TYXA 3KL4A 4J1SA 3RVJA 5AVRA 4RY0A 4WLOA 2X1LA 3LBIA 3ZCPA 3AKZA 2R5WA 4QRIA 1SFRA 3C5WP 2CUTA 1NXSA 3FNFA 4PTYA 2VQSA 1ZNQO 4LXIA 1G3RA 4OV6B 4Z9XA 3U9SA 2Y93A 3IYLW 4HH0A 2Z2IA 4UD6A 4YMVA 2J5QA 2JI6A 2XCIA 2WZCA 5FLXA 3CCE1 4MINA 3BAFA 1KY5A 3B1KA 1BROA 3CB2A 3N39C 4TTQA 3BMCB 4BKPA 3QFSA 1QIHA 5BWBA 3LY5A 4Y1RB 1QPBA 3EEBA 4OHYA 4CI9A 2K9JB 1ORHA 5KAMA 4CTKA 1DWPA 4J1NA 3D6YA 1J0EA 2ZYAA 3OY2A 4WKPA 1NFRA 3T34A 4D82A 5EE0A 3PH0A 1M5UA 3G0CA 3UJHA 1XPOA 4LF6B 3WOHA 1W1IA 2C5HA 3OZDA 4J91A 4N40A 3FQMA 2R1ZA 4PGFA 4BZZA 4J3FA 1MT0A 2R68A 4HH2A 2JWDA 1DC4A 2F9MA 2WM9B 3UK7A 4DLPA 1C0LA 1N4DA 5CBKA 1W49A 4Z4HA 1T4CA 1KK0A 2GRJA 3KAJA 3NV7A 2SCUA 3ME5A 3FDXA 3RTDA 5J3JA 3LLUA 5AJHA 4JL6A 3PRKE 4M83A 4L8YA 1L5MA 2J58A 1SUPA 4Y2VA 3W90A 3WUVA 2ZTSA 1H93A 4O8CA 4OHWA 2PAFA 4L4YA 4RHEA 3CD6Z 3TLMA 2JHFA 1U9JA 2JGAA 4KN5A 4OQZA 2PLFA 2VXBA 3GHHA 4OCZA 1FEZA 5LU8A 3B3AA 1CD5A 1TKCA 3E5RA 4P53A 5FNVB 5B6JA 1RQNA 3IGFA 1MF7A 5CMLA 4B3TB 5EQTA 3ASZA 4ISBA 3L7IA 3RSGA 1QIEA 3X2IA 3K09C 4KEAA 2I7VA 4P22A 3S1QI 1FRVA 1JR3E 3BL8A 2KNCA 4O5OA 4YYEA 1A3CA 3IT1A 3HUSC 5I9MA 5CBPA 2LXBA 3SULA 1T9KA 2ZUWA 2NVUA 3ADOA 3H3XA 3NM6B 4DBVO 1FP6A 3BB4A 4MWCA 3FWYA 2QD3A 1PR4A 4MV5A 2ZJ3A 3OWHA 1ILEA 2NWQA 4HMOA 1G9SA 3SXUA 2B25A 1LTTC 3OA7A 2HYNA 1G2PA 2RBLA 2C99A 2E43A 2CYBA 2E5WA 1V8PA 2G0NA 3K4QA 4HADA 4IO0A 1TCAA 3FCEA 3NGXA 5ALYA 5DTMA 3RTGA 3V34A 2WC1A 2XOKD 3DVQX 2E6UX 2CLCX 3OX1A 5JNRA 2IS1A 4NARA 4LF9B 1NUPA 3KYDA 3L4FA 3PO3S 1L8XA 1DJQA 1X2EA 2G71A 2YIJA 5FOQA 1ZMXA 1HDGO 5D5HA 1NTRA 2R48A 5IYZA 1HDOA 3AUJB 4DV6B 3GLVA 4Q7MB 3W6PA 3HRHA 4ZJUA 2WSIA 3KHSA 3TGLA 2QVYX 2VAVA 5MN4A 1UKVY 3CCRZ 4I99A 2LDBA 4WZ6A 1MO6A 1R9NA 2AI1A 2BJVA 2G1JA 3EGVA 1O94A 3LKBA 4U39A 2HODB 2ANCA 3H19A 1M75A 3S1NI 1JKMA 1SBZA 4N3AA 1BNCA 1KH1A 2JB9A 2YOHA 4X1YB 2OB1A 4R8SA 2XUJA 3G8AA 5FL7D 3T9EA 3Q7TA 3HRNA 1BTOA 1RFGE 4EGJA 3O3NB 1T1SA 2PH1A 3ZVKA 3NH5A 2H07A 4KKVA 5IAOA 2XE4A 2B20A 3CN7A 3KOZA 3WRYC 1SBCA 2D3WA 4PQYA 1LNZA 3MCVA 2EW1A 3ZXYA 3HVUA 2AOXA 1AZTA 1QVWA 2BC9A 2ZWAA 3ZNOA 3SXPA 5EJ9A 4O2AA 5A6SA 1RYNA 2XE8A 1E59A 2P9ZA 4WFIA 2BELA 2VP2A 4P9NA 4EZBA 4J7CA 2VSNA 1LZKA 1AXRA 1EP1B 2YL2A 3LUCA 4N0EA 3SHVA 1FVXA 3ROXA 4MS4A 3T97B 3SKYA 3JALA 1G20E 1L8FA 4EUEA 1RHKA 3EDOA 2FY8A 4JASB 5HJ5A 1BFKA 4EW1A 2IYTA 1JIIA 2OHHA 1I6KA 4HDSA 4N78D 2P0AA 5A4KA 3GPDG 5JS7A 2WPDD 5EYPB 2G1PA 2O2XA 5HFNA 1VQ5P 1J24A 1RHZB 1OZFA 2EU8A 2RB4A 1WTAA 3CLKA 1XYGA 2QT9A 3LVFO 3O3OB 5JQWA 1YI2Z 4JFRA 4RPHA 2GVDC 3MW8A 3BHIA 3FVQA 3QA3E 3P0JA 3QPVA 4B0OA 4WLEA 1EVYA 2EZ9A 1HNWB 3NIBA 4O4IB 5HTKA 3WZLA 1ZOLA 3T3OA 4WX2B 4KLZA 1EXVA 1BW4A 3SLGA 3CLRC 4HNGA 2CW5A 