1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
1OGYA 2NAPA 5T5MD 5FTMA 2R7ZA 4GA6A 3O6QA 5FTKA 5T5ID 1PYQA 1I3QA 3GTQA 5GLFA 1FDIA 5DYGA 1SIWA 3O5AA 3QQ7A 1OMIA 2JIMA 4CRYG 2VPYA 1PT1A 1Y5IA 2JA6A 3DMRA 4AZDA 1ZMEC 1Q16A 2E2HA 3GTGA 4DMRA 1CZ5A 2V3VA 3HKZA 1WLFA 5FTLA 2JIQA 2P10A 3QC8A 3QQ8A 4QIWA 3GTKA 2EEOB 2NYAA 2KI8A 2R93A 1KQGA 2B63A 3FKIA 4KODA 1DMRA 1TWGA 4D7ZB 1UHEA 5EPPA 5FTNA 1AW8B 2E7ZA 3TIWA 3ML1A 5DYIA 1TMOA 1EU1A 2NVXA 2PJHB 2E2IA 4CRZA 1K83A 2PMZA 3H25A 2JA7A 1WMKA 3HU2A 4KLNA 1R27A 1E5VA 2Y0SA 5C1BA 2JIPA 1PQFA 2WB1A 1TWFA 1Y4ZA 2C45A 1R9TA 1AA6A 5C18A 3GTOA 1Y1WA 3GTPA 2V45A 4AONB 4KDIA 1PYUB 1S3SA 1TWAA 1KQFA 2YU9A 3TM7B 3OUGA 2R92A 1E60A 1WCMA 3EWKA 1PQHA 1Y1VA 3QWZA 1QDNA 5B6CA 2DMRA 1E32A 4KDLA 1PT0A 2VUMA 1IW7D 3CQZA 3IR6A 3IR5A 1UHDA 1R7RA 1TWCA 3IN6A 1PPYA 1TWHA 3H0GA 1H0HA 3CF2A 4AOKB 1E18A 2IV2X 3GTLA 1DMSA 3IR7A 1G8KA 4RV0A 1E61A 1CZ4A 5FTJA 3PLXB 1FDOA 3GTJA 3HU3A 2NVYA 3HU1A 1SFOA 2JIOA 4GA5A 4C2MA 3GTMA 1I50A 1QCSA 4AAYA 2VPWA 1PQEA 1CR5A 1YLEA 4KO8A 2VPXA 2JA5A 1AJYA 2IVFA 4CS0A 2VPZA 1G8JA 1H5NA 2JIRA 2WAQA 4AYBA 2G8YA 1VC3B
chains in the Genus database with same CATH superfamily
1SQPD 1ULTA 1ZXLA 4MRMA 1J1UA 5BYAA 3HKCB 1Z47A 2CW5A 4RBNA 2VDQB 3G0BA 2BWJA 4FDLA 1N3IA 3QC8A 3DF9A 3ZGVA 2I71A 2BMEA 4G4IA 5ER9A 4GYWA 1HEYA 4YT4A 1GUYA 1ISPA 4A26A 5F1PA 5AJXA 2BF7A 1FTGA 4CL8A 4CRZA 1ZR4A 3C2QA 1VQOP 3CVXA 2Q2NA 1DRVA 3BMOA 5EFOA 2IPXA 3F1LA 4DMKA 2DBZA 2WTBA 3C4VA 2GCEA 1FVFA 2WMYA 2FZEA 3U9SA 4JFRA 4OIFA 1M90Q 4YXWA 1RXUA 1W0CA 2PWBA 4YJ2F 1Q7EA 1PIXA 4CKZA 1IJDB 3QVVA 1U3WA 2CVZA 1T5OA 1KAOA 4L2IA 1FPQA 1KZ9A 1ORDA 4K86A 4CS0A 3MS7A 4B4WA 4RY9A 2IIBA 2NO7A 1GILA 1KYOH 2QRZA 2I65A 4C4RA 4WV3A 1NJ8A 4JU9A 1D03A 3IRUA 5DBGA 2O0MA 1D2NA 2WJVA 2CMFA 2GAFA 4G8JA 3H1AA 3WMM0 2POQX 3VAAA 1KYWA 3KXDA 4PGAA 1TT5A 1XAJA 3UBTA 1SBIA 1ZYRD 3AR7A 1YR7A 3LCMA 3OZSA 4ZP1A 2AOTA 3O95A 1IZ0A 5GWXA 3QBDA 4U7HA 3V1UA 4BLQA 4G3XA 1OXTA 1V1RB 3SYTA 1ZY2A 3BYZA 5KPJA 1E4EA 2KPIA 2QV7A 1A8HA 3AP1A 4ZZIA 4OQLA 3KQWA 1OLXB 1C14A 2DWCA 4Q1CA 1JIKA 4DLLA 1U7HA 3E7PA 3ICEA 3L77A 4HQ6A 3DE0X 3UVEA 1QYRA 4Z49A 3JQAA 3OKAA 1H89A 4E08A 1Z38A 4LF6B 3JQ6A 3RBXA 1JDNA 5KWSA 4P81A 1WKVA 3CO0S 4RVUA 5TV2A 1CK4A 3D3EA 1D2CA 2GFIA 1NTKD 1QE5A 2CZGA 3EG9B 4EVQA 1WF3A 2FMHA 4X85A 3M06A 3B9QA 2UZAA 2QRXA 5KYUB 5GPBA 2J5BA 3MHVA 2W6BA 2ZE5A 4D6PA 4RZXA 5AM4A 1ZW0A 4MTLA 1MAWA 4JN6B 4GIBA 4MUMA 4PLWA 3CM0A 4H7DA 1EKXA 1SCKA 3A4NA 4YCAA 5ES3A 2AUMA 4K7JA 1E6CA 4YJHA 4S1PA 3EXAA 3OZBA 4BJHB 2NVUA 1NUIA 5E6SA 3DAOA 3BREA 4TTRA 4HAUA 4OJTA 1NKSA 3NTQA 1REQB 4KVZA 2DG2A 2PA0A 5ELLA 3LIDA 4EMTA 1IUOA 2IKQA 4JI7B 4AWAA 3DPUA 4KTTE 4Y2JA 4BGVA 2XZLA 2E2WA 3FOEC 4X20B 3QUBA 4Q1FA 5T6BA 1NJSA 2IP1A 1I1HA 5KOIA 1FXSA 3H2IA 5E1BA 8ADHA 1JOCA 1Q2XA 1XLTC 1YHQP 5BWCA 1U8EA 1T0JB 1KILE 2J0EA 2O2XA 1CDDA 2IU6A 3ZJUA 1R6TA 5AKHA 4R1OA 4I1YA 2V4HA 4KFCA 2WTAA 4ONEA 4RYLA 5J47A 1KZYC 2BL4A 4TTQA 3N8KA 4XJXA 2VC2B 2V6MA 3HUFA 3JQDA 4OG2A 2K3RA 3I07A 1M8GA 4ND6A 5HJEA 2YASA 1G5IA 1X1BA 1XA0A 2P9HA 1Q12A 1UBHS 4LPKA 4RQTA 3G9XA 4GX5A 4YIHA 4RD1A 5EHNA 4IRMA 5AQ1A 1J1DC 3QI7A 4QOEA 1ZD5A 1SFOA 2J09A 4OXRA 121PA 3CPHA 2VK4A 2WNSA 1DC5A 1USPB 2WSMA 4BNIA 421PA 4HNUA 3EIUA 3E3OA 2XTMA 4Y8VA 5AJUA 3G6EP 2WSCJ 5EOVA 4GIFA 4C7XA 1MJGA 2QMHA 4ER5A 1ST3A 4MLPA 4MQUA 3ZZTA 4ISCA 3EGDB 4R54A 1U7MA 5GY7A 3OEWA 3ZGNA 2XWSA 4H3HB 3FKIA 3DWGA 1SBQA 3L4SO 3BE5A 1BCSB 4CEHA 5JMOA 5BRJA 3TIIA 2ZSUA 1TU3A 2OO3A 3PWKA 2LXBA 5CA0B 1QHHA 1CR1A 5BU5A 1GZLA 3V6LA 1GITA 4ZMRA 3QWOC 5T4BA 1G9SA 1KC8Q 4LF9B 3UAOA 4YCNA 4EHBA 2DRIA 2OLJA 2AYZA 2B89A 1LS1A 4IIDA 6LDHA 4H27A 2VUUA 1H8HD 3O8NA 3GTJA 4B17A 2YTZA 2A9QA 1DC8A 2WICA 3RS5A 2Z6VA 2HSEA 4MS3A 4R9SA 1XZJA 1FZGA 3QKWA 3Q5SA 3OF3A 2IXTA 3H1HD 3GF3A 2ZIUB 3W9SA 1FZTA 3LX8A 2O01H 4LYGA 5CTAA 5GLYA 3DE7X 4IEFB 1Y9AA 1XZCA 3KQPA 2GAEA 4R2HA 2VT6A 1Q0PA 1SMYD 1UMCB 2CE2X 3D7MA 4A0SA 2X86A 3UIEA 3FUTA 1QHYA 2BUCA 4FKBA 3MRXA 3ZWXA 3HVJA 5CJJA 1ADJA 3SWWA 5A9SA 5KAMA 3CB2A 3T94A 2W58A 2XMDA 4RZSA 4DSOA 2X0JA 3KJFA 2R92I 4ZREA 1V8FA 2FWBA 2OC4A 1ZV8A 5A71A 4XIIA 4B4VA 1FY2A 3ANYB 4LRYA 2ZRHA 4ZDKA 1L1EA 5HBGA 3OJFA 4J4HA 1KVSA 1ULBA 3WRYC 1AF4A 5T5MD 4IQ4A 2PZFA 1IWBB 4IFEA 1P7YA 4YYEA 2FUEA 4OGQB 5ALFA 4UTXA 5EPUA 2XOEA 3EVBA 3NBKA 5LSAA 1UK6A 4AULA 1QB7A 1TWGA 4MQBA 5IT9f 4MHSA 1SBHA 4TZTA 4GMKA 2G6GA 3LX4A 1KA9H 4WZZA 3NMDA 3Q3HA 5TMBA 1GGEA 4YJFA 4BO2A 4NOMA 3F96A 3V4FA 2VQFB 4XGKA 3EZLA 3ZXSA 3F74A 4LOLA 1RAGA 3OQIB 3BWXA 2OHJA 5BQ5A 2YWBA 4BO0A 4ALJA 1PJCA 3KZOA 4QTTB 1EXIA 3WU2E 4GMFA 1SZDA 3TLGA 3EZ9A 3ZXIA 1A7KA 3QOXA 3Q2IA 2CYCA 1ZUNA 4RPIA 1EZVI 1PKEA 3CXUA 2WMNB 2VWQA 4WKBA 1P72A 1RHQA 1AKMA 5T64A 2Q3MA 1LY1A 1ZCZA 1H2XA 4F3TA 3GOHA 4RFVA 4HAVA 2QD4A 4M99A 2UZ1B 1GW4A 1BQ3A 1B76A 2C8KA 1I2DA 1V26A 4OXQA 4RIEA 3V4ZA 1G21E 2ZI5A 1JN0A 1JYFA 1YB7A 5L4LA 4X94A 4O2AF 4TPKA 3VHXA 2PUVA 3N8GA 2O0KA 5CH5A 2O2CA 1W4BA 2W2LA 4HFMA 2GPJA 3RUAA 3RL0B 1PL7A 4BKQA 4PWZA 3F5HA 