1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
1PYUB 4GA6A 4KDIA 1YLEA 4QIWA 4AZDA 4CS0A 1KQFA 1SFOA 3GTOA 2JIOA 1E5VA 5GLFA 5T5ID 2R93A 5DYGA 2JIQA 3HU1A 1AW8B 1R9TA 2KI8A 1E61A 3HU2A 2IV2X 1Y1WA 1PPYA 1WCMA 4AAYA 2G8YA 5EPPA 3CF2A 3TM7B 3H25A 1H5NA 1VC3B 2YU9A 3IN6A 1I3QA 2C45A 4AYBA 3GTKA 1DMSA 1UHEA 4CRZA 2VPWA 2VPYA 1QCSA 2E7ZA 2V3VA 3PLXB 5C1BA 1CZ4A 1Q16A 2JIMA 2V45A 1PT1A 5T5MD 3GTJA 2IVFA 1WMKA 1DMRA 1SIWA 2NYAA 5B6CA 1I50A 1OGYA 3IR6A 2NAPA 2JA6A 3FKIA 1CR5A 3QQ8A 5FTNA 1TWGA 1FDIA 1QDNA 2JIRA 1TWHA 2JA5A 2VPZA 3HKZA 2DMRA 3H0GA 5FTMA 1PQHA 5DYIA 4GA5A 2NVXA 1ZMEC 2R7ZA 1TMOA 3CQZA 2WB1A 1H0HA 2VPXA 1R7RA 4KLNA 5C18A 3IR5A 2VUMA 1IW7D 4AONB 3GTQA 1FDOA 1Y1VA 1KQGA 2JA7A 3QQ7A 3O5AA 3QWZA 1EU1A 4C2MA 1Y4ZA 3TIWA 3GTLA 1AA6A 1AJYA 2E2HA 1E18A 5FTKA 2WAQA 3QC8A 1Y5IA 4D7ZB 3HU3A 1G8KA 3IR7A 2NVYA 2EEOB 2Y0SA 2R92A 4DMRA 3DMRA 1G8JA 1E32A 2JIPA 5FTJA 1TWFA 5FTLA 3GTPA 3ML1A 2PJHB 4RV0A 1OMIA 1PYQA 2P10A 1K83A 1S3SA 1WLFA 3GTGA 1PQEA 1PQFA 1UHDA 4KODA 2PMZA 4CRYG 3OUGA 4KO8A 2B63A 3O6QA 1CZ5A 1TWCA 2E2IA 3GTMA 1PT0A 4KDLA 1TWAA 1E60A 4AOKB 3EWKA 1R27A
chains in the Genus database with same CATH superfamily
4CIXA 4U3FD 3W2FA 4ZHQA 4JI7B 1H3EA 4B3BA 2Q5LA 4AP5A 3IHKA 2OENG 2YXDA 1QP4A 3JW8A 5HIJA 5AO9A 5A0VA 5JROA 4A7PA 1RR6A 4GXRA 3SQLA 3SS7X 4Y52I 4C0AC 2PA0A 2AA3A 2HMWA 2WJ4A 1IXKA 4K87A 1XA4A 1JDUA 3FKQA 3DCIA 1W0JA 4D1YA 2BMWA 2E4XA 4GA5A 3TIGA 4WWIA 2QBYB 1JR6A 1UBGA 1OYOA 1CI6A 1KC82 5LJIA 2PM8A 4I55B 1ZXLA 4M1SA 1KRXA 4BFUA 1ZI8A 4IDDA 1Z29A 4R0VA 3P0EA 4P58A 4G23A 5CIQA 1LA2A 3IJEB 4B75A 4F5DA 3HI4A 3GTOI 3HE5A 4WXEA 1VPDA 2CXPA 3DKVA 5DBOA 3MW8A 4J9UE 5I9MA 4Q6WA 1QVZA 2ZXXA 3LHSA 5JRDS 3ABSB 3WGMA 4MVJD 2AFVA 1GL2B 2XLBA 3MBIA 1S5LE 1Y1KE 1WJGA 4ZI7F 4PXAA 1E8DA 4HGYA 2BBTA 4BDSA 3OD5A 1RIFA 3GK3A 