2QVCA 3G9XA 3HR4A 3SSOA 4MWEA 4YMSA 2QA4P 2CJPA 3E3NA 1ZJ4A 4JUFA 4PHHA 5AR1A 5EP2A 5GY7A 1RAFA 1PFGA 1HE5A 3DDZX 3N70A 3W05A 4E32A 1X7XA 5AVZB 3KSUA 4JXKA 4URUR 2YQ4A 2H11A 3PE3A 1D2GA 1KC3A 1X1CA 1MNAA 3K96A 5CT4A 3CQZA 2R8XA 1IRXA 2HSJA 2WYUA 4IBOA 4TLEA 2DTDA 3NHLA 2ERCA 5DI9A 2B87A 1I36A 1N2HA 2EC5A 5AW0B 2PZAA 3OIYA 5JD3A 4IPTA 3UHFA 1KY3A 5CNIA 4RWZA 5F4BA 1YI8A 3D3QA 4DVJA 3UFXA 1GUZA 1XA0A 3IUSA 3MEQA 1JDZA 1HRKA 2BMJA 3QXGA 4FFWA 5DBFA 4D9EA 1Y7PA 3FHTA 2PKCA 2WWRA 4I2VA 3P9PA 3N2YA 3RAJA 5FWXA 3AU8A 4B4WA 5M5BA 1UBJS 4OYYA 2XNXA 5AW3B 1P9NA 2ZJOA 3GTPI 1T9HA 2GXSA 3I4CA 5LMZA 2L42A 3GZNB 1W2BY 4QUAA 2H85A 5LOVB 3COSA 2OK7A 4HLCA 1W2GA 3NVKI 3P4YA 2IOFA 3IV7A 4X64B 2AL7A 3HE3A 3DZHA 3H2HA 4KZKA 2PP6A 1L3BA 1JY2P 1EX9A 5L7TA 4C7NA 3OC0A 2CL5A 3KKKA 3SU8A 5EZYF 2GZ2A 2R6GA 1APBA 4L28A 2HZBA 1HD5A 2VP5A 4FR5A 3CRNA 3CXHH 2G72A 1T2KC 3BRSA 1L5QA 3MS4A 3NWOA 1IC6A 5COBA 1BHQ1 1GG8A 3QW2A 4KGZA 1HGVA 1TI7A 3TQFA 4TROA 4BNLA 5ICCA 2A57A 3DTVD 2OV2A 2ZS8A 2P5TB 3OTIA 2FPPB 3VDQA 2D2XA 4DLLA 2CL6X 4O4HF 1GVNB 4Q5IA 2D2EA 1G8HA 4FMPA 3W7BA 3FXDA 3HOVI 1D7OA 1JXOA 1R0CA 1WY7A 4IGIA 3L71D 2IXAA 5C44I 1O57A 2ZRHA 2AZTA 2LBPA 1N2ZA 1VMAA 1Z0UA 3MCTA 4PLVA 4RHFA 1S8FA 5KI6A 1T4DA 5A4MS 3ELUA 4UXJA 1IBRA 3L46A 3HKBB 3SOPA 2CE7A 3BEDA 4G37A 3WSVA 2AFIA 2PD6A 4IS2A 2AOUA 3KQVA 4CDNA 3ZV3A 4GSYA 3LQFA 1TQ2A 3DV2A 3ORRA 4YJ3B 1E1QD 1M7GA 2OHVA 4A6DA 4WK2B 3EEYA 5E7JA 5EIAA 1WQ3A 4QDUA 5FOSA 2ORIA 4G63A 4P3XA 1T1EA 3EWIA 3IUJA 5E1MA 1Z2OX 4CMKA 1PUJA 2HT6A 1YTZI 2AC7A 2P3YA 4GPZA 1UK7A 4URYR 1XNGA 3OCUA 3H1LD 3FMVA 4KVFA 1DSSG 1JHYA 1YGPA 2C1ZA 1GHTA 2ECKA 3D6JA 3E58A 5BQPA 3I23A 5CLFA 5JLJA 5L6MB 1W5TA 3ZIUA 4MOWA 3T5BA 1TWAI 4LNAA 5BV0A 5EFWB 1KJ9A 2JJ2D 3M49A 1IK9A 4JB3A 3KZKA 2VBGA 4MO9A 1B4DA 1V1MA 3HJCA 3LDGA 4GRDA 4UVIA 4MJLA 4MHOA 1SJ9A 3IKJA 2ZFCA 5IZ4A 4RA6B 4HQOA 2AD1A 3CLTC 1L8QA 3JRXA 3KVNA 1E7QA 1LWNA 3PP8A 4IHJB 3WL7A 4OHXA 3ZEAA 4P8RA 2FX2A 4OA5A 1SKMA 1NPYA 2V58A 2VRBA 4BO5A 2YTZA 3S2FA 2FWPA 3RZOI 4LWPA 1SIBE 4PZCA 5LP1A 2BEVB 4Q3BA 2ZWOA 1B8NA 2GARA 4D3ZA 1T0BA 2M32A 2EEPA 4X1OA 1XZLA 3LYLA 1SH7A 1AQ6A 2GM9A 4F06A 3U1TA 3CMAZ 1CUJA 3ED5A 1NN5A 1HEIA 1SQ6A 2VP4A 4HRYA 3NUZA 2GZSA 5ALZA 1KHHA 1WDMA 2JH8A 4RJKA 2DMRA 3HRIA 5LA6A 5KNCH 1KRXA 4ZJPA 4YAKA 3D6UA 5JSFA 2N3ZA 5H4UA 4EA8A 4GMHA 5G1PA 3G2QA 4Q7EA 3AVXA 1QOPB 4NBDA 2HADA 3BQMB 4H6PA 2PR7A 3ESXA 1J2TA 4GM1A 2RAUA 5EP1A 4B8WA 4EF4A 4JP8A 1FDRA 2XIQA 1TYDE 5I3ZA 3Q8MA 1VCIA 1E7YA 1KKLA 1C1DA 1KGDA 1KZ9A 1NR7A 2C4KA 2QG9A 4FN5A 2I54A 2FCAA 5FOVA 3P96A 3ZTTA 3V1YA 3CSSA 4B3BA 5JWRA 3SMVA 2VK1A 2WJ6A 3UFXB 2A78A 1YKGA 2XHZA 3BCCE 3I6ZA 4BQPA 1YF3A 