1OBHA 1UZMA 1RIIA 3KKZA 2D0IA 2QVCA 1IFIA 4RTSA 1Y6ZA 1G8PA 4WACA 1NVVQ 2H29A 4G5QA 4YJ3B 3P2EA 1WCIA 2P5YA 2ATCA 4LMRA 5A05A 3CLUC 2JRCA 2GK3A 3X2KA 4LXTA 1MC8A 4CKEA 3PQ8A 2AH5A 5LKAA 2VJAA 4BNDA 4OBEA 3RHSA 5FLYA 2VXBA 1EQUA 221PA 1I2AA 4YUXA 2EKBA 4OHWA 3OQHA 4OXKA 3STYA 4C07A 3KE8A 4CKBA 4FG4A 3CFYA 4G5SA 1JG7A 5EN4A 2RGNA 2Q1TA 3MJTA 2XWQA 2QPLA 3Q3CA 5E2AA 3RRZA 4IIYA 4AECA 4HNGA 2O5CA 3D4OA 3LWBA 1TQ4A 2FZVA 3BIFA 3RG2A 3GP3A 3MRTA 1IBSA 4DJGA 1YJ9P 1HE5A 3KYBA 2Y05A 3A58B 2YW9A 3A37A 1G17A 1MA0A 1W36D 1PNVA 2Z5VA 4TS9A 3GA0A 2PR7A 3VVLA 1QLED 4TWBA 5AIAA 1X94A 3R4VA 4JP3A 2R5DA 1XMJA 4TVOA 3HYCA 2I1WA 5LDDC 1AUXA 3P9KA 3F8SA 3PTLA 3IKVA 2BEVB 1GQFA 1MJFA 3HVUA 3H9JA 2E6UX 3OJXA 3ABRB 2NPOA 3HXKA 2AFHA 1VJCA 3IMKA 1ZL0A 2QTNA 4AW9A 4TV8F 4XVUA 3PK0A 3I01M 3L72J 1X1CA 4H7FA 4HP8A 4PU0A 3A9SA 5EWLA 4HWTA 1WEKA 3R6WA 2V6JA 3FTPA 1O9HA 1ZMBA 5FIUA 3SM9A 1QF8A 3OTIA 3NETA 2RGEA 1YT5A 4RH1A 1Q3HA 1YVUA 3HO8A 3ZQJA 2JH3A 3STTA 2ERYA 1DG3A 1NSTA 1SQVK 1DARA 4X3PA 3Q5EA 4HXFB 3CINA 1XLTA 1OX6A 1J21A 2RG1A 1KPIA 2BFNA 2CWDA 1Y63A 1UBEA 1HKHA 2O7RA 1O6BA 3CL3D 2BE5D 2C59A 4A3GI 1TZMA 1MB4A 4RK0A 4EARA 2Y1KA 4B8WA 1WUTA 4LJRA 1XEXB 4BKPA 2ZUEA 4REOA 2QR2A 3HV2A 3WFJA 1QH9A 5HSGA 3IX7A 4X41A 3CT6A 2Q5FA 1ZCJA 4LYJA 1JDVA 1T2AA 3MTEA 5BQ3A 3DOUA 3LZ6A 1RLMA 4FX2A 1CVRA 1GPAA 1Y1VS 4AQYB 1H9BA 3KZ1E 2YNMC 1DBQA 1SOMA 3V2IA 3P4UA 4QBGB 5DB4A 3T99A 3H1TA 2NSJA 3AE4C 3H2SA 4IF4A 3URMA 2ITAA 4G24A 4Y6LA 5L45A 1ZEJA 1NWQA 3L43A 2QTGA 1N75A 4NPAA 4V03A 4JYPA 2ZIXA 2BUBA 4DCPA 3RSHA 3KSRA 3CO5A 3RTCA 1KI1A 3NGXA 3HMQA 3DLTA 4Z4IA 5LB4A 1CP2A 4PPQA 3M1AA 2H9YA 521PA 4IL6E 4E30A 1N5MA 2PEZA 2WIKA 4KIUA 1DBSA 1JJIA 4E13A 4EQZA 1ZIOA 4LQCA 1EPUA 1X70A 2HMAA 1VQ6P 4EI8A 1LDGA 5EWMA 4AWBA 1VJRA 3FCSB 4MEJA 1SXJE 5FI1B 2YKQA 3JC22 3H5WA 4AI6A 2QW0X 3ZJ4A 1ABBA 1X7ZB 2I2AA 1ZISA 4JSTA 3EMBA 3ZJYA 1V8DA 4C29A 4FC7A 1SWVA 5EFZA 2X6QA 1KP2A 2J9ZB 1Z6AA 1GKYA 1EFTA 1PP9J 4HDSA 4UUNA 1N0IA 4BPRA 1FDSA 1TYCA 2R8BA 3TLBA 1M8KA 1F48A 1X1QA 2CDCA 2POCA 5JAIA 3E9EA 1EVQA 1OASA 1PGOA 3G2OA 4WB4A 3U9LA 2VHWA 3L0ZA 4P80A 2CW0D 3WJ1A 4RZUA 1DKUA 4DGQA 1R5SA 3GTQI 3AEKB 4K2AA 3WB0A 2ZB2A 2OESA 2GO7A 1WLYA 3LX5A 1YJQA 1CZRA 5APTA 3ZZMA 3F73A 2HZBA 2RAPA 1K8XB 3JYOA 3CLTD 1GIAA 1S2IA 2C7QA 4B09A 3WRYA 1I94B 3O4VA 3IE2A 2ACVA 1E1NA 4D46A 4UNIA 3I2JA 4MYDA 1WUJS 4JBXA 3MWDA 3E8SA 5FAXA 4QJ4A 1YAHA 4O1HA 4XWGA 1UM9A 1GD1O 3L71E 2J3LA 3ANMA 3HKEB 1KMQA 2IGTA 3IVAA 1W4AA 4GQAA 1OXMA 1ZH2A 4D9BA 5DWVA 5AVOA 4HNRA 1MU0A 1SB9A 1PG2A 5BSTA 5JSFA 1JFRA 3UMCA 2D1FA 3P32A 3FXDA 5DV9A 1OB5A 3OCXA 1W29A 3IR9A 1I10A 2HT1A 4WN3A 2MJLA 4NCIA 2Y4OA 4FGKA 2EIXA 3F9CA 4ND2A 2ZUTA 3OQBA 1Y8ZA 4Q82A 4K9DA 1RXEA 4H7KA 4I7ZB 4OJKA 3NXKA 1Y4SA 4WCVA 4JUCA 1ZX1A 2WZ7A 2WYVA 1X8LA 4DC9A 4H16A 4R9RA 3F5MA 3WK4A 3CURA 2R7LA 1KB9H 2QR3A 2WWTA 3LUGA 3I05A 2RGCA 4HDAA 1ECPA 1DRKA 4KRXA 4XLTA 3G9RA 1HZZC 1U2TA 2GGSA 4CLRB 1KNXA 4D96A 4KUEA 2WSSD 2QAGC 5KKZB 2IS1A 3LC2O 1XXHE 1R5OA 2A1UA 2PPVA 1CJUC 3AEUB 4RESA 5HOQA 1ZR2A 4LZWA 4ZI7F 1K75A 2Q5LA 1BDHA 5GONF 3CCS1 1AMUA 5D3MB 2D0OB 1E77A 4L9SA 1WW2A 4A91A 3GEEA 1PL8A 3RC7A 1DQYA 3UHJA 2YMMA 1P84I 2NU6A 1B00A 4DQDA 1T24A 2FUNB 4L8GA 4Z7NB 2IYPA 1YVRA 3GNLA 2BAGA 3OEED 1YIOA 4AICA 2PJRA 4CR8A 3KJNA 3NAMA 3VTAA 3WL4A 3HY3A 4M1MA 3BN3A 3ENVA 3D59A 3AJDA 4DLPA 1I0ZA 1NLUA 4A3SA 3QK7A 2QUZA 4Q3OA 3O2JA 3AEQB 5IM4F 1SIUA 4UVIA 3U3DA 4KJZA 1K5GA 2PWZA 3F3MA 3PGLA 2QW8A 4B33A 2AZ4A 3QYJA 3RASA 3ZD8A 1RAIA 2COEA 3S70A 1XDBA 3W5BA 4D98A 1EGAA 1SQXK 4A0FA 1FS0E 4FDAA 3U5TA 2UVPB 4Q39A 2UZIR 5JTUA 2IPPA 1ZB8A 5LQNA 4OB8A 2LBPA 4C2AA 3U7HB 1GZDA 4O0LA 1M5UA 4BFLA 3SQXA 4S0XA 1RF1C 1D4AA 1PQWA 2JB9A 4IWNA 1JSCA 1EUZA 1WCYA 5BN5B 1ZMRA 2VNSA 5DNDA 1DAHA 1XZDA 3KQLA 5ILQA 2Y9MB 1N78A 1V3TA 3FM9A 3OZWA 2JLBA 1LBSA 4M0FA 3A1SA 4XGRA 2ATIA 1KY5A 1QH1A 5F3WB 5B7NA 1T13A 3E9CA 3WIVA 3SHQA 2QNBA 3EDQA 3NWPA 3GRYA 1PG5A 2HQ1A 2G77B 4W5NA 4WVFA 4KXWA 1XD2A 2NWQA 5F98A 4D3DA 3T9CA 3I45A 5B58C 3CEHA 2OOYB 4OATA 5FBQB 4XM1A 1MB0A 4EKDA 2GBLA 2YHUA 4B40A 2I7CA 4BCDA 1W36C 4KQWA 4X84A 1ONBA 4MB2A 3G1WA 3DMPA 4U3FG 1H5NA 4W63A 2ODWA 5IYZA 2PA3A 1ZXXA 3ZQ6A 2QORA 3H11B 1R6XA 2ICAA 3ZU3A 2HA3A 1N0UA 3NHYA 1FSGA 1NR1A 2HV9A 1FNNA 2RI0A 4MH0R 2YMKA 3BQMB 3IAS1 2G0TA 1SU6A 1KAMA 4XCQA 3B3GA 4EG6A 3EA4A 1FFWA 3AK4A 3V5BA 4R9UC 4EHIA 2YXEA 4BNUA 1Y1VA 2VP2A 2PMWB 1GP2A 1W1UA 1SC4A 4LS3A 4UDYX 1PEDA 4O4IF 4BLVA 1NTZK 2NP6A 3TR6A 1XRPA 5F2KA 1PBTA 4ZEVA 4QOJA 3PUXA 2CKDA 5EQTA 3U6KA 4CM4A 3ZE8A 5T3YA 1L0LE 1R00A 3I34X 3LP5A 2FFDC 3AE2C 2VSFA 1OH7A 4MP6A 3KVNA 4PHGA 1KD12 2CSUA 1JAHA 4O4HB 2QN1A 3AB8A 3PKZA 1T10A 5J4LA 1I6KA 1JG4A 1CNEA 4LJAA 1E1DA 1Z07A 1OXVA 2YIJA 3ZK8A 3G9TA 1R8EA 1AKUA 5JXHA 1CRZA 2A6HD 1JAIA 3GPIA 3K16A 1X9IA 4MQ6A 4BX8A 1O6GA 5LD2C 1ESEA 4H6VA 3HL4A 3JWJA 3PD7A 3KM0A 3KLPX 1QUEA 5CT8A 5BWOA 1XELA 4A3JI 5ICFA 1E4VA 1QX8A 2SPZA 4J0IA 3DMHA 1R74A 4UREA 1I13A 2ZWIA 4Z86A 1YQTA 5CA1A 3KDAA 4FNOA 3NRCA 3RUIA 