The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
265
|
sequence length |
715
|
structure length |
715
|
Chain Sequence |
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Escherichia coli
|
molecule keywords |
FORMATE DEHYDROGENASE H
|
total genus |
265
|
structure length |
715
|
sequence length |
715
|
ec nomenclature |
ec
1.17.1.9: Formate dehydrogenase. |
pdb deposition date | 1997-01-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00384 | Molybdopterin | Molybdopterin oxidoreductase |
A | PF01568 | Molydop_binding | Molydopterin dinucleotide binding domain |
A | PF04879 | Molybdop_Fe4S4 | Molybdopterin oxidoreductase Fe4S4 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Single alpha-helices involved in coiled-coils or other helix-helix interfaces | Single helix bin | ||
Mainly Beta | Single Sheet | N-terminal domain of TfIIb | ADC-like domains | ||
Mainly Beta | Beta Barrel | Barwin-like endoglucanases | Barwin-like endoglucanases | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold | ||
Alpha Beta | 3-Layer(aba) Sandwich | Dimethylsulfoxide Reductase; domain 2 | Dimethylsulfoxide Reductase, domain 2 |