4BKUA 3HBAA 3KAKA 2ZTMA 1E6KA 1S2GA 2IEZA 1HFKA 3GW8A 4IXWA 3T99A 3X43A 2SPZA 2B2NA 3U60B 5KNCD 3PEEA 1K3TA 4B2YA 2IV7A 4LOLA 5IVPA 3O2NA 2X7XA 1K92A 2CCKA 2BIFA 1EXNA 1MDBA 1XEWY 1Z38A 2PWBA 4IFFA 2Y9ZA 3RVRA 2OQRA 1OYOA 3UXHA 1TPZA 4KHPB 1QE0A 3A37A 4RGQA 2FYUJ 3J7A4 1CY2A 1KS9A 2NV6A 1HE3A 1VYHA 3EXEA 5JMPA 3NTXA 3BMNB 1QVGZ 4PPGA 3M9XA 5F7ZA 4H1VA 1P5RA 3LX5A 4ZVQA 5C35A 3RWMB 1X0TA 3P7KA 1FZQA 2ZIWB 4H08A 2WKPA 3BDAA 4BMNA 1U63A 3VV3A 1HWYA 1YULA 3TZCA 3ZDYB 2NVOA 1CDZA 2PN1A 2O1KA 4Q34A 3ZWVA 3G71P 1XP8A 5IN4A 3IEIA 4FU0A 4ZPXA 4IWNA 4X3OA 3WVNA 3OJFA 2DKFA 1DBVO 3I2FA 1FZAA 3PKZA 2P8JA 4NJMB 1N25A 1M1XB 2PS9A 1M2HA 4MR8A 1BVUA 1UINA 2ILVA 1XALA 3OE7A 2Y6VA 4KDIA 4G0NA 1YJW1 4U6QA 4EFMA 4ER3A 1B6RA 1YB1A 5HQTA 3VGPA 3E9YA 1GT6A 1Q21A 1RWOA 2QG6A 2RKOA 3FUVA 4Z9FA 5FTJA 3WG9A 1CUCA 2LXNA 1T2DA 3I55P 1WXEA 1XC7A 3LW5H 2GX6A 2ZJ0A 3UAGA 4LC9A 1G19A 3D3JA 1UP7A 3M70A 1F1BA 3A3KA 3TOSA 1N2IA 1O4VA 5AJWA 5T57A 1E6EA 1QTRA 3GP3A 1DDIA 4OXXA 5A62A 2F8LA 1J39A 2FW6A 4FZRA 4BO1A 4JI0B 1A5ZA 4QXPA 3A4YA 2BGKA 4JFAA 4G0OA 2JG3A 3RVDA 1N73A 1BAPA 1BXGB 1CF9A 3RZDI 1DP4A 3QA9A 3WGTA 4D9JA 3R09A 4RFSB 1XELA 1Z6TA 4KDLA 2WVAA 2A1UA 4PPYA 2Q7OE 5H2FH 1G1AA 4KNYA 3FB1A 1XEXB 1XYVA 1XMVA 3PGJA 3WTBA 1ZCBA 2R3SA 3RIEA 3VA7A 3D8RA 1J1IA 3VU3A 3LM8A 1FJPA 1CSEE 3I6QA 3A9WA 3HWWA 5C53B 5KX5F 1XZQA 1EGAA 2FF7A 3B1FA 2GZHA 1BCSB 1II8B 1GFWA 1TWHA 1RHUA 4NCKA 3CURA 1L0LG 1U3WA 1I1OA 1W59A 5LU9A 4DXAA 5KPDA 3N3AC 2AKLA 1MB2A 3D0RA 1Z2DA 1GGVA 4RVNA 4X65B 3I2IA 2D5BA 4HDQB 1AD2A 1MGOA 1SVFA 2R5NA 4JUAA 2WYVA 4L9RA 3EPKA 1KAQA 1V11A 1JWHC 2DWOA 4AT1A 1YJWP 3R4YA 1LNSA 1U99A 2HWXA 3B12A 4HLNA 4KXQA 2G9VA 2HREA 4ANFA 2C7VA 3QUBA 3CXUA 4MHSA 3W3ZB 5CB4B 5EGNA 1KYOE 5AVUB 2AMYA 2VHQA 3HBMA 5JMWA 5D84A 1JCCA 5I7UA 4UJ5A 3MINA 1J20A 3A1EA 3OPVA 4C05A 5HKKA 1MORA 4PJ0E 1Y5LA 2P2YA 1PJ4A 1I9GA 2JVKA 3RQIA 2JGFA 4BNHA 1Q57A 3FJOA 3GROA 1SUDA 3L7KA 2KSQA 3TE5B 2OCPA 2Z9DA 1SQBJ 1MKYA 1J7JA 1OX4B 4OX9B 2JKYA 3TPZA 2ZBUA 3DOFA 3H4IA 1U02A 5CCGA 3OFJA 4BRSA 1EVEA 4J43A 4EJ6A 1YDGA 2C7BA 2E48A 4YBZA 4EUKA 1J07A 4UTVA 1LPNA 1U7UA 1A8UA 2G9UA 4AJNA 4HUQA 2OAP1 3E9QA 3GUUA 2IX9A 2TECE 3A6ZA 2LDXA 3K1YA 4MPRA 2PH3A 4QWMA 1E2NA 1ODIA 4LZNA 1X7WB 2WYWA 1V5IA 2EJVA 4G1EB 1CEYA 3TWOA 1IN6A 4DF3A 2UVPA 1H2BA 1I5OA 3L0SA 5THKA 5IYZB 1PQFA 3KKNA 3OZUA 3GLHB 2WNIA 3C7AA 2N1TD 1L9XA 3LOQA 4Y2GA 4H3VA 1NXVA 4B6FA 5BSHA 2DQSA 1D4FA 1JV2B 4R1OA 5HBGA 4KUEA 3M3YI 1E9CA 4GOOD 3WKCA 2GM3A 4RKUJ 2GCGA 4YGXB 2OYHB 1MX1A 1TQDA 3MD0A 2WR8A 3DBLB 4IDOA 1JHOA 1QE5A 1KJNA 3CF0A 3CINA 3RFUA 3E15A 1GKIA 3A3YA 4J7UA 3U7JA 3VMXA 3P5JB 1W5FA 2O2IA 3MC1A 4J1QA 2VAMA 3BFXA 