4D97A 3BCCG 3PDHA 2JGDA 2Q0HA 4IOLA 2C42A 5F5LA 4R8VA 2OQVA 1J21A 1ZMOA 4IIVA 3S15I 3RASA 5A04A 2XYGA 3KFVA 2LUOA 1YJ9P 3GEGA 4XR4A 3V42A 3UMJA 2VUUA 3SXUB 4UUNA 3G7UA 3BQMB 5K03A 2PKQO 1H1LB 1ONOA 3RSSA 1T8YA 4K6OA 1P2VA 3NWJA 3HJAA 3QLTA 3O3OB 4LX8A 3GGCA 4C4PA 1ZM3A 3AUSA 2UKDA 3ER9A 3BTUA 3H9QA 4M2LA 3S2DI 4K6GA 4BO1A 2Z1NA 4L4XA 2DPYA 1LV7A 1IH8A 4RPJA 1TB4A 4JEUA 5LA6B 1SVIA 2YY6A 4P98A 4H9GA 3LQ4A 1P84H 5AVJA 3WLPA 3FVWA 4XM2A 3BT7A 4E31A 4BEWA 1BOFA 4LJKA 5FFFA 4D4GA 4KYTA 1U0OC 4NCKA 1ZIDA 4PXSA 4KQKA 1ZKDA 3KEQA 4TUYB 2J3HA 1CJTC 4ASUA 4YT8A 6NULA 1YUNA 1QVRA 1L5KA 4RK5A 3NOVA 2WUVA 1E5WA 3NYRA 4FGWA 3UM9A 2X3YA 1V1JA 1R64A 4DW8A 3E9MA 5CFZA 1NTRA 3QXJA 2VHQA 3MAJA 1VMIA 3PJFA 2OAP1 2JFNA 3TPCA 2HH9A 1A5ZA 2MTBA 2PK7A 1MZVA 1G0NA 3CXCZ 3G2JA 1GY8A 2E6UX 4BKOA 5KIAA 3QA9A 5K20A 2I8LA 3ZVMA 1QPZA 3CX5H 3OCVA 1JG1A 2F6RA 4MVJG 1RWNA 3PL1A 4E3ZA 2IP2A 5IARA 2AOVA 3Q5EA 1QLHA 1SD2A 3KJHA 3TW0A 1N32B 3PPXA 1C7RA 2V45A 1ZJJA 3GJZA 1OGYA 2FLWA 5F4ZA 3K73O 1S721 1ISHA 3Q3IA 1FDIA 2WYVA 1URQD 1MC8A 3A8TA 2JCYA 4QUGA 3OIYA 2YW9A 5HJ7A 4M8LA 1LQ2A 4DJFC 3DO6A 4EVIA 3JR3A 1KY3A 3Q7TA 2Q6VA 1HV8A 1MPTA 5EIAA 4ZGWA 3AFNA 1NWQA 3GXBA 4P08A 5ICEA 3O2QB 2WSMA 4W9NC 1OGJA 1GN9A 3MQFA 5EZYB 1SWVA 1X92A 2J59M 1KJIA 4DMGA 4QZVA 1DIOB 5IVKA 3BPSA 3L4BC 3LPDA 4GKAA 1E0DA 5CJJA 3K0FB 4DLZA 3N87A 1JB9A 4D9CA 3IEVA 1FAVA 5AKLA 3CC7P 2BI7A 5H3LA 1XCMA 1D6NA 5AW7B 2XMCA 4QLAA 3L8GA 3V4RA 4CIVA 1XX6A 3T35A 1VRCA 2AN4A 3ASZA 3I37X 4F21A 3I9JA 3T3HA 2B9EA 1Q6ZA 4JJFA 1XWIA 4RXTA 3TFWA 1GQFA 1RAAA 4FJ1A 3J81k 4OBEA 5IBPA 5CCGC 2Z4TA 2PEYA 2DBQA 3B1ZA 2FVXA 4AULA 4E32A 4MINA 3PUHA 3FFTA 2BFWA 2IBZE 1YIJP 4WOCA 3HB4X 4UU1A 1YDHA 4CEIA 4DMRA 1PT6A 3V4VB 2NPFA 4B4OA 4ZAWA 4EQ6A 4RV9A 4OJKA 3BA1A 1J07A 1QTRA 5DLPA 3HOWI 2HCFA 2ET6A 4MLCA 1AKTA 