5IJ0B 3LVRE 4Q7MB 4NAHA 1N6HA 3ACDA 4U0KA 1ZJ6A 3FFXA 4OH7A 4HADA 1KD11 5ALNA 4OXIA 5JECA 1TE2A 1Y1TA 3OE5A 3BJRA 1OTXA 5DULA 4ZRNA 1S72Z 5HFAA 4I7EA 2EBWA 3CT4A 5DGDA 2FOLA 3NH8A 2JIMA 1FJHA 1I3OA 4WZAE 3KOYA 3ZX4A 1KEVA 3H1KG 1U02A 4H3KB 2QZPA 2V3VA 4CI9A 4II7A 3S68A 1JTHB 1LTGC 3PG5A 3ZI7A 4AYTA 3I6ZA 3ZLUA 3D7KA 4H6XA 2E5WA 1NTMD 4NG5A 4DAOA 4XFJA 5FDFA 4J9VA 1H8HA 1QK4A 4TN1A 4QXMA 5FHRA 2BMFA 1RAFA 3GT3A 4NP6A 2V8JA 2VSNA 3S7TA 2VDKB 2C4UA 3G2HA 1H85A 1MDFA 3I4LA 3JD3A 5TGDA 4DBZA 3CU5A 1HFWA 5IM4A 2IEZA 1WCMI 2B4TO 4ARVA 3O3NB 4JCOA 3CRW1 4FN4A 5IVDA 3KHKA 2CFCA 1F4PA 3L4BC 5IUKC 2HYIC 3ETCA 1JTVA 4ZNCA 4EUSA 4QAJA 3SMVA 1TK2A 2C2BA 2JGNA 5I5EA 2MSWA 2OLEA 3OEYA 1K89A 4BNVA 2VCYA 4GXRA 1Q0ZA 3W2TA 1TYEB 1NU1K 3P8CE 1ZJJA 4WCFC 4Y9UA 1MO3A 2FUKA 4FCVA 4LDQA 2I6GA 3JYQA 2GI4A 3UJCA 1PX2A 4UHDA 4MWOA 1EBBA 4QHTA 2JLZA 5IVHA 1UC4B 4DS3A 1EP1B 7MHTA 4QUHA 2CKMA 2JI7A 2ZUDA 2D13A 2WDPA 3GLIB 2VL7A 3WIUA 1GO2A 4ZFNA 2O8BA 3IPYA 3N7UA 4RKWA 1GYQA 1R9GA 1DTWA 3CLTC 1P2FA 2WJGA 4BV9A 1O0SA 2I0FA 3AH8A 1U63A 2V58A 5KYYB 3M4YA 3C85A 1J56A 2SKDA 3AEFC 4RIIA 3UIAA 1N8NA 4PAOA 5TGTA 1UEIA 1Q91A 4BRWA 4R1TA 1WOYA 4AYWA 1PPJE 1SIBE 3L0YA 3R3HA 3GU3A 1D4OA 2IHZA 2C9OA 3DZBA 5LUAA 4J1TA 3VDMA 4WY2A 2B36A 2IEGA 2VSOA 2QAGA 2AKEA 1DUSA 1H5QA 1QG4A 3LP6A 3BG0B 2A06E 5AFSA 2A0XA 5AKXA 2EL7A 4EKEA 1IPHA 3W6UA 4K46A 3SDZA 3B36A 1YB5A 3GCWA 1Q83A 2LTAA 3DLHA 3LYUA 3GQBB 1FFAA 2HDNB 4KQIA 1RRKA 2C8JA 3P96A 5LQMA 2P9FA 2AVDA 5K8JB 1E6KA 2F1JA 4JAVC 3T1OA 3NVMB 3FROA 1ATIA 4F1KA 3HJBA 2HMVA 2XYGA 4WECA 4D8WA 4WJZA 4F8EA 2W22A 4ASWA 2CCKA 2GD2A 4U2GA 2VTEA 4ERXA 1N4AA 1FU1A 2E5YA 1BFKA 4N6OA 4C0JA 1J6UA 1PGQA 1CEEA 2H4JA 1ZNQO 3HI4A 4J3JA 5C8YA 2POHA 2K1AA 4M0UA 5K0EA 1ZBQA 2LDXA 1YF3A 2C9YA 4O2BF 3H9BA 5FR1A 2J32A 4PSCA 2O7VA 1B42A 3VOTA 5A1TA 3KQQA 2QD1A 3M0DA 3E2IA 4P92A 4TVBA 4ZAZA 3EZ2A 3UFBA 1E5QA 3RU7A 1L5GB 4LWZA 2M6LA 4WHMA 4IDPA 3O73A 2NYAA 4PO1A 3L74G 1LPAB 2ZYGA 2IP2A 1KYZA 4F6CA 3WLEA 1PP4A 1HTBA 4O33A 1SQPK 3AHEA 3BF7A 3VYRB 2R84A 3PDIB 3QX8A 3L4FA 1VMKA 1RZUA 1UL1X 1ZW1A 1Q7CA 1AT1A 4NBWA 1NRIA 3EVDA 3SDSA 4FHGA 2E5LB 2JFPA 3VMZA 3TL6A 3U1VA 3QWBA 3L3BA 5AVRA 2UAGA 3WYGA 1K08A 2IYUA 1J22A 3V3TA 2JJYA 4YMTA 2BFBB 1VMAA 2NYRA 4L08A 2PUEA 2OV1A 4RF4A 1WMFA 5HHTA 2AN3A 4UBLA 2AXQA 3VVCA 3ESDA 5B5SA 4TNUA 5AVTA 3K6SB 4PN7A 4TSRA 3HR7A 1FVXA 4G9GA 3BA6A 1IWOA 4KL8S 4RSHA 2OXEA 2BHSA 4URVR 3FQMA 4J75A 4NBKA 5E2IA 1SN7A 5K03A 2C7VA 1E2QA 4WOKA 2ZBFA 2X5XA 4MVWA 1LTJA 2XNDD 1YQ9A 1RXYA 1P19A 3LY5A 3UMMA 5BUCA 2QNRA 3GLGE 3D8UA 1WRBA 1WMKA 4RF2A 1AKTA 2G09A 1ID8A 1ZN2A 2IZ1A 4JB2A 4NZYA 2FSGA 4GBED 4JQOA 4WBSA 4BWFB 4HMQA 4V3CA 1I32A 1M34E 2ZPTX 4UTVA 2R7AA 2QZJA 1WIWA 3F3PC 3ZY4A 1A98A 3VR6D 2HX1A 1Z7WA 2FN7A 3A3PA 1XMQB 3N2EA 3RK4A 4MQEB 1G3UA 3BE8A 3KPUA 1VXRA 1WVGA 4DDVA 3Q9LA 4NCXA 3QHQA 3OTOB 4KNYA 2C9DA 2LDBA 1WB9A 4E09A 1UMDB 3VZRA 4JOSA 4MP8A 5FOVA 4UNRA 1IC2A 4L4YA 2C2XA 4HDOB 4HWPA 2X15A 3V1YA 5C5IA 2PP6A 4CM6A 4M1TA 5JDCA 3GVCA 1P0PA 3I76A 1UBCA 1YAJA 4I1IA 1LRLA 3U3KA 1ZNWA 5KYKA 4DZTA 1G19A 3GJXC 4EVRA 4DNFA 4RL6A 2I2CA 2WJYA 4U7TB 3A04A 3K92A 1QGUB 3ELDA 4OHCA 1CZKA 5F9MA 1T9HA 4AS1A 1A02F 3FNIA 5BN4A 1U5BB 3BK1A 1P1CA 3M9WA 1E3IA 2ZSKA 3AV0B 1H4QA 1EZ4A 5HCUA 1TK9A 4ESVA 2I3CA 1WDTA 4BIMA 3RKSA 3O1JC 3RK3B 2MSKA 3HPRA 1O77A 4PFJA 4ZU3A 4WINA 2F3TA 1T9GR 1O03A 5L3QB 2PICA 4NOLA 3GO4A 1T4MA 1L6IA 2XKAA 1U3VA 4F5EA 4BV2A 4MR9A 2EFYA 1YTLA 4LOAA 3RYIB 3DEKA 3LQKA 3R9XA 1KJQA 2R1TB 2F64A 4MV4A 3N59A 1E5WA 3DXYA 4DV5B 4MVJM 2HLOA 1P77A 3FOBA 2PFKA 2FPPA 3PNLA 2O8FB 5AJZA 4B4UA 3BCSA 5LLSA 1XNGA 1MENA 3GIDA 5LNK1 3CVUA 4JJ8A 3AF1A 5ALXA 2E4YA 1F2TB 5DZSA 1RJWA 5FBZA 1WZ2A 4Y99C 4GO1A 1N3YA 4FXPA 4MVJG 1NE2A 1TIKA 4WXEA 3JWEA 1QWOA 3JYLA 3A06A 1MTOA 1B6GA 1QNFA 3FWYA 3HCFA 1MW9X 4RD0A 2QQEA 3RO7A 1G3QA 7YASA 2BFFB 3HVHA 4JBHA 5A5FA 4E22A 3W04A 1YV9A 3ID6C 2LV8A 1WXHA 4PV7A 2VYFA 5IF3A 2FPOA 2GT1A 2C2YA 3N58A 5FB3A 1QVZA 4KMSA 4FWBA 1E9AA 4JZYA 4WNYA 3KJXA 1VLVA 4KCGA 1P62B 1DG9A 3L4BA 3ZH9B 1RM5A 2XNHA 3QJ5A 4PZLA 4E5KA 4AJOA 1YRLA 1LVUA 3G0IA 3RKUA 3HB4X 4II2A 5ALOA 4IV8A 3B2QA 2ANBA 1R2QA 3UXMA 4N40A 4EP1A 2QRVA 3NAQA 1Y8RA 1HDZA 4KIJA 1E2NA 1LX6A 4XWTA 4ZIRA 2JJ1A 4WCFA 5JQGB 4C2UA 1QIIA 4GYYA 2IE0A 2XMGA 1OZ0A 1RYYA 2CLHB 3JAMb 4UBOA 1GK6A 1ZUHA 2VFAA 4ND3A 4R51A 3ACBA 3V5NA 2AJCA 4EUHA 3ZWWA 3G5TA 1BCRB 1ZI6A 5KJEA 1JGTA 1GCGA 1LS6A 1FP6A 1VQPZ 3NBFA 2XVXA 3GP5A 3GEBA 2YW2A 2BJVA 4DYDA 5F5NA 1DX9A 1O8BA 1ABEA 3ZS8A 3RROA 4M1ZA 1HEIA 2O8CB 2W2KB 1ETUA 3THWB 1OVRA 8MHTA 2P7JA 3VKGA 4J6FA 5BN3B 2G88A 1L4YA 1Y9ZA 3GJ7A 3SJBA 4MPJA 4QELA 1V71A 4BNLA 1R9TA 3ETDA 2BONA 4D6XA 1NXPA 4PZDA 5L7YA 3DZFA 3CUEF 2JLWA 1WTCA 3AFGA 2WIBA 3FSJX 4BU1A 5AW7B 2WYOA 1QB8A 4IOKA 4QQRA 3PFKA 3BSFA 4KIGA 1LBHA 2AG6A 3Q1LA 2R5NA 3RS4A 3UT6A 1D04A 3LFHA 1QIMA 2KI5A 2X1VA 5LMZA 1VJTA 1PYOA 2WKRA 4X6LA 1T35A 2XV1A 2WJ4A 2VTVA 1X7YB 5GAJA 1JLKA 4UM9D 1IEQA 4WOBA 2D6FA 2R87A 4Q4JA 4D2IA 4PZPA 1J0AA 