2VDMB 4PC2A 3RC8A 1EJBA 1O08A 1AO0A 3T4NB 3CKLA 3VJRA 1G18A 1F0KA 1SVKA 2UYQA 3Q11A 4DE5A 3AECC 3RGUA 3EBPA 2O8CA 1TC1A 1X3SA 4DPMA 2AN1A 4YMWA 5JO0A 1G6Q1 4BZQA 2ZQ5A 4EKNB 5J2TF 2AUTA 1R74A 1L7OA 3O8DA 3C7KA 1UKEA 1YNJD 1EGHA 4CTMA 1KEEB 1X8KA 2HIMA 3K7EA 1QFYA 5DCYA 1POWA 4P84A 3L70D 3D9QX 5IKEA 3PLAE 1VF5B 2B21A 2ZB2A 3T3PB 2O2DA 1OXVA 3IQWA 1KQ3A 1L6IA 3D31A 4QHYA 3W5IA 1UDCA 1VQP1 3RFFA 2X2FA 4AZSA 1JB9A 1ZXXA 3K0AB 4RPGA 4YIKA 2YFKA 3GD5A 1Q83A 4BOYA 4C5BA 2Q3LA 4NBSA 4JU8A 5DI3A 2ZDHA 5C4MA 2M0BA 3RNOA 2IW1A 5FX2A 2Y66A 3NIGB 4XCQA 5EXEA 3L72D 2HQOA 1ZFNA 1X86B 2J33A 2XA2A 4IICA 2Y1KA 4AS2A 5BUSA 2Z6QA 4A23A 4HH3C 1I2MA 2IZ6A 2VTKA 3L74D 1LW6E 3FG9A 3SSNA 4AMYA 4DDKA 1MV8A 1DCKA 5FEUA 1KILA 4LJLA 3A1TA 1T0HB 4NE7A 3IHLA 3AX6A 3F78A 5CDSA 1A4UA 4IGKA 1VG0B 1ENYA 3QPAA 1IMJA 1X7ZB 1Z08A 4LV5B 2P2NA 2VNKA 3AETB 2VPPA 5DK4A 4IF6A 3EVEA 2QTGA 3ABQB 2OSBA 3LXRA 5FR2A 3TKLA 2EGTA 5IM4F 1NA5A 2NPSC 5FTNA 4BP9A 1U2GC 1UBRS 4IAOA 3H6PA 2R6AA 1CJCA 2QRVB 3AIOA 3TTSA 2FZKA 1JFTA 3GLFA 1ZWKA 3GDWA 3KEQA 4FSXA 3W3AH 3LO8A 5DXFA 4AS1A 4RVCA 2PU5A 3AKEA 1MTOA 3NT4A 3BMQA 5HKLA 2ZU0C 1J9ZA 1SQXD 2JD2A 5D1OB 3GPIA 3S7TA 1RYBA 1SU6A 2FCRA 2GRUA 2PWPA 2H1VA 3AT1A 3HCDA 1LBTA 1A2BA 2XKBA 3M0EA 4RF5A 3W78A 3GMIA 4TRRA 4AJ4A 1FDVA 2FYUE 1TKRA 2Z2JA 4R9NA 5ICSA 3IO5A 4FYWA 3VHXA 3JQFA 1VG9B 3ONNA 1V6SA 3AHEA 4OQEA 5AVJA 3F73A 1P0IA 1BVHA 5HE9A 2NZXA 3TUIC 1DIAA 3MZ0A 4D9CA 4C7RA 1GGMA 4IX1A 4D9MA 3W5AA 2ZJYA 2JA5A 3VPBA 3DEAA 4RVFA 1JWLA 5CAEB 3R3VA 4NY1A 2D4HA 4UD2A 3FHLA 4HBGA 4N76A 1CP2A 2WFLB 3O0TA 4YRRA 3QM1A 1ZBDA 2Q07A 3ETHA 4GDOA 3A9SA 2V98A 3NDIA 3CNOA 4NYIR 5A9TA 2PZKA 5EJEA 4HR7A 1E3JA 1YKFA 2FETA 5F21A 3R7AA 3C3DA 1ZJ5A 4DW8A 4HN9A 4WKCA 3AF6A 2E37A 2H51A 1ZC3A 2WMYA 1GR1A 1HZJA 2OFOA 2XNJA 1XRNA 3CGWA 2C95A 3HV0A 4B7ZA 2CYCA 5AK5A 4A1FA 4OYRA 1HQCA 1P31A 5DNCA 1GU4A 1YUBA 5FBKA 1T5TA 4CV2A 3TNUA 1D1SA 4N39A 4U1RA 4G5YA 4ZQEA 3BWEA 3G7UA 4AKTA 5I8WA 1SCNE 4DR5B 4EHJA 5GTIH 3JQCA 1HKHA 3LGSA 1P19A 1Q0RA 3DZ8A 3N74A 2Y1DA 5AKJA 2B9EA 1VL2A 3X1JA 1PK9A 2QPTA 2PWZA 2F17A 5LC1A 5FPKA 1P45A 1ZK2A 2H4YA 4G6ZA 3H5WA 1K8XB 4RXTA 4XUEA 4HVTA 3Q2KA 4PC7A 3O9ZA 4E07A 3UJPA 3P26A 3S68A 1NQAO 1V1JA 2WG0A 3DP7A 3IC5A 3KFVA 4D4GA 2KPIA 2I80A 1PFWA 3TW0A 1U8YA 1R4AA 4M55A 3H87A 5FQNA 1M66A 2CFSA 2ZZKA 4CN9A 5CDFA 1WCMA 3EEQA 5G0SA 4NZNA 3WE7A 2PTGA 3IDFA 3QEJA 4MICA 3VJMA 1E2BA 1JALA 2HHHB 1MEOA 3BPSA 4UBMA 1N2JA 1E1KA 1JUDA 5REQB 5TVKA 1O8BA 4JJIA 2REBA 5BNFA 2QDXA 3LJKA 4TXMA 3TIIA 1VJGA 5LMNB 1FLVA 3KV3O 2EFHB 3GLFB 1CEEA 1XXHA 1GFSA 3L7NA 2WKWA 3EXFB 3MG9A 3NHRA 4P4SA 1L7NA 2XQIA 5AFSA 1T9AA 4K9PA 1RWNA 5B5EH 2JIOA 1AK2A 