3DD1A 2JR8A 3HY6A 3GFBA 3REOA 2EX0A 3OAKA 4ARZB 4ENUA 3VC1A 3N75A 2A0XA 3IHWA 3PD0A 1BDCA 1ZM9A 4MR8B 3CXHH 3LP5A 1PJZA 1NU1D 2JGAA 3TZ6A 2H59A 4O4JA 4REQA 2FHSA 2ZAOA 4Y0VA 2VT7A 3JZFA 3UJAA 4QDKA 4BVJA 4R51A 1EX7A 2JDIH 1RYNA 1VQ4P 3EY4A 4A10A 1Q74A 3MWKA 3AM3A 1JHVA 1T29A 3GVXA 3L8EA 4A2PA 2KPIA 2K2QB 1KZHA 4LKRA 3VZDA 1X42A 4JYCA 4BLOA 1G2QA 4B76A 2WK1A 3AZQA 1GPH1 4ZZ3A 3IBTA 1JSXA 1P7VA 2BMFA 4EIJA 4X90A 2ZI7A 1IK7A 3M1AA 4MVJA 4GOMD 4QWWA 4U9IS 3W79A 1S89A 4OHRA 5FOXA 1XNHA 1C5KA 3GG9A 5AVVA 4PYOA 1PP9J 2X4LA 1W52X 1USPB 1O6CA 1V95A 3FI9A 4WV3A 1OLOA 3K5PA 3ORQA 3EEOA 3X0DA 3TZBA 3GFQA 1X2BA 3LL4A 4W82A 1P6QA 4WCDA 1UK6A 2F3UA 3L1IA 4YMIA 5EMMA 4IPTA 3FOEC 1DBPA 2YHIA 4PONA 3QFHA 3QVTA 3WY9A 4D3FA 1JSLA 4BV9A 2GK6A 2Q5FA 3LLMA 1L8FA 3C7AA 5DBEX 4Y7CA 1N7SB 3NZEA 1CP3A 2RBKA 1E69A 1FYVA 3CG0A 4Q4AB 1NC3A 2ZGVA 1LKZA 3R3XA 2FNAA 1XLUA 2JCXA 3CZ4A 4F91B 5K4AA 4JBNA 1HNXB 2F4MA 3F5SA 2AZXA 4IMRA 1FFXA 4YPFA 3CR3C 7YASA 5JQWA 1WLFA 2AN3A 1MKYA 3BX1A 1EXMA 3LC0A 3FCAA 1Y1TA 5FD8A 2PMFA 2DLCX 4Q15A 4G01B 3U50C 3CCFA 1Y9AA 1GZ3A 3GOQA 1XQXA 5KX5B 1L7NA 4PV1B 2BJVA 5EMKA 1YJ91 2Y0BA 3MWLA 1SBZA 4JLWA 1NU1G 5JH7B 3L74J 4FT4A 1G60A 2DQYA 2I2DA 1YA4A 1C41A 3RYCA 1SU8A 2I9KA 3G0GA 3JVIA 3H0GI 2NYRA 3W3AH 5LVAA 2AG6A 2GZSA 1N8NA 4CEHB 4O4LA 4HQ6A 2WZQA 2A5DA 1PZQA 4BHTA 4PCVA 3U4CA 1CFJA 3PDWA 3H1JD 1QK5A 5CBOA 1ULZA 4RACA 4NCNA 1NULA 2XUKA 2ID7A 3ESDA 4HDSB 3GRYA 5K6TA 2IX7C 5CJPA 3QYFA 1ZVQA 4UAGA 4MKIA 2P40A 3WFJA 1VE9A 1KGDA 1N4AA 1M6WA 1URQA 1G55A 4EAAA 1G66A 3WYBA 2OKCA 1XMOB 1KK0A 2WV7A 3I34X 4J3JA 3LRPA 5K3AA 4X1IA 1IWBB 1I0LA 2WMYA 1D1PA 4P7GA 3G2QA 4B3CA 4IQ4A 1E0AA 4R3UC 4OKIA 4XB1A 4R1OA 4WDQA 1JDJA 2OHFA 5K0BA 3A0HE 1YZ3A 4GEKA 4ZP1A 5TY0A 1US8B 1A76A 4JP6A 4NAVA 4DSAA 1BYIA 1IBMB 3WB1A 4WERA 1KIMA 5YASA 3BDAA 4K5QA 