2DWQA 5F5LA 2SICE 1CB7A 3WR5A 3UMJA 4TTJA 2HJ9A 1QZZA 3N0TA 5CEEA 1TC2A 2ZRNA 5TPWA 3COVA 3PC8C 3V4WA 3BGIA 1K5PA 4B8YA 5WRFA 2B4RO 1JHXA 3ON5A 4RSRA 2X22A 2VEOA 2E4AA 2HSWA 3CLUD 1J4AA 4BV8A 4KXQA 3MFYA 5B3JC 2WSSA 4ESHA 4ZTUB 3W6NA 2Q99A 2OV3A 1WQ4A 1IE3A 1L6RA 1U7UA 4OI4A 5CJ4A 4DCTA 1EXJA 1I7DA 3EUWA 3YASA 2BZSA 3MT9A 2Z04A 2CJXA 2O8DA 3HXQA 3T5AA 2ZFUA 1R6VA 2N75A 3NIGB 3QVGA 1U9JA 5HS4A 3DYIA 1ENZA 3C9IA 2DR3A 3GAMA 5GTDA 2I2WA 3DG9A 2XZPA 4O4LB 2VEDA 3IKTA 4M22A 3GLVA 4IZ6A 3OEEA 3FUUA 5HVNA 2X76A 5IJAA 1D8TA 1YJWZ 2JW5A 5JWOA 1OA7A 3OLQA 1R12A 2AGVA 2XE6A 1JLLA 5H3CA 3I56P 4OUDA 2ZJ4A 3ITEA 4FQ8A 2D1YA 1N92A 4F1WA 2J33A 4RD4A 1VQ9P 1KMNA 5DNWA 2EIHA 3FTCA 2RB5A 3PRJA 1U9IC 3KKPA 4UTZA 3CCLP 2IV7A 2ZBDA 2VCEA 3LZCA 3OUUA 4P36A 3BERA 1W581 1PR3A 3ICWA 1EFDN 4HNSA 4AC9A 3FNEA 1K8YB 2DPLA 4JELA 2FYUD 4N3GA 5I9TA 3S8EA 2VPTA 1MAHA 1WW9A 5BSHA 5JJBA 5F77A 2CV2A 1K7FB 1CS0A 4YEDA 4YCMA 3TNLA 1UPAA 3LX6A 2R6GA 2ZYVX 3I8XA 4UMEA 3R3SA 2BYTA 3HL0A 3DAPA 3GG9A 3ZY5A 2HK7A 1QYVA 3O4JA 3MHPA 4H1HA 1HLFA 4RPJA 4BO5A 4G8DA 5DSXA 4QVKA 4LYDA 3AKCA 1XV5A 4I2VA 3PFWO 3M1IA 1ZU5A 1NPYA 5ISMA 5I9NA 3ADPA 3H2BA 1R0YA 5FO1A 2E2IA 2GN8A 1TTPB 1AMNA 4TTSA 1N2CB 1VI2A 3E1KA 2A86A 2R9VA 2QTHA 2JI8A 3D3KA 3CCUZ 5A9RA 5JJ5A 4ZJPA 3L7OA 3G5UA 1UBGA 2PZMA 2BCCJ 2P3QA 3HEBA 1ZVKA 2FE4A 3BMXA 3L49A 4CTMA 2HMTA 1L5KA 1R1DA 3GTPI 4UZEA 4EB6B 3E22A 5ESRA 5J63A 3SHTA 1XEAA 4FYHA 2JHPA 1I3KA 2G6BA 1Q821 2FRDA 4LOHA 3EMDA 2N3ZA 3RDPA 3P5SA 1CUYA 1U0SY 1W6RA 1F9EA 2HGSA 1M75A 4K1LA 4DV2B 2ZRIA 3ODGA 2YNMD 4CKCA 3V4VB 2TRSB 1QF6A 1GZ6A 1PE0A 2J6IA 2EC5A 2WEKA 2VPYA 4C6TA 3QLUA 3D9QX 2X2EA 4CTOA 3HA2A 2BP7B 1O97D 4CEIA 1Z0KA 4YRNA 4YV7A 3G82C 4OMDA 4BFWA 2CD7A 2EBFX 3H1JD 4K88A 3HTKB 1TFIA 1NX9A 1XHFA 1QH8A 4WSOA 2KX7A 2YVQA 4HEA6 1ORVA 2CUKA 5LR6A 4HQLA 4LDZA 2BUAA 1TWCA 1LLUA 5C1OA 1VB5A 1JQJC 2PYIA 3A0UA 1N6NA 2SKCA 5D7NA 3AFIA 4GW3A 3FB1A 4PM4A 3ASYA 4WAUA 3JATA 5IVKA 2Q4RA 2V0GA 3HA7A 2FXPA 2VJKA 3M6IA 4JBZA 3KYDA 1ZBDA 3TGWA 3C7CB 2FP4A 1VE9A 4W6ZA 4G0PA 5AR1A 5HF9A 3PP5A 2YY7A 1J2YA 2XODA 4YUVA 4PNEA 4D9IA 2ZJFA 3CC71 3WQBA 3MILA 3OZFA 2QUJA 1UIMA 2OPHA 2QA41 2GYVA 5HZMA 2WKQA 4ZAGA 1Z56C 2O2YA 4R0VA 3WLAA 3OOJA 1CVIA 2GWRA 5I01A 2GM4A 1Q14A 4DWJA 2ZE7A 3IPAA 4UEOA 4YJ2A 4A2QA 1P0FA 1Z4LA 3RSLA 2P28A 1ZM4A 4ZQHA 5T67A 3RSCA 3V7WA 2OCBA 3J81f 3HYLA 4UUAA 1XDSA 3D3WB 3LTEA 1HK7A 3I2GA 2CXPA 4C5CA 2X19A 1IK6A 1E1QD 5DW0A 3CKMA 4CT4B 3RSSA 1XG5A 2BFPA 3B71A 2HC9A 2RI6A 2GUVA 1EWYA 2ZWAA 2FEPA 1T0HB 3FI9A 4CM7A 1MRSA 2REQB 5AQEA 1Y6QA 1ZH8A 3PX2A 3A9VA 3B85A 2YV2A 1MOSA 3C3DA 4TQ9A 5D5HA 1NY5A 4L5CA 2QJYB 5AW0A 2WFLA 4Y9RA 1GQOA 4PLFA 1DO8A 1LUAA 1JB9A 4N0PA 1J09A 3NHBA 2WSEH 2QBYB 4R9NA 1SFCD 4NBFA 4DARA 4DAEA 3H32A 4JOBA 3W5VA 4K9PA 2YJ3A 3IDZA 1W2GA 5JCXA 2YBDA 2QW1A 3F3FC 3IP8A 2JGIA 1DBWA 2EGGA 2EGHA 3K2QA 4X1OA 4V0QA 4XJSA 1UPBA 4N3YB 2EFJA 1T8SA 2YV3A 2JRLA 3LW8A 4JLKA 5CG1A 2HADA 3LSYA 3HCDA 4NDNE 4IQ0A 3EY4A 3BH7A 3P71T 2G63A 2LW7A 4RMGA 4O08A 1Y1RA 2GETA 3WGOA 5ALQA 1M6WA 1FIUA 3EC2A 2E0IA 4GZ3A 5B64A 3VR1A 3O4GA 2R3CA 2YICA 3LH5A 4IQGA 5LVAA 4Q6BA 3L75G 1L5MA 5H3LA 2VF1A 3I58A 4NU6A 1MFTA 1PFQA 2GZAA 5EXSA 2BFCA 3B6MA 1HO3A 2P77A 1GZUA 1X8YA 1HT3A 2EQAA 4QD3A 3ZQ4A 2E76D 4XH9B 3PC8A 4NCKA 3CC21 1TUEA 2XUKA 5BVGA 4JLUA 3NDIA 1KF0A 1HQKA 2PANA 1TJNA 3A6JA 2QR5A 1M1YB 4HLUC 3TNFA 5KTOA 3RLIA 3K71B 1UBLS 3GHGB 3VMAA 4CUZA 4GKAA 4JKYA 1SWWA 4ITRC 1XX6A 3RFFA 2CL7X 2VT2A 1T6ZA 3AL3A 4MCHA 4OREX 1HNNA 2P1ZA 3ZHQA 4NXNB 4EB3A 3Q7PA 3QFRA 4MRSA 4RA6A 1Z0JA 1TUBA 3ENNA 3F1KA 1LH0A 5DLEA 3QG5A 4OP1A 2WT4A 2ZJSE 1S3JA 4KAJA 2Q6OA 3T3PB 4NX2A 4U6SA 3KHUA 3M6WA 3LDUA 2OVBA 1VA5A 3HCRA 4MVJH 2Z9CA 2BHLA 2VP6A 1ZZGA 4PZ0A 4PAQA 4HSGA 3MMPA 1L9KA 5LB2A 1W88B 3L7NA 3GOQA 5CP8A 1DKNA 4FFSA 4MITA 5E1MA 3CS3A 1K7YA 3R2JA 1A0OA 5J9FA 4GVXA 4Q9DA 2VTDA 3A4LA 3MXOA 4IFTA 1MHTA 2GASA 3HD7C 4MWZA 2JCXA 5FULA 3T1YB 3S2HI 4OOEA 3QVSA 4H31A 3FDXA 3MTJA 4YGYA 3ZXUB 2J9XB 1K0FA 4ENPA 4O63O 3TH5A 2ZI7A 2VLBA 2ENUA 2Q3EA 3M34A 1GSIA 1C30A 2XKJE 1LBTA 4NBDA 3NWEA 4GPZA 3IHKA 4P1ZA 1CRWG 5INTA 1B1AA 1DXOA 3W9UA 1YS1X 2Y1GA 3NAGA 3TX2A 5JZVA 3E4DA 1VPTA 1SQBE 5FOXA 3OPQA 4BWGA 5C8XA 2J07A 4IGKA 1U28C 4EY3A 2YJTD 4QJ3A 1T9DA 4H4EA 1JHZA 3ORHA 1Y6RA 3O0TA 3J80f 4HGPA 3I55Z 1VI5A 4J07A 1M1UA 1S2DA 3EEFA 2FY8A 2ZT9C 4BVGA 3PFBA 5DHTA 5FTWA 4IEEA 4YHHB 1WD7A 1OH6A 4I9NA 2Y1OA 4A0HA 2X1LA 5THKA 3QSYA 4WBNF 4ODIA 4GKBA 3MGNA 1C9YA 3AKDA 3A1WA 1FJPA 3UCEA 2XNDA 3V00A 1JJ2Z 3HB5X 3EAQA 3EF0A 4A6DA 3E9MA 3CEAA 1WG8A 2XXAB 2N42A 3AOEC 4KDEA 1X87A 4L8FA 4P4SA 3T35A 4ZGGA 3DONA 1MGOA 3MAJA 3R3VA 4DWVA 4BEWA 4W7HA 1YGYA 2XKMA 2B3DA 3KUCA 4OLBA 2FK8A 3BE4A 2H7XA 3VU9B 4PG4A 2IFNA 3NBZC 3H0GI 3GGJA 2MMCA 2PUCA 1EDIA 3EDRA 5HE8A 2GRUA 3ICCA 4XCVA 1JKFA 1CUWA 1VQO1 1GPH1 3IHLA 4TUYB 4OQYA 1TQHA 1GL2B 4H1VA 2GN0A 5IJWA 2ZKIA 3H5AA 5BV2P 2Q3LA 4I14A 3D2CA 2HFED 3SLGA 2NUPB 1XR3A 3LBAA 3Q15C 5JJCA 2BZ0A 2PXHA 1HF3A 3AETB 4C20A 1GRCA 1L8QA 