2XQGA 1M5TA 4CEIB 3DP9A 1CUGA 3GJYA 2DBRA 4CS0A 1PG2A 3VAYA 3D3NA 2WAOA 4CXMA 4UNPA 2WUFA 4Q03A 1O95D 4YR7A 2AEFA 5E3HA 2PL1A 1LWOA 3EMVA 3BWDD 4A3FI 4KV7A 5H7XA 2IPMA 1QIFA 2G1KA 1J6UA 3DV0B 1QLED 1U0LA 5DM2A 1SAYA 2EZUA 5TS2A 2I67A 5ALKA 1XJWA 3EOZA 4I8IA 4WWIA 3KYCA 4M0UA 1YZYA 2OPHA 3OPXA 1BMFA 3IJPA 3CR8A 3B1WA 3I9LA 3Q6MA 4J0IA 1UP4A 4M60A 1RXWA 1NW8A 2AMLA 1G6KA 3RJ5A 4UAUA 3ZHQA 1YCGA 3ZW7A 3HE5A 2FN8A 4C22A 2XDWA 1HORA 5BUZA 3AM5A 4HOYA 5C4GB 1T91A 1L0LJ 1T5HX 2IXEA 3ONFA 5LMCA 1OXUA 2FSSA 1G3UA 1TJPB 3QE0A 3BCCJ 3ZWMA 3GO4A 1ORTA 3VNUA 3P0HA 3DT9A 3WGYA 5APWA 4RJTA 1CK4A 2QQ5A 2WAXA 3A6FA 4RMNA 2BTQB 4GHWA 3J7AC 5DLDA 3BRWA 1SR8A 1V5WA 1IXRC 1MDFA 1DAPA 2HDNB 4PAMA 1GQSA 4Z1MA 3ZZ1A 1I2DA 3V48A 2H1RA 1NQOA 4XX0B 4PV1C 3K92A 3MGGA 1JSXA 3I05A 5EFOA 4JROA 2AS0A 1KQNA 1LDNA 1SOUA 5LP6C 4C6RA 4I4IA 5FV7A 4D6TJ 2BE5D 3ZHTA 1OHHD 3INRA 1K732 4IUBS 5AVKA 1L8LA 3BRQA 4KGDA 1LI5A 2XE6A 3N05A 4Q16A 2HWKA 2I4OA 3ND7A 4P83A 2BR5A 4AP5A 5BMOA 5C8DA 1YJQA 1NF9A 4D92A 1DJPA 4IDFA 5B36A 4NG5A 4CEHB 2XTZA 5I7VA 1TUBB 2GPTA 2QVZX 3L0CA 4RIIA 1U3GA 5CVJA 4JXJA 2Q5EA 3A6KA 3AP1A 4UZSA 3ABVC 3H1PA 1EX6A 1QGAA 3LC7O 4C5AA 2VA8A 4NJEA 3TG2A 1VMEA 3NO4A 4GPBA 3P2MA 5C31A 1UZLA 3EE6A 3TZHA 2R62A 1TRHA 5ALUA 4LGMA 2OORA 4N01A 4R81A 5TGTA 2CN1A 3NORA 2V6GA 2NXJA 4P33A 1ZB8A 5BORA 3HJRA 1VLHA 1NMSA 1ZEMA 2Q8PA 4IH1A 1NU6A 1P1IA 1I6WA 1ZHHA 3LBNA 2XB4A 4RM3A 4UAGA 5CYFA 5C3UA 2PS0A 5TC4A 1ADJA 3KQHA 1SQXG 3QWBA 1CRQA 2PV7A 2GCIA 2P35A 3GUHA 3KTOA 4O2BB 4QARA 4TWAA 4DQKA 1CSBA 1J2YA 5JDCC 2HA2A 2I6XA 2G67A 2IYZA 4MKXA 4QFDA 3ZCTA 3QQ7A 4L4ZA 4KPFC 1KILD 5C8VA 4C01A 1Y6JA 3K8OE 3KVVA 5BPHA 3T1YB 2GBGA 5CA1F 1J97A 5JYDA 3M9BA 2AR0A 2DBVO 4RGYA 2WQ6A 5I5GA 4I46A 3H0GI 4TL9A 1XTCC 3UVEA 1X92A 2X8AA 3C1LA 4KACA 4MA4A 4ZI7A 3AEKA 4KRYA 4ZMSA 2WSSA 4NZ9A 1UP6A 4L85A 5I9IA 3OIGA 5J40A 2F55A 5C7IO 1J0BA 1G5RA 3H4VA 5JNSA 5TMEA 3ACDA 4RXUA 1OXXK 3LW8A 3U56A 3MS7A 3JATB 4D3FA 5A5DA 1FMLA 3AZQA 2XB9A 4XPIA 5U4QA 3ZD8A 4HJRA 3TF5A 2R87A 1FFGA 3FVTA 4RBNA 1T5OA 2YWGA 3EFBA 1KQOA 1T29A 4TN1A 4AF6A 3GAAA 1ACJA 1BW9B 1EESA 1ADCA 4G1MB 1GDDA 1ZN2A 4ZYLA 4LJ8A 1MJ5A 1QK3A 3OJEA 3TN7A 4ETWA 4LMBA 2A0KA 5DH9A 1RIIA 2WM3A 4IOMA 3WLJA 4E70A 4X61A 2V8OA 1ESZA 3QLTA 3SXJA 4FGUA 3DLTA 4G2NA 1NRWA 1CQXA 1BRMA 1I3LA 2C8VA 3DZCA 4U3FE 3WRWA 3O03A 4AMVA 1FS5A 1GV0A 1XLUA 4NFLA 3H1JJ 1QFXA 5ITZA 4BVAA 3UGTA 3EIEA 4LI0A 4GPAA 2G4VA 1VXOA 1E20A 1R8JA 1QORA 2NACA 3V4RA 1YJ8A 3CC21 1GCUA 3A3NA 4X20A 1WEHA 3T0FA 4BRUA 1SUEA 1IN5A 1VGVA 2O48X 4DNXA 2E75B 1SXJC 2ZIEA 3AL2A 4X3CA 2BFDB 5D6OA 1XTQA 1V5EA 1C0IA 3BHMA 4MCAA 1VL1A 5LL6P 2DQ4A 1OX3A 2YV5A 4Y2UA 3RHFA 