5I8ZA 4CU2A 2QTLA 1K5HA 1JWAB 4CTKA 4ENPA 2DKOA 1SB9A 1MX5A 4L8GA 4NOLA 5HF9A 1SOMA 3F98A 5KJ6A 1KAEA 1Y7TA 3TSIA 2GPYA 3GLVA 2VCHA 3BS4A 2QPOA 5I7AA 1J1UA 4P2BA 3ROEA 4YGXB 3IXQA 1YUAA 1B0PA 2FFRA 4BNZA 1JWBB 4CE6A 3PQ3A 3RBXA 1RU3A 4GDFA 4R84A 1XK6A 3GHGA 1Z6PA 2NMVA 1JTHB 3ZWAA 2NP6A 3GTQI 4RYDA 2ZRAA 1SXGA 3BMQA 3PQ2A 3FWZA 2VAVA 3T3GA 2CZQA 1W46A 3VR2D 2X14A 1NTZJ 5CXUA 1QRUA 1FP4A 5T4FA 4N49A 3HQ4O 4ALJA 5GV8A 3H2KA 4ABYA 4LFBB 4BY7I 3CC71 3H1JG 4B6FA 3RANA 4B0PA 4QC2A 4XSVA 4GZ5A 3BXHA 5C1DA 3LCRA 5DYNA 4U2EA 4KWCA 2JAOA 2NM0A 5TIIA 2AUTA 3OHMA 5AXBA 4YCSA 4F06A 2AXTE 1QQ7A 5EXDA 2SICE 1H3NA 2BGGA 1T3GA 1T8TA 1QF7A 3RFFA 3LWBA 1NFRA 1YIJ1 3RT7A 4ZTUB 3D4OA 1OYYA 2RGCA 1IL0A 1UODA 1AO0A 3ZJUA 1FXWF 4JT9A 3IVAA 2DKNA 1GTVA 2HFJA 1FFGA 3HVHA 3GJ8A 1XTPA 2HRZA 3P0HA 1Z13A 2BEWA 1GXSA 1PKXA 2WF8A 4EDHA 4YUZA 2VNHA 1O0SA 3LQQA 1AHIA 1Z75A 5HFAA 3DEHA 3LBNA 3DMYA 3ZX4A 1T1EA 4KMRA 4LQLA 2AEMA 4FGUA 4HN4B 3B7GA 1FPMA 1K6IA 5E2BA 1FW8A 1U6JA 4PD4E 1G9XA 2V6MA 4DWJA 4BIIA 1SUSA 2H43A 3HA5A 4IIJA 3VMMA 4BBAA 4RPKA 2XB4A 1E1QA 1IB0A 1TJNA 1U1IA 1VQ41 3QKTA 4Z51A 3D8BA 3CX6A 4UZFA 4P3KA 2DB3A 4D4KA 3NHPA 4D79A 2JAQA 1T2DA 1EFTA 3L1HA 1HX7A 2ZUWA 2F8SA 1E5VA 1RQ2A 4II2A 3VPAA 3FPCA 1RKXA 5KU1A 1FVOA 2V59A 3L7AA 1TYZA 3EWAA 5HYVA 1Z3CA 3FLMA 2BFFB 2AJCA 3KKLA 4URFA 2O8BB 4HVTA 4OL9A 4Y9SA 2M32A 3PFWO 3E3OA 4RK4A 2HGSA 1MG5A 4XWGA 1L4AB 1ZJWA 2JVIA 4J0GA 2PX6A 3FF1A 4MRIA 4LZLA 1ZRMA 2KNCB 3NUQA 4Z0HO 4WY4C 3C8VA 3AF1A 4RK1A 3MWYW 2GN8A 5CW2A 3ABOB 4W5OA 3TZKA 2BCCD 1OFGA 3EWNA 2WA2A 5FP0A 4PO9A 1XAGA 3LA8A 1MC4A 5MHTA 1PQFA 5CM2Z 5KU7A 4YRPA 4DCNA 3QBJA 3ZWNA 3AJRA 3H8SA 4J0FA 1STOA 2WJ6A 5AVQA 3WXMA 1V9LA 2C3PA 4K7JA 4UU0A 4CCYB 2PKCA 1OHHA 3R3YA 4IUYA 3N74A 3J81b 1Y1SA 1KU6A 1BXRA 2C4TA 4RGVA 2X8JB 3SMVA 2ISSD 5EP4A 3DUFB 3