2HUNA 1YCDA 2OCYC 3GCGA 5H3HA 4YT2A 3UPDA 4K6KA 3RL0g 1YCHA 3KX2A 1TQDA 1Y9JA 4Y2RA 2B87A 3HUUA 4B6RA 3U81A 2YXRB 3WYBA 3VYVA 4KPGA 1GTRA 4YONB 2O6LA 3O0DA 1U7DA 3Q5DA 3B5NB 3ZLJA 4I8DA 1O97C 3LV8A 1V1MB 3IEKA 3K73O 3ORRA 1FJ2A 3HXOA 4RLFA 3MWLA 3SIRA 1HLPA 1N10A 4UHFA 2NSDA 4BQRA 2RMZA 2P4QA 2QPTA 1Z56A 4QUIA 2QJOA 3VR5D 3RCBA 2OFPA 1Q7Y2 1P4AA 1LPNA 3I561 1KC3A 1I6MA 1QGED 1EG7A 2JVJA 5F9FA 2ZFCA 1HVVA 1VQ91 1G66A 3HA5A 1CSBA 2QSUA 5CBPA 3OTWA 4O2AA 2JKYA 1TU0A 1A5AB 3WP1B 2Z5IA 4PXAA 5KHLB 3KDSE 1QIGA 4KGDA 2JIQA 4HZIA 5LZ8A 2GK6A 3S55A 2HREA 4DQ0A 4TOIA 5IT5A 3VP8A 3N05A 3BXZA 4EAAA 4YIKA 2P2LA 2QX4A 3HDJA 5TR9A 3DV9A 3VR4D 3DNPA 2H1OA 3A6FA 4GP6A 5E0OA 1W44A 3SS7X 3FAKA 2WBLC 1LJ8A 1Y47A 2H65A 8AT1A 3LWNA 1CZLA 3KAKA 1QPBA 1Q7Y1 2QL7A 3TUIC 1Z0ZA 4R68A 2ABWA 1I14A 5COBA 1S3IA 1UMBB 4H0FA 5EIEA 5KTPA 1LX7A 3L70G 1YK1A 3G1UA 2V0NA 5AW4A 2Z3WA 3CSSA 3C15C 4GDFA 1TD9A 1SIWA 5KYWB 4LXUA 1ZMOA 4D4JA 2Q9CA 4RVOA 1W49A 5B1IA 4PYRA 5CK5A 4CBVA 4CEJB 3EXIB 1JQKA 3GJ4A 3D70A 2BCGY 1IXKA 2PGLA 4BO8A 4NXMB 1DELA 2J0QA 1BGYG 1JA0A 4EFKA 1FW8A 3UAWA 1QIJA 2FEWB 1OGIA 4IVRA 3IAUA 5IDQA 1IHDA 3FCXA 3VVBA 2GK4A 4OA8A 3K94A 4CODB 1YHQ1 1VJ1A 3RQIA 4BMCA 4E70A 2RT9A 3WMWA 3UWMA 3L7DA 4YRSA 1T2NA 1SFCC 3TKLA 4D0RA 1NTMK 3K1AB 3W1VA 2RH4A 3KEQA 4QOSA 3FTEA 4MGHA 4RM2A 2VP0A 2Y4NA 1W8IA 4DQLA 3UA3A 3DUWA 4TV8A 3OW2Z 3NOXA 2BKLA 2I6UA 2R7KA 3VX4A 1MVNA 4Y6QA 3U7QB 3JSVC 3U48A 2AYYA 1HQYE 3EXG1 2Q45A 2H2HA 4CIVA 2RMKA 3KP1A 1SVWA 3PL5A 3WSWA 2C54A 3P0RA 3QUCA 1JVSA 4YPCA 3QRWA 4EWLA 3TR5A 3QP9A 5EZYF 1Z9BA 2XOKD 5JSYA 5FPPA 4Q48A 5AK3A 5LU8A 1XALA 1Q0HA 2P78A 3QOFA 4E4YA 1W34A 4HLUA 2GVDC 2PCLA 4XIYA 4PBRA 4IMRA 2AF4C 1J0CA 3H25A 3JVIA 1OXZA 2HR1A 2ZTUA 3G6E1 1HL7A 3LK7A 3VYTB 3AZOA 2WTNA 2AMJA 2B0JA 2UZ3A 4NLLA 1W2BZ 3SZMA 2BRUC 2H1LA 2QLFA 1BE3G 4DPMA 4DTIA 1MV8A 3UW3A 5GVRA 3Q9SA 2X9GA 1UC9A 1XDUA 2E76C 3L06A 3HKBB 1KO4A 1JB1A 5GMOA 4NY1A 3DDOA 1BCCE 3LD9A 1OBFO 9ATCA 3Q98A 4TXMA 1HDCA 1NWHA 3V1KA 4DSUA 4G37A 4CLEA 2CB0A 3PXEA 2VDJA 4ZU6X 5KLIB 3OZRA 2H85A 5KOHB 3LBYA 4F11A 5JS6A 2EXXA 4W5HA 1LA2A 5C1PA 3VPGA 4C0XA 3F3SA 2IDZA 7AT1A 2PUHA 4GOJA 1QCCA 4MUKA 3CX5D 2XIJA 4FHFA 3HCPA 1CF2O 3PS9A 3GAAA 2G83A 3CIOA 4M9ZA 3WWEA 4Z3OA 5GADl 1SQ5A 3HWRA 1BJTA 2IX3A 4JSRA 1JLSA 1E3DA 3VX3A 3QWAA 4W80A 4BP8A 4HAXA 3C5HA 1JO5A 1XZ8A 1DIHA 3MD0A 3Q5RA 2BCEA 3ZLBA 5BSFA 1OX4A 3GFGA 3NC0C 2K87A 1N2IA 4CU2A 1U28A 1FU7A 3GA5A 2KE5A 5ARBA 4FMPA 2ZU0C 3OBBA 3HNPA 1X7GA 2B92A 3AP3A 5J2TB 2WWVD 1YQUA 4AX4A 4A15A 5HFNA 5JLJA 2XR1A 2PLRA 3GWZA 1TVKA 1WABA 4N6JA 1UEXC 5KTNA 1ORTA 3FE2A 3NYWA 3AESA 3U13A 4QDUA 2Q3JA 5KLVG 3K31A 2Z6QA 3V4SA 1S9DA 1C3OB 2BEZF 2P0EA 2J87A 1H9AA 1VHJA 3QPBA 2ZTVA 1JU4A 1V4VA 4HWGA 2V7QD 3AW9A 4GQIA 3OSUA 2PZGA 3V6IA 5J2UB 1N33B 2FPIA 1SQFA 1PN3A 1RRMA 3WGTA 3QKIA 1JKMA 4M0LA 3LW5H 1LWUC 4GKGA 2G7ZA 1XCBA 3AOEA 4CM3A 2BISA 4HZUB 4M76B 4MKGA 4WXPA 3IAM1 2ZYHA 2NT4A 5LQCA 1WXEA 1KE2A 4M49A 2PU5A 3HYTA 5AHRA 3VUEA 1UZLA 4MZDA 3ROKA 3OLZA 1BNCA 3GBVA 1YZFA 4M1EA 1U0GA 4HLNA 4CMIB 3D9XA 2ETXA 5ARCA 4RHYA 3E27A 1NM5C 4LXIA 4CV1A 1W5FA 4HNAB 1R8JA 5LJIA 3ND5A 3WAGA 4PFQA 4ESEA 3VRHA 4C4XA 2Q6QA 1Y42X 1JFLA 1NG9A 2QJFA 3OIWA 2Y9PB 3AY6A 3LC0A 3PBKA 1P9LA 4QQ8A 1JQ5A 3O8ZA 3MMSA 1Z8HA 2LIVA 2YNMA 3ZE1B 3X2GA 4A8JB 1P4RA 1U9YA 2BGUA 4PJ0E 2P27A 5JEDA 2P67A 2VBCA 1MIOA 1POXA 3ZKWA 1NL3A 2WPVB 1O6CA 5SV2A 4XFKA 4GBMA 1ZU4A 2PUWA 2C31A 2WHPB 4QJBA 5B1HA 4BC0A 2QG6A 3DTVD 3KT8A 3PFIA 5H68A 1BAPA 2JUBA 1E9RA 1D1QA 3ZI0A 2PD6A 1M0TA 2XUHA 4KDCA 4UAVA 4PLZA 3P26A 4XQEA 3MLAA 1NATA 1PL5A 3UV3A 3AVUA 1L0NJ 1BKDR 4U7FA 2C2OA 2QSYA 2V5VA 3EMVA 5EZYA 2JFGA 2F43A 3NOOA 1YI2P 1JWHC 5C5EA 5B66H 2HI0A 2IUUA 1JLMA 1XZEA 3RZOI 4LMPA 1CFJA 3ILXA 5E3HA 1J2TA 3Q8WA 1CXZA 2F1HA 3GJSA 2GPWA 2FUG6 3E1GA 4P2GA 1HMPA 4IHJB 2FZWA 1GGFA 4Y9SA 1JBEA 4ZI7A 1PIWA 4XWAA 4MPPA 5EMJA 5LOVF 5GONA 3PE4A 1WHTA 5G1OA 1YJ91 3QBEA 4UEWA 2P2SA 4ZCLA 3N70A 4R81A 5DEIA 1I7SB 4RX1A 5EHXA 3L4JA 1BJKA 5FTKA 4H1TA 4JJ6A 1PVDA 2E89A 4P8RA 4M87A 1J8FA 4RE6A 4LE1A 4PS1A 4X1IB 2OBBA 1RI1A 2O53A 1E3SA 1K7EB 1U4SA 1IWPB 1OU4A 1XZBA 1DIAA 3ND9A 2YOFA 1EUDA 1ODSA 4WVLA 2CEKA 2GARA 1P4HA 4AK9A 3B5IA 5E9QA 1O3YA 2D3WA 1NULA 1Y3AA 1AHHA 5EIHA 1E58A 3EZFA 4KC0A 3BCUA 4QTXA 3M9BA 2ECOA 2LCIA 4PS0A 5D3KA 1MZPA 4F8YA 2KYVA 2QY9A 4BZQA 5LKRA 1DFIA 5GZ1A 2KLHA 3RBZA 3PWTA 4DGLA 4DLYA 2Q0XA 3Q87A 1XRLA 4BDTA 4P7BA 4BZZA 2Z1MA 3R77A 1BHQ1 4F9FA 2RCYA 4RS3A 1HOXA 3SKVA 4I1LA 3Q5PA 2ZWPA 2W98A 1SFCA 2AJLI 4KQCA 4BUZA 3LF2A 2V6GA 3NM6B 4HDMB 4ND1A 4IZHA 3Q1KA 1S89A 1N9ZA 3V8EA 1Q50A 3DNMA 4ZANA 1A9XA 2VJNA 1T0UA 5IH7A 2HJSA 5DHSA 3VPDA 1RXIA 4K26A 2P79A 1EDKA 1Y1WA 2XNSA 2ONKA 4TV9F 5LBUA 1TZ2A 2HU8A 1TWAA 3N6RA 1N1DA 2A94A 3FZEA 4YPOA 3K35A 4KDLA 3GROA 4V02A 2IF0A 5M29A 1O08A 1UFVA 1K9SA 3UUFA 4MD9A 1Y1PA 5TRTA 1HZZA 4OQXA 3CYFA 3PHJA 1NMQA 3JALB 4MV7A 5EUCA 1ZN7A 1HE2A 4HMPA 4BNGA 5PGMA 2ZSIA 4DC1A 3UJHA 4MB0A 2LR2A 3QJYA 1VQMZ 2O05A 4D0SA 1EDJA 3P4YA 