3DM5A 3WYBA 4Q7JB 1SK8A 4P34A 4MB6A 2QJPB 5DSZA 2H0RA 2I78A 1KO1A 2I2BA 4KHZA 4Q3NA 5JECA 3K15A 1PDOA 1Y1LA 4QJ4A 4JOBA 3AF1A 2J41A 5DTRA 4BEJA 4QNMA 4DWJA 1QLWA 5ECDA 3JARA 5FTMA 5EKXA 1OC4A 3TPFA 2WSEJ 5LCXA 1DRVA 3ZLJA 2X9LA 4B6RA 3OQMA 2E49A 4B76A 1WXQA 2CBXA 1N0UA 4KFCA 2LXCB 4V1CB 4L74A 2YJNA 1USGA 4H6WA 4PO9A 2ZSJA 4W9NA 1M3SA 2PT9A 3VKVA 4UOZA 4ZVUA 1U9IC 2C88A 1LRJA 4QQKA 1FU4A 2XI4A 2CNWA 3JR3A 1XRJA 2PQ2A 1O1YA 3CUYA 5FLXb 3P94A 4JVNA 2I2WA 1NVEA 3ZU4A 1WCXA 4M9CA 4M9SA 1XOIA 1M2VB 2OCIA 2X7HA 3JD0A 2YHUA 4UM9D 3WYDA 1JM0A 3R9KA 3PFBA 1F2VA 1GQRA 1OI3A 1HUCA 3L1UA 3A27A 3LC1O 3R8CA 5E9WA 3RG2A 4EEKA 4MVCA 2G0AA 2VHCA 3K1ZA 4EVIA 3GLIE 1D2EA 4ZOLB 4FNAA 1Y47A 3G4SP 1DKQA 1DQZA 1W4ZA 3PIDA 4UHDA 2HRCA 3TJMA 2YCLA 1TWGA 1PWHA 2ZIVB 2ERXA 1C9NA 2MYUA 2ZDGA 4ZVLA 5ICFA 3CC71 4EI8A 3A26A 5EA2A 1AKUA 1FLAA 5CM2M 1H8HD 4JUDX 3EK2A 3U31A 2EATA 4YX9A 4M37A 5JI3E 5JJCA 3W5UA 4W5HA 1X8LA 2CFTA 3ROTA 1G8FA 3KCNA 3D8UA 2XMRA 4KJZA 3L0IB 3VYVA 1P4SA 2UDPA 3TNLA 3N2GB 5LUBA 2CMGA 2O5CA 5LQNA 4I2NA 2XNDD 5JSYA 3CIFA 2F3SA 3T4EA 1NBIA 4A0QA 4I4TB 2A5LA 4GX5A 1I3CA 4A82A 2KLUA 1XEWX 2PO5A 3KOOA 2YWRA 3W4KA 1N7SA 4C4RA 5A03A 4JXZA 3ROKA 5J4KA 4I50B 3GPCA 4DJJA 1LVUA 3C8VA 1JB1A 2FPWA 4OQPA 1YR2A 2GQ0A 4KC0A 5HZGA 2R79A 2CJFA 5A1TA 1UBTS 5GIOE 3IAM1 4JI4B 3ILYA 3L70J 4HDRA 4KFRA 3ZCUA 1M67A 2O52A 4GOJA 3A2AA 1KSGA 3SF8A 4YMTA 7ABPA 4B6PA 3H9GA 1HA3A 4X90A 1AN9A 1JHQA 2BSAA 4H7IA 3GXBA 2DY1A 5BOSA 1J09A 4ZM7A 1CB7A 1HGXA 4R8VA 3KJIA 2CK3D 4RV0A 4Y2RA 1BWRA 3E1SA 2QR1B 1VQO1 1UJ6A 3CPJB 3M1AA 4PC6A 5FYDA 4RLFA 5H4GA 1S72P 1UXJA 2HIHA 4U5QA 3RU7A 2AJ8A 3GWZA 2NMVA 3LTNC 4Q93A 4FEEA 2VDNB 3AI1A 2OYIB 2WNSA 1ZH4A 3PNLA 1EM8A 3FI9A 3ZDBA 1O89A 4Y2JA 3HWX1 3OOEA 4JXXA 1J2UA 3HN7A 2B2XA 3HG7A 4R2XA 3SKVA 5C7YA 4W80A 1CRPA 1P3Y1 1PVDA 4XZ3A 2EBFX 2I3ZA 4CKYA 1RZ3A 3X0DA 1I6HI 5CXUA 1TD9A 2C9CA 3T52A 4B3GA 4DILA 4UUQA 3GRRA 4QXQA 5DHRA 1EE2A 3GN1A 2IEIA 2X19A 3KR9A 4M0LA 5AVTA 3IN6A 4E2WA 4JEIA 2OLJA 2NVWA 3I5AA 4H77A 1FFSA 1Z03A 3G2LA 1RYDA 3O26A 2P40A 3AJRA 4HWPA 4KO3S 4H0CA 3T7CA 3TLJA 3NH4A 1EVLA 1NQUA 1HO3A 1WXDA 3V3TA 1Y1VS 3U9LA 1RQRA 3PNBA 2DE6A 1D0SA 4IJ6A 3A05A 3U3XA 4EA7A 1R0YA 2G3YA 4PLFA 4EJSB 3GLHE 3KSRA 1XKLA 4MUNA 5BN5A 4UPDA 3Q87A 2QX8A 3MLBA 3MT0A 4X91A 4C4TA 3VOSA 4WZAB 3EFEA 1SIWA 1A5BB 2ZAIA 2VP3A 2IBZI 2J3EA 1OVUA 1ISMA 1P4AA 2ZM6B 4QWWA 2YMYA 4EHIA 4YUAA 1QYCA 1UBKS 1FSPA 4PAWA 3R5HA 2NU8B 4OFXA 4B45A 2AE2A 2IIPA 1KMNA 1PNOA 1YS4A 1YUNA 4I1LA 1RNLA 2CLIB 1NKTA 3BGDA 3O82A 4BO0A 2J0UA 3KB2A 2QRJA 2N75A 2FWBA 2ZIUB 3GY0A 3K72B 3KPEA 4C21A 1W36D 1SUAA 2GJ9A 3MLEA 3CCVZ 4P4LA 1Y37A 2ZWPA 3RLIA 2YKOA 4XOUA 2XMCA 2QZPA 1FNDA 3WI7A 1R8SA 3H2IA 3L3BA 2FSFA 1C80A 4A2QA 3N28A 4H13B 1U5BB 3ABSB 2DWPA 1JN0A 4RF3A 4YP9A 1YHZA 2IHBA 2RHGB 5T3YA 2JLSA 2YHAA 3A4IA 1F3OA 5ARDA 1Z0KA 3DL0A 1FUIA 3GKQA 1S9KD 4P31A 1NFFA 3NNNA 4HS4A 4WMLA 1QG0A 3ZNPA 5BV8A 4QJ3A 1WBBA 2BSQA 2X1MA 2OG2A 2BCCG 3K0FB 1IQ0A 2WZ7A 3HMQA 3LDHA 1XLTA 3OLQA 1JLRA 4IJVA 4KX3A 5DTEA 3X1KA 1NQXA 1DXHA 3S4YA 2OMKA 2FQXA 4UDYX 4A5OA 3D4IA 5CD1A 3JQEA 3R5SA 1YA6A 1DD4A 4PSUA 1GGJA 1G21A 1QS0A 2ACEA 1KAGA 4N8SA 4OQLA 4CKBB 1KD11 4QUIA 1L4EA 4OI0A 3RT7A 1Q86Q 3CF2A 5LIRA 4G0ZA 2B87B 5FWDA 3PO3I 1SRRA 1PT9A 5T41A 1FC0A 3G2NA 3A36A 4EG1A 1ZRTE 5L53A 2OUIA 2LPMA 1JIXA 4RA6A 4BTLA 1JVSA 3ZWCA 4YT2A 5B30A 1A4XA 3C3PA 2CLDX 1P17A 5CU7A 4Z3OA 2JBAB 1WD7A 1F8FA 2IODA 1JT2A 4TYMA 2H1SA 5FUBA 3UQZA 1ZVVA 5AI0A 1ZH1A 1UPAA 4F12A 3M0AA 2INGX 2O7SA 4LWOA 2B8JA 2FDCA 1QO0A 2VF4X 1G7CA 3OPYA 2FVYA 1E2FA 3DKVA 4IV0A 4GKBA 3DS8A 1O58A 1ZAKA 4B3DA 3C4JA 3MCAA 3HABA 3GTKA 2FXOA 4AWXA 4EKGA 3V5BA 4MDHA 3EZFA 3HMKA 3TCNA 3EPLA 3R4VA 2FZCA 1GTVA 3H1KE 1XSEA 4EHDA 2VDUE 1K8QA 2ZIZA 3N58A 1W0KA 2RHJA 4E30A 4IVRA 3G6KA 5JBNA 1KY4A 3CCCA 5AW1B 3PQ6A 3LQYA 1K7CA 4HYYA 3QBEA 3SC2B 3H5OA 4TXHA 5BMVF 5BNIA 1UZMA 4M1EA 1QE3A 3VPXA 2HHLA 4UQLA 3HE4B 2Y1XA 3FSEA 4WOKA 1CW2B 2IIBA 2G25A 4FGKA 4UBNA 3M6WA 4X5OA 3TIWA 1R88A 2OXCA 3UANA 4FCCA 1RYMA 2XVYA 3QKSA 4IQ8A 1ZJZA 1ZGZA 3IH5A 4DIUA 3CNNA 1GPNA 5KTYA 1VIYA 1RQ2A 4YIHA 3F2IA 2BM9A 3BREA 3HL4A 4KOAA 4QU9A 4D41A 3QY0A 3TX6A 4TSFA 5FPTA 3NANA 2J6HA 3QFCA 1TTPB 1VJCA 1W96A 3D59A 1RMTA 2OCGA 1BE3D 1XZPA 3DDHA 3EGOA 3HBNA 5KWEA 3H75A 1P4RA 4IL6E 2D7JA 1N8R1 1A9TA 3CCS1 2ZAGA 4ZGGA 3HQ4O 3TD9A 1NHGA 3I1JA 2C7GA 2ZUEA 2NSDA 1BHJA 2GNPA 1DG9A 3BZWA 3J7TA 3JSVC 1TZKA 2RIRA 1UBEA 2QL9A 2HFKA 4FZ3A 3EVNA 1OXBB 3EVAA 2QHXA 2KXPB 4OGKA 4EG3A 4ZU1X 1QHGA 3T7AA 2E76B 3WK7A 1NGSA 4ENUA 3PO2I 3QKRB 2WKQA 5EPEA 3GRVA 4EHAA 2ZB3A 3WWEA 3AY3A 4WCFB 1QQ6A 1BKYA 1QPGA 1XA3A 4YAEA 4DA9A 2HLPA 1VQKZ 3BXGA 1IK7A 1MB4A 2LKDA 1HDIA 3AK4A 3PHGA 4R5MA 4R2IA 2JAPA 3RTEA 3GVPA 4UATA 2H9AA 4C76A 4M3NA 1G8JA 1M1YB 2OWEA 4BV2A 3FJ1A 1JMKC 1SG6A 2GZ3A 3QYJA 2QJYB 3H65A 3G2MA 1MFZA 1JDBB 5B7PA 3LPDA 1MUUA 4DB4A 4LTDA 3MRXA 2Y6UA 1S8AA 3RPEA 1YD7A 2O59A 3V1KA 1E0KA 5KJCA 5G2OA 4Z7QB 2WJ3A 1KB9I 2Q2OA 4L8WB 4FHGA 4YR9A 3C24A 1FMFA 1XCJA 4IR7A 1EB8A 1B0AA 4V03A 3STTA 3OURA 4BYMA 7GPBA 1DGQA 3PWSA 2M6LA 2I1QA 2CSXA 5ITVA 4DQXA 1YJ9P 3COPA 2AQHA 1E5DA 3VSDA 4CKXA 1IJBA 5JISA 3F2VA 1ABBA 1VECA 4OHFA 2EZ4A 3SFEC 3GFPA 5DLQC 2PKWA 4BGVA 1ADFA 3HU3A 1Z7BA 3IMFA 1MC8A 3PC3A 4AUNA 4B3HA 1E6CA 5T64A 3ICPA 4TXNA 3Q8LA 3FIJA 3UJ9A 5LWHA 1H05A 4M8IA 2ZE5A 2BI7A 3QHPA 3SF8B 4EJ2A 5EIXA 