1RWXA 2UUOA 5H4HA 1H3EA 3PICA 4HUJA 3EFOA 2TYSB 1DKOA 4LHWA 1S2OA 2VNKA 1YI1A 1ACJA 1NASA 2ZAYA 5DNAA 3UK6A 5KC8A 3X1YA 3KDPA 2FEOA 4YCJA 5JS8A 2QS9A 5C4GB 1ID1A 3R23A 3D5TA 1SP4A 1X77A 4G63A 2QE7D 4O4IA 4HYTA 4J2OA 4O0MA 4LTNA 3TM7B 1VQ61 1MAVA 4N1AA 4AIIA 4FOOA 4MPDA 2VJQA 5CFPA 2VTKA 4LMAA 3PTAA 4PVDA 4ZVNA 3ZGLA 1FP4B 1BXGB 3IPRA 3V4LA 5A7FA 2JNYA 1QU2A 3HU1A 4N03A 2CLOB 4PE5B 3F98A 2ZETA 3ADCA 3H1IE 1RQPA 2OCLA 1BU5A 2QXYA 5ICSA 3T7TA 1LRKA 4R8SA 2J3HA 1D9ZA 4JD5A 5IT4A 2DKFA 1M72A 2BT4A 1JLRA 4L5AA 4Y28J 3W06A 3C6ZA 3H9GA 5KIAA 5BMOA 4EHDA 4X64B 1NMZA 4D44A 1RF1A 5C1DA 1F5SA 2JIPA 1THZA 3UQYS 2EOAA 1KQSO 5J1TB 2OD2A 3UOWA 1M6HA 2I9PA 3OPYI 1B0ZA 3CZPA 1D5CA 4HNHA 1IAVA 1BA3A 4KFSA 3ER8A 1RKXA 2BR3A 4Q9NA 2JI9A 5DISB 1BXRA 3E1RA 4HTAA 5LOVA 5CIWA 5JSQA 4F6RB 4X9XA 3F9IA 1PVVA 4NFSA 4S2EA 1GL9B 1M2VB 1DLJA 3FIJA 3NP7A 2OSBA 4BPBA 3RTBA 4Z4CA 1TA0A 1KBQA 3QEMA 3I04M 1PUIA 1B7GO 1M2EA 2B1QA 1NT4A 2A9KA 1UP7A 3JVEA 4N5HX 1SK9A 3D4BA 1U6JA 3GTGI 3VOPA 3CR8A 2DM6A 4X1KA 2BKEA 1YZHA 1WQ1R 2H1RA 4XVQA 3DOJA 3U44A 3HRNA 3HGQA 1FX0B 3DMNA 4MWTA 3IJ5A 1L7QA 3W2HA 4IXTA 4IFIA 5JOQA 3UJNA 1ISFA 1VSQA 1NM5A 4GR9A 3VZDA 4OVNF 4OQEA 5HK8A 4Z7JA 2GCOB 3D2BA 2ID4A 1DMSA 1N7IA 1PI3A 2J3DA 3NUGA 3GF4A 4IILA 3Q0IA 4M8KA 1YOVB 2CPBA 4PD4I 3OZTA 4YLGA 4BXOB 4Y2PA 1ULSA 4MA4A 2QX9A 1EFUA 4A73A 4NFYA 4CMJA 1W35A 3M0EA 4JL8A 5B36A 2X6TA 3VHRA 1V11A 2HBQA 2FFDA 2UUCB 3ZJ5A 4AYXA 4F86A 1DH3A 3DVAA 3GP8A 5AW8A 4MEAA 4UUOA 2Q29A 4TL8A 2QREB 4G0UA 5F2NA 4B7UA 5LQUA 1NTKK 2X8LA 2B63A 3ZWMA 3VYIA 1SQVE 1NKVA 4KVAA 1EK1A 3M49A 4HWKA 1CQXA 4NULA 5U9CA 5HF8A 3CGGA 3KSAC 4QBHA 3EH1A 2FF5A 4BVAA 4RMJA 1URQB 4TV9A 3GTLI 4J49A 4XEUA 5TF4A 2YIVX 1NF8A 4B9EA 5DHQA 1OW8A 1KYOD 4RK1A 4ZM7A 1DTEA 4OA5A 1ZIPA 2V8KA 1NFQA 3WB1A 2PRYA 4Y2SA 3OT5A 5CBKA 3I5YA 3H1KD 4N5DA 2P9ZA 4F91B 1NUQA 2FW1A 4OLHA 2DWPA 4I50F 1MXFA 1T2EA 4NBUA 3TJZA 1YBMA 4A0GA 2QWXA 1DO0A 2WSCH 2WYUA 1K05A 2CF5A 2KLVA 3K72B 3ZN2A 5AKZA 3WMRA 1XHEA 1QBGA 4XXHA 3NX4A 4CM1A 3H1LJ 3QUTA 2QAIA 4ZDIA 3WRXC 4RKYA 2KUBA 2P0AA 2OZEA 2GFHA 2VJOA 3SF0A 3I9OA 2ODNA 3VR5A 3OH8A 3CWZA 4G23A 2QRGA 3TW8A 4I9UA 4MD7A 1SELA 3OKCA 3RR2A 4IHQA 3I4NI 2GEDA 5ALVA 3O8BA 2Q6KA 1R4ZA 5J59A 1VSUA 1QVFO 3V4QA 2PDAA 1PX0A 4O2BA 2QRJA 5DTJA 1VKZA 3A4VA 3GIWA 4MRVA 3C3KA 4FFOA 4KO3S 1L4MA 1PZFA 1U3CA 2OMEA 1JWAB 1JEQA 5JYEA 3KB2A 4AG3A 1B16A 3GJRA 1EB9A 5IP5A 1SXHA 1JEYA 1RPAA 3DV0A 5JAOA 4IL5A 5DYWA 1U3TA 1ZUD1 2BZGA 3FHLA 1DC4A 4FJ1A 1V45E 1G5TA 5CNKA 3VR4A 2JKZA 3S1SA 2X5OA 2VYND 3ZZUA 1JIQA 1T0PA 1JUNA 5GTHE 5C37A 2Z2XA 3T15A 3G49A 3D0RA 3BFVA 4X7MA 1DWPA 3QGMA 1VQNZ 2PJZA 1PQFA 4UFOA 2XUGA 4F93B 4BY1I 3ZPXA 4MA0A 1YFZA 3GFSA 3U80A 3B6IA 1O8CA 1C7IA 1QLWA 5IAEA 2AS0A 3LQQA 3B2NA 4B80A 1KMIY 2ZUCA 1DCTA 2K2WA 3JD0A 1J2JA 1CJSA 3LPDA 4C3OB 2Q2QA 3EQ9A 1ZRSA 1SKYB 4LXYA 2E2JI 2DECA 3FVTA 4AJ4A 1WW3A 1JI3A 1EP9A 4R83A 2ONCA 2XB4A 1OFVA 3CUWA 1XU4A 4Q3CA 2HLHA 5JNUA 2PG3A 1Y5IA 1ZH6A 2XWBF 4J7UA 4ID3A 3W2EA 1VPCA 3RFUA 1QG6A 2JFBA 3BGSA 3IMFA 2P10A 5JRJA 2AOUA 5I9SA 2MIIA 4LZNA 3D7RA 2VDOB 1SVNA 2IBTA 1CQIB 4Q03A 2FJUA 3MWEB 2XZRA 2WB4A 4NNJA 3ZHSA 1J39A 3GFFA 3CWBD 1VQLP 2Z2YA 3QM1A 3UV6A 4EG5A 4TN5A 1ODTC 2OD9A 3MEQA 2UYOA 3KBBA 4DL9A 5A5VA 3M91A 5C4IA 4FHEA 2WKWA 2GM9A 1Z0IA 3C8ZA 5BNWA 5IZCC 3V2PA 1KYTA 4EGAA 3SC4A 2BF4A 5I47A 1L4HA 1L5HA 1IK4A 2JAQA 4JCWA 2XEDA 2XOKA 2YBEA 4HWRA 3I8OA 1R5JA 4JLAA 1YI21 4TYNA 3HXLA 3ITDA 3QE2A 1P2TA 5A2QA 2QMOA 3KSMA 3TTVA 4DNPA 3MD9A 1U2DC 5BT8A 4ND4A 4HGRA 3FYSA 1GQ2A 1QP7A 1F2UB 2VH5R 1G8SA 4BNFA 2VF2A 3MVEA 1L5ZA 2O1SA 4UAJA 1P31A 4MN4C 1CHDA 1F51E 4FQ7A 3HD7D 5E7MA 4E3WA 3L5OA 2XT9A 1KYVA 5AI8A 1I30A 3S27A 5BYJA 2JD0A 3BCCJ 1JIUA 3IUMA 1MJNA 3LECA 1GR1A 3GTOI 2KLUA 1ZK1A 4FFMA 2K4MA 2W71A 2YH2A 1POWA 2IV2X 4UKDA 3GDGA 1BYIA 4PLYA 3LYLA 4QGBA 3KLBA 2AN1A 2ROQA 1C1YA 4AUKA 3S9OA 3RRJA 4WN9A 1HA3A 1NGSA 1GU7A 2J3JA 2X9VA 1YLEA 1BE1A 1U7OA 3PO3I 1M6VA 1Z3CA 5I4CA 4GXTA 2HNAA 1UBKS 2I03A 5KOJA 3A1UA 2PBLA 5CVVA 1UPCA 3UGTA 4YCLA 3EZNA 4XDHA 1JAYA 4MUNA 4IF6A 5JZOA 4L57A 3IODA 5D5QA 2ZT9D 3U5ZB 1OLSA 5DI3A 2G5GX 4YAFA 4FVTA 2FGKA 2VG8A 2HRRA 2PUTA 4FW9A 1H2BA 4Q6WA 2D7DA 2EKLA 1DC3A 4ID9A 3MCAA 1NNSA 3WK7A 1X1EA 2G4VA 2RAUA 3BVPA 2OBNA 2HGZA 4HNQA 4KYIB 5EUQB 1A9SA 2HSGA 3TGUJ 4MKIA 3SUMA 4M6WA 3HWSA 2HA4A 1DDIA 4JU8A 1Q822 5HKKD 4X00A 4GE3A 3RWOA 2DLDA 2QI9C 2DFTA 1UHDA 5FQOA 1SQXE 5JRZA 5A62A 1DBVO 4MRIA 2D5LA 1K88A 3ZXXA 2QM7A 4Y0VA 1JJAA 1EJ6A 1AO3A 2ZT6A 3ILYA 2WUGA 3DVSX 3U2QA 4CNBA 4KP7A 2AV6A 4NFHA 2ZRKA 3X1WA 1NYHA 2INGX 3MJRA 3VMFA 5K7SA 4YAIA 2C2KA 2V7QA 2ZG6A 4LF4B 2Z08A 4HRVA 5CCHD 4LY6A 4DDHA 4LSMA 3NTNA 1EWTA 3HKZA 3I9JA 4I1SA 1JKXA 4JLBA 3TYXA 3IAEA 1K4MA 4N47A 3M4OI 1S4MA 3RS0A 2Z57A 4GNKA 3LQ2A 3QQ5A 1E2EA 5AOBA 5HUQA 1DAMA 2BI8A 2GZ2A 3RRXA 1WOMA 5NLLA 1MX9A 3LM8A 4OHKA 4NPFX 4R05A 2WUFA 1VQ5Z 1XTUA 4YRRA 3Q8LA 2I99A 3LUPA 2LNDA 4NJMA 3A3YB 2MR5A 1S72P 1ZXGA 1SHLA 1B1CA 3IAOA 2Z2JA 3BDAA 1K73Q 2DPGA 2QGZA 4QZVA 3OC6A 3O2SB 4HEJA 3FPCA 5FUVA 2I8AA 3IGFA 4JXZA 4RVNA 3O8OA 3T9DA 4IIGA 2A1TS 3UUGA 1BW9B 4O2RA 1GU5A 3V9PA 3LKZA 4L9RA 5A4IS 1AK2A 1KSJA 1HL3A 1QS0A 5E7QA 5M3BA 4JJAA 2PAJA 3MGBA 2ODAA 3MTQA 1L4EA 2X8BA 2OYSA 5C4MA 2GF0A 1T3JA 2AFHE 1NTZE 1SQQG 2V6FA 1M1NA 4DZRA 1EXVA 5EYPA 2IT1A 3ECSA 3TS1A 1KRHA 3MUFA 5AW1A 3ICQB 3DTVA 1CJBA 4IYRA 4Z6KA 4Y2UA 2ASVA 1AQNA 1V5IA 2B8JA 2XXBA 4LDNA 3WRXA 1G8KA 4ETIA 1IOVA 4I3GA 1OX3A 4D81A 3DL4A 1M1KQ 3FLMA 4CJXA 1G9XA 3HKDB 4C0SA 5CDGA 1DEOA 4DEYA 4KUGA 4KO8A 1U04A 3QKSB 1QDEA 3VPSA 1L4LA 1KTIA 3IE0A 4LC9A 4UEQA 3O6QB 2QI9F 2VZEA 2NM0A 5ALWA 4C88A 2MINB 1UWKA 2O3SA 4MV0A 3SJ7A 4ENQA 5FXMA 3HJNA 4OB6A 1V3UA 3CZ4A 4EY4A 1XB2A 4DHEA 3TUZC 3JV7A 3P0HA 2F8SA 2P2ZA 1BSNA 1JHVA 4UASA 3HUSC 3T97B 3MOGA 1VQ4Z 4BQNA 5TISH 1FX1A 1L5OA 1TGYA 4KGZA 1DL5A 1L7RA 3AB7A 3ASVA 2HNKA 3KYJB 1N2EA 3BJMA 2XQJA 2OG2A 4OFZA 4FR5A 4B8ZA 2F7SA 1B74A 2E74D 2Q9AA 3REFA 2B0CA 2A9FA 3AZPA 4V1CI 3NTOA 5CK4A 1XVLA 1E61A 2D1QA 4DXDA 4P22A 3KOZA 4GDOA 3PPVA 3EE6A 2VP5A 2ZCJA 3FYUB 2B78A 1IOZA 3S1QI 2VPIA 3BXPA 4LHVA 1E2HA 2IDKA 2DPMA 2NYVA 2TMGA 1GQQA 3VZSA 2H5LA 4Q4AA 4RDIA 5ADWA 4WFKA 5AVYB 2AR9A 1KH2A 3QQ7A 5I8ZA 3NV7A 4B6SA 3H4IA 2M0BA 3UFXA 1YONA 5A5EA 4P5PA 1EZ1A 5CM9C 5B3LA 4QE3A 3SVZA 4WJLA 3BB4A 1DJLA 1E0SA 2FU5C 1M2GA 1AGPA 4JDUA 3H3XA 3SQDA 3TE5B 1PFUA 5MGNA 4L4RA 3UANA 2HXYA 3ENZA 1Z8FA 2TMKA 2ZSAA 5EJEA 1PWYE 5LM3A 4WY5A 3AHIA 1NE7A 3U7RA 3RK1A 1F3OA 2PH1A 1XPJA 1N4DA 4EA6A 4DLWA 1H8ED 5H02A 2G67A 1FTYA 3PLXB 2YKGA 1Q0SA 1ORRA 1ZOIA 3CG0A 3STXA 1TQ2A 1YRAA 4G2TA 2OHHA 1SUSA 1HT2E 1N2JA 5AHXA 1RLTA 3EB9A 1NU1E 1F8GA 2E49A 1YZTA 4RJKA 5C8VA 4IOMA 3SYRA 2MYUA 3BK2A 5M5BA 2B6HA 1JFFA 5IZCA 3CXHI 3WV4A 1A82A 1KVRA 2Y3IA 4K03A 4QDKA 4PG6A 4O1IA 2IFTA 3LC1O 4YROA 2WP0A 1Y37A 4AYCA 4KO1S 1S5LX 2C4MA 4AJHA 3QOWA 2W8ZA 2IYOA 3NS7A 3ZBPA 4JOQA 1QTNA 5IW8A 3HE3A 4YQEA 3DS8A 1JR6A 2HODB 1M1ZA 1NJ5A 3BG1B 5B3JA 1JP7A 2DHCA 2WF8A 1PQHA 3P2YA 4QLOA 2I2XB 4IH9A 4R9VA 2OZPA 2ZBEA 3PUKA 1S9KD 3E7KA 4WUVA 3R3UA 3V42A 3VKFA 3VI3B 3DR5A 1FC2C 1XA3A 4ZEOA 4BP9A 3I9KA 3RAJA 1GPBA 3ESQA 1Y6FA 5APXA 2OBFA 2OZLA 2C04A 2A58A 2NU9A 4OBWA 3DNFA 1UKVY 3AEBC 4EYYQ 4GPTA 1JT9A 2XQGA 1DGQA 3H6PA 5B30A 1G2IA 1WT6A 5C3EI 3NXSA 1RLIA 3ZE9A 2Y9YA 2QE7A 1FCJA 1KEZA 4HN9A 3VKHA 3UOGA 3QTLA 5I9MA 4JUIA 5AVZB 3H8WA 1K6MA 1T25A 2A2ZA 1TA4A 4G2NA 4Y1GA 3WLRA 2WWWA 4DA7A 3ABVC 1PFWA 2P6NA 2OUKA 2J3IA 3TSZA 1UT6A 3DT8A 1QMPA 4UMVA 3VC1A 3BHIA 3OM0A 4JQSA 1KZ1A 3E9DA 3G68A 1TC1A 1W4LA 3A32A 3VNUA 2BJOA 3KSZO 4PXSA 1H1LA 3NGLA 4GI3A 2WNHA 4DR4B 5TVGA 4F2HA 1U9IA 1G2CB 4A23A 3WSTA 2W04A 3OZDA 4NJEA 3BSYA 1RQLA 2ORVA 2MTBA 4BQOA 2MSCB 1OI7A 1TKAA 1NJIQ 3DZ8A 3DW3X 1QIEA 4LHZA 5E8RA 3DB1A 4DUYB 4ZPXA 1WPXA 5HQTA 2N1TB 1IJKA 2WAYA 1FLVA 2FG7C 4BFSA 1WTAA 2I76A 1M8JA 3DGFC 2W2NA 3UHPA 1SQPE 3ESZA 2PUJA 3A25A 1TJ5A 3E3AA 4IXMA 1R0XA 3ABZA 1YJNZ 4DV3B 1C2YA 1WUYA 5A3RA 3L73J 5JRDS 3IOCA 4FC6A 4DLZA 5JEEA 4LZLA 1VRWA 2WVRA 1U4OA 2R68A 4LJ8A 3ZXYA 1R0KA 1HUCA 4BO7A 3GT0A 3QEAZ 1XK7A 4PQGA 3IMEA 4LBVA 1MC4A 2ZVQX 1Y9EA 1MFPA 1OTYA 4RV5A 4EJSB 1F0KA 1ILEA 5FTJA 5DBOA 1PR2A 3KIFA 2K2QB 5ED0A 2HEIA 2FV8A 2QZSA 4E03A 4WUTA 3THRA 4OAQA 4EYSA 3OQ1A 4PZAA 2YJZA 1KB9D 3BMCB 3HGTA 2DJIA 4LGYA 3VR6A 1VQL1 2A35A 2JGFA 1JT2A 1QHSA 3DEYX 3I23A 4H0CA 1GZ4A 3KK0A 1A3CA 3G85A 3KTOA 2M6NA 4ZQBA 1YRQA 3TQRA 3A0HH 3QVUA 1I01A 3KKEA 1CEYA 2NVXA 2CJFA 2GDJA 5CCHC 1O2DA 1HD5A 3F2IA 3RT7A 2QM8A 3SBXA 4H7HA 2EDAA 3ZVNA 3VAZA 4BMSA 3E1SA 1UINA 4KAXA 1OGJA 2PIAA 1B4DA 5KNCH 1AIPA 5L7TA 2YO2A 5I7FA 1OI4A 1HG0A 4GS5A 4Y7CA 3PUWA 2D2CB 3CZ9A 1NOKA 1YULA 4GPAA 3OHPA 3S2FA 1AV7A 3COPA 4RFSB 3WLQA 4HDKA 3P7KA 4WNCA 5HA5A 4IG9A 4ZKUA 3AUXA 1L5YA 1AA9A 2CHEA 1DEHA 2JEEA 1JX6A 1CW5A 3GAZA 1PS0A 4X8HA 1Y80A 2ZI4A 3TQSA 1P1FA 1T0BA 3VBEA 3AM5A 5DXJA 3GGCA 2H4FA 1KDRA 2WJAA 2W2QA 4N39A 2Y1DA 2J9RA 3MXTA 4RNCA 5ITVA 3L7KA 4JI8B 3STHA 4E1BA 3RS2A 1R5LA 2WUEA 5DBFA 1GFWA 2W27A 4OQFA 1NVXQ 1OVGA 4JENA 1FK8A 1DKLA 3CCEZ 2JH9A 1QKIA 4BIIA 4B35A 3RVOA 1O87A 5DFAA 3CKYA 5LXTB 1EXWA 4C7JA 1FZCB 1IBMB 4KKXB 3R74A 4XIGS 3V8PA 3HUSA 1Q2NA 4MMXB 1LZLA 2YOGA 4WLEA 3BG5A 3WLJA 1VQPP 3CCL1 1INLA 4BB0A 2CV1A 5A6VA 1P75A 1ZOOA 5LWHA 2BZ1A 3K70D 3OJ0A 1LQLA 3NHKA 3BMNA 3NHZA 1UFOA 3M1YA 2ZRCA 5J58A 5HMLA 3I30X 1K8A1 3CF6R 1MC1A 4OAOA 4L8VA 1XC7A 2JWAA 3S1KA 4EG7A 2BFAA 3NBAA 4YMHA 2XJ4A 5DYNA 4V0RA 2HJRA 2DFNA 1L1RA 4CDNA 2BFEB 3CZ5A 2L0XA 4DR5B 2R85A 1JFTA 1NR7A 1VDZA 2VHVA 3ET5A 4L4SA 4IFFA 3DBLA 1NVOA 5IKPA 1HSZA 4D6TJ 1I36A 3B2EA 4ZHSA 1FLDA 1N3LA 2V54A 1SR8A 1SKMA 1XNHA 3BB3A 3GEPA 3CZAA 2H51A 1E99A 1R0RE 4RVGA 1Y5RA 1Q22A 2R00C 2E74C 3EXG2 2IOFA 4DEXA 2FVXA 3H8SA 3WWYA 4WK4B 3GCXA 2J6AA 3WL5A 1M73E 1L4AD 2VYNA 3N2KB 1E3JA 4M7WA 4RK6A 1LD3A 4U00A 3AG5A 3F3KA 3K0FA 2AT1A 5JFOA 1V0JA 1WSDA 3LUAA 1E1KA 1WHSB 2PYZA 1RR6A 2ST1A 2HT6A 1LTBC 4QU9A 1Z39A 2P65A 2OM2A 2RBGA 1PCXA 5DHPA 4R7TA 3G7UA 4H35A 3G6KA 3PNKA 3A4MA 4K8RB 2BEJA 1RJ9A 1E2GA 1PYDA 3F7NA 4JNCA 1GNTA 3O3OB 4KNWA 3F6EX 4YN3A 1AV1A 3FWPA 1JHAA 1I5RA 4HO1X 3WZMA 1CRPA 2FHPA 5I7AA 3HOUI 5FH9A 1EMDA 3FXAA 3IEVA 1D3AA 3AFOA 4JT2A 4WBNA 2HK8A 4KR6A 4QBTA 1N7SD 2PGNA 2PKEA 1F0YA 2GCGA 2P2NA 4YRFA 4HX2A 3M3DA 3V2QA 3CW9A 5CT9A 2K37A 4FGWA 1ML8A 1BX3A 1PKXA 2IITA 5F33A 2O23A 4ZI3A 1K9M2 5JO0A 4MVJF 4MULA 3GH1A 2C4NA 3CVVA 5REQB 3QBJA 1YJWP 1X92A 2IS2A 5DRTA 3UHOA 4ICIA 1UIXA 4BWNA 1ZH1A 2OXRA 3FF1A 3MJFA 4ZKDA 3H1HE 4HGYA 4Q9AA 3AEGC 3DF7A 2NSLA 3F5QA 4EGFA 2ZRPA 1KQGA 3T9AA 3IA2A 5F64A 1RWBA 2PUBA 4EG4A 2G76A 1OWOA 3EIEA 1TCVA 4EBBA 1GPDG 2MSEB 4NB8A 5AJVB 4DMLA 2ZVDA 1NRXA 5A4JA 3MJHA 3O92A 3R24A 2IUEA 3E82A 2CLFB 2X3YA 3KKMA 5AW9A 1BW3A 1Z33A 4KI7A 2KHZA 4RTJA 2VPPA 4KHZA 4F1JA 1OU0A 2C7RA 2C7OA 1K9M1 3A1DA 2WRZA 2RJOA 4WQMA 3GARA 1F12A 3HBLA 1FFXB 4EM6A 2E9HA 3TI7A 13PKA 1I2ZA 4NQRA 3I2YX 1DDOA 3HD7A 1AVTA 5EXTA 1KBOA 4JJ7A 3JRNA 4HT3B 2JGDB 4EOTA 3DZKA 1B2RA 5F52A 3U3MA 2O2DA 3WXMA 3ERCA 1GQSA 1GZHB 4I08A 2JLCA 3CCUP 5HM6A 2JBAA 3VMMA 1RMYA 4RMHA 4IMIB 2ZQ5A 1USWA 3GG2A 2B4YA 3MWFA 4MIKA 1PBNA 3U62A 4PONA 4ENWA 2PK7A 3G0CA 3DJFA 4WTOA 3L82B 1D07A 4EPVA 4LDRA 4D3SA 3WLTA 3S81A 2DWUA 1J2UA 4EW1A 1ZITA 2NW6A 4YP9A 4ZTZB 1GYPA 3ESBA 3FJYA 3ZUGA 4PYJA 3TOXA 3VNQA 2QIPA 4BBAA 1KR5A 2J4FA 3GPDG 3VNRA 1M7HA 5FPKA 5DJTB 4M0PA 1C4KA 4ARSA 5BYBA 3DP9A 4N78D 3GF7A 5HKKA 3UB3A 5G1NA 2NSHA 4ZCMA 2MCFA 5F2EA 4P4TA 8GPBA 2AMFA 4CETA 1C7EA 2Z1NA 1RM4A 1PL0A 4KJMA 4LHXA 5KAPA 1KSHA 3V8QA 2RHRA 3UJDA 4UAUA 1AM4D 3RT9A 1HDGO 5LQDA 4FONA 2YQ5A 3OUGA 2OAQ1 5IN4A 2YINC 4DQXA 2HCTA 2R86A 1EXNA 1L7BA 5EJ4A 2W8BA 2K9YA 1IO4A 1DINA 3REQB 3RRFA 4RLHA 5K3SA 4PC7A 1JXQA 5CCHA 4R2LA 2E9SA 5APVA 2EYUA 1UT8A 3BGWA 1M2OB 2H1WA 2GJAA 4K8OA 2WF7A 4RIHA 2G80A 1VYVA 1PLJA 2JF0A 9MHTA 3SSNA 3PCTA 3FUXA 3STWA 3S1MI 3JZAA 1OVUA 2F9LA 3B3AA 1H2HA 4BRSA 2WPSA 4KR2A 3KELA 1MX1A 1XEWX 3WWPA 2V6BA 2B82A 2PT5A 3NBXX 4RV4A 2YIMA 5F4ZA 5CFLA 3DFMA 2C8VA 2HM7A 4I5EA 3UQZA 4B1FA 3HU2A 2QA5A 4HEQA 4MVXA 1ND5A 3S2YA 5J4YA 4FKZA 4QRHA 4MYRA 1UJ5A 1E7WA 4U7JA 4BNKA 2W5UA 4UJ3A 3FDZA 1TWFI 4EW2A 4JQCA 4IJMA 3I32A 4XD7D 1U9CA 1H1TA 1YKSA 3CPWZ 3GLMA 4L0DA 5AP9A 2QY6A 1I50I 4BATA 4GVPA 4UBJA 2JGLA 2EX0A 3CZMA 3SJZA 4UB8E 4M86A 4NS4A 3EW9A 4OHFA 3K4HA 4OEHA 3CMAZ 1A7AA 3MAGA 5HJ2A 3WJ7A 2FYNC 1NAYA 4L85A 2YZ2A 2DJ5A 4DT1B 3LKVA 2Q7OE 3LVFO 5DM4A 4KNVA 1DEAA 2CLMB 3DTNA 4CCYA 4CMKA 2QTRA 2OQRA 5DTQA 5G1PA 2VDVE 4FWTA 1Y6JA 2QTBA 3EVEA 4BQSA 4TM7A 4UU1A 1CE8A 4RA9B 3G8AA 3DFUA 5AHWA 2H00A 1UFKA 1XU7A 4GM4A 2A68D 2YHIB 3ZK7A 3HFGA 1XNRB 1CNFA 1P8JA 2ONYA 2IHTA 4LZOA 2WQZA 6ABPA 4WKOA 1NFFA 4RQBA 1NTRA 1FAVA 3X1DA 3ZE0B 4DWOA 4PQRA 4G5OA 1WIIA 3L70D 4MLDA 4Y7DA 4QYTA 1HYQA 5G4LA 2HRBA 5FEMA 2HUPA 4YH1A 5GIPE 4M21A 4OD0A 1SC1A 4GSYA 4Z0HO 4RORA 1UWLA 1T1IA 3WDMA 4TL9A 4JYBA 2R6AA 2DT8A 3DMDA 4PLTA 3SIWA 3U3OA 1JQ3A 2Q9IA 2GEFA 3DHEA 3C45A 2VTBB 3L92A 2WU0A 3WHKA 1BGYD 1I3NA 4LWOA 4AQRD 3G2KA 3PPIA 5G4KA 2ZS8A 3SQNA 4JVSB 1QTQA 2M5AB 1U1FA 2ZRMA 1E62A 1E1QA 2PQ0A 1Z6TA 2RKBA 3I2KA 2R00A 4R2JA 1M7LA 1T5TA 1PZMA 4PICA 3IIMA 3D3JA 4KVGA 3K70C 3HYSA 3VO8A 4OGWA 2ZQZA 3O26A 3K9WA 5FLEX 3I09A 3W79A 3MTBA 1BQEA 1Z4OA 4ZOEA 2GFQA 5AK4A 3FVQA 4W82A 4MS1A 1P80A 2BDUA 1U6IA 5TB5A 4OU5A 3DBRA 1PV2A 5JI2E 4J0CA 3HE5A 1E2KA 1SBZA 2I3BA 3GFQA 4XWYA 4B84A 1ZI9A 2RC5A 2YFQA 2DUMA 4PZEA 2G3YA 4EHLA 3EWIA 4QL3A 2V03A 1U90A 1A50B 3P9YA 4IDAA 3L72G 3GLHA 5E3JA 1YQ3C 3M4ZA 3VM6A 2O50A 1RF0C 5AW5B 4D5GA 1A97A 3WGJA 4RELA 3NBUA 4DMGA 3VO2A 3TUJC 2PSFA 5K0CA 1DXQA 1L4AC 1RO2A 3FHOA 3KL4A 5BUQA 1F7UA 4UZFA 3DDUA 3ENQA 4HB3A 3FOZA 1N9KA 3SS9X 3AECC 2C7GA 1TMOA 1H8EA 3TD9A 5AW6B 1P9WA 2JR6A 1BE3D 1ZINA 3NHPA 4GPEA 4H13D 2AWNA 5C1IA 5JVDF 2IOFK 1NBHA 1E9DA 3FYTA 3P9SA 3WRVA 4TVKA 4DIDA 4ZVOA 1J20A 3FDFA 2OXFA 4XIFA 1QGKB 2OSVA 2VDMB 1QVGZ 1ZL2A 2ZKLA 1IFPA 3QY9A 5KAIE 3MWKA 3QU2A 1MW8X 2BRUA 4RY0A 3DUFA 1QLHA 3ZCQA 1EWRA 2ZLBA 3K7EA 1A5BB 5LL6f 1RC8A 4FDUA 3BWDD 4HB0A 3VB9A 1N7SC 3A1FA 4N5LA 2XKBA 1NVWQ 4ZYWA 3E3NA 3O3MB 3T1VA 4IDHA 2NXEA 3TOCA 1RC1A 1ZN5A 3D8NA 4AKSA 1JZTA 1R16A 5FTLA 5IWAB 1A71A 1MO6A 2M32A 4EPYA 1FE8A 3MSXA 4F4HA 4REQA 2JBHA 4KLRA 4NBAA 1KPGA 2Z8YM 3L6BA 3GEHA 3JX9A 2AOWA 3I55P 2QMUA 1T43A 3R7SA 4LISA 5DHRA 4HB1A 2XJ9A 3QXGA 2FHSA 4DXHA 2YV5A 4NENA 2WT7A 1JXAA 2OBXA 4HGOA 4TYQA 3IN6A 3H0EA 5FOSA 4JUBA 1J9EA 2DUUA 2AEJA 1STOA 2TS1A 2BIFA 1AUPA 2CGEA 5DMXA 4P2BA 2ECQA 3PA8A 4G0MA 3PQ4A 2KS1B 5KLVD 1KI4A 1UODA 1XMIA 5JPCA 1Z17A 5U1PA 3Q5GA 3REOA 2QJPC 4L15A 3S1NI 4ZT2A 4C2BA 1P84H 4C06A 1GEGA 2QK4A 3IBFA 1HFJA 2QTWB 3O47A 3R20A 3WO0A 1JAXA 5KWIA 5EP2A 4P38A 1X8XA 1Y1QA 1F0PA 1NNI1 1LVGA 5KNLA 2CBZA 5CVUA 3PGVA 4U3FD 3AVTA 3GUUA 4X1YA 3WXBA 1V3VA 3HPQA 3IRVA 1PP9G 4WKPA 3DC2A 2J3KA 2WU1A 4TSKA 3UJ6A 4DRYA 4MGEA 2RHDA 3DT9A 3EFBA 1KMHB 2Z1DA 3DA8A 1X3WA 3C8MA 3D3NA 3E9QA 4NBSA 1LP1A 3FCCA 2YU9I 5TQ0B 3X3HA 2JVKA 5KHOC 3QI2A 1BS9A 4J2TA 3U1CA 1LWUA 2DB3A 1ZP0C 3SEAA 2X5JO 4H59A 1RVDA 3TNUA 3DKKA 4X5OA 4AJLA 4H7PA 2H1CA 1R50A 2TMYA 1SKAA 2IBZE