3NYRA 3OZCA 3ONVA 1H9CA 1QHHB 4PZ9A 1LTAC 2ZUCA 4AJLA 2FWJA 1IDOA 1AXEA 2RHHA 1RQ7A 2YVKA 4UEQA 4X00A 4BNTA 2DTEA 4DOMA 4ZCTA 2X0JA 1V16B 1CUAA 3DMGA 4G89A 4GD3Q 3SZMA 1XJCA 3MHPA 5IYZF 3M6AA 1ABEA 2OYSA 2R7MA 1AQYA 5IDYA 2WPDA 4J9UE 3IUYA 4MKRA 4Q1FA 2A9VA 4NDNE 4TZTA 3TLCA 2CXNA 4AMZA 4KO8A 1NTZK 3IXMA 1QGED 3BDIA 4RD1A 2AYXA 2F1KA 3BB1A 5JVDF 4YRMA 1I4LD 3R6GA 2NPSB 3UHPA 5K8JB 3WK5A 3EF0A 3TFOA 1Y9ZA 2MSDB 2CMKA 3N75A 4WLFA 2GEDA 4YECA 1EDLA 4OKSA 3WJ2A 3Q5SA 1YBAA 2PX2A 3OI7A 3RSOA 3GD7A 3F4KA 4D02A 5BSEA 5LQCA 4DR2B 4MR7A 5L45A 1G1IA 1TM1E 4X6LA 4Z1MD 1AZLA 4H7KA 2D5AA 2P65A 3WWOA 4B9EA 1QIJA 3JVVA 4UVHA 4EZEA 3EXIA 2QT1A 2J7KA 9MHTA 5GTDA 1Y1PA 1N2FA 1GTJ1 1M34B 4RIEA 5CXSA 3U49A 3PT5A 3NHBA 1ISFA 2GUSA 3W2IA 4YPVA 3U7HB 4ZT3A 2ZVJA 3VYTB 4AO8A 2CFIA 4RK1A 4YMHA 1G6OA 1HT0A 4MWGA 3OTOB 4KREA 4AIIA 5ARBA 3V80A 2PY6A 3FNRA 3EH1A 1BW9A 3MVEA 4OF4A 5GV7A 2C3OA 3QBTA 2VTEA 3EFOB 3C6YA 4GG1A 2CDNA 2QKDA 1SHTX 2H4XA 4C6TA 3WAJA 1HX7A 5AVYB 1IZZA 1W5EA 5BOVA 3FWZA 2V7QJ 1NWHA 4DIEA 3DYBA 3ETLA 1RNIA 2Q6LA 4ZCMA 4X95A 3OAKA 2W98A 1JFVA 2DUJA 4NL4H 2VHZA 3WL3A 4XB6B 3AHJA 3GLRA 3KAPA 4JY7A 5B6IA 1AQLA 3R9XA 1QYRA 3VMHA 1KAHA 3BD8A 3PGMA 1L0NK 1Y1WA 1NVMB 3C1OA 3OIUA 4HNQA 1ECCA 3AEDC 2O5JD 4U2EA 4A0GA 3IF4A 3ZR4B 2H4FA 1IFNA 1NMXA 1G8YA 4AFNA 4YUYA 1T8TA 2JIRA 1YJWZ 1M6WA 2YIUC 1BIFA 1NP3A 1FNMA 2GPWA 4JK3A 3B36A 3SHQA 1URQA 1A9PA 3FZYA 4U2GA 4CR6A 1KTVA 3V8MA 1QMGA 4DDVA 3ZI7A 4OSOA 4IL5A 3PUWA 5BUQA 1VL6A 1JFFB 2XCQA 1M7LA 4A3CI 3PQCA 1B0UA 3QFFA 3WNVA 4ARIA 2NXNA 1JWBB 2AYYA 4ZEWA 5JAIA 2YKGA 4DLWA 2JKVA 4QUJA 2JK0A 2W2KA 1PD1A 2JHAA 2KM1A 4Q4CA 1Z6YA 4EPTA 1WP4A 1DFHA 1Y3FE 2IBTA 5IKXA 2NYVA 4ALMA 2NUTA 4ZI7F 3OEYA 1A1SA 4ENSA 5D6NA 3ZY2A 4HH4A 4HFNA 4D8VA 3IP9A 4G4IA 1WY5A 2B3TA 4RWEA 4EG7A 3NOXA 4ZK2A 4YUVA 3K73O 3G2OA 4L5BA 1GK4A 4WLVA 1EZVD 2JCVA 3PKJA 1J7KA 1EYZA 3I83A 5AH0A 3T1HB 2SNIE 2UUOA 1PG5A 2V7QA 1MLDA 1N92A 2Q7CA 3LP6A 3TGWA 4JHLA 3AE6C 3A9CA 5IG2A 2GBLA 1M1JB 4ID3A 2XUAA 3DUWA 2PGAA 1F12A 2XKAA 1J2JB 4RMIA 3HSYA 4C7MA 1H85A 5CW2A 1RBMA 2FFQA 1M8PA 4R7TA 4UHCA 2JBAA 4UVEA 3WC4A 4A26A 4C0XA 3NGLA 3ZJ5A 1NVVR 1U8FO 3CKYA 4EGCB 2X2OA 2JS4A 5FB3A 4B6QA 2IT1A 1DRKA 4EDFA 5DBIA 1L8OA 1PR0A 5LYJF 1PZMA 2P6MA 1C4OA 4B5LA 3L6CA 1QRRA 4O08A 3ZD7A 3IP3A 4NZPA 3WL8A 5AW6A 5FQOA 1ORWA 4O4HB 2BCJQ 4R9UC 4JBWA 1RJEA 4D9KA 1DEAA 4PSAA 1CE8A 1LY1A 3PC6A 4B74A 3DG9A 1T43A 5F52A 1Q77A 4JP1A 4UB6E 3EMBA 5HG0A 3FTEA 4JELA 1H4SA 3GJ6A 4CLOA 4IIJB 3L1HA 4MVJH 5DF1A 3L70E 4QOHA 4DV2B 3OQOA 3FCYA 1NX9A 3H5TA 4PU0A 4DLVA 3G0OA 4JJZA 2KZJA 4G26A 1UMKA 1LLUA 1TPYA 3LPLA 3NBXX 3I62A 4OHMA 4O2BA 1Y9DA 2IY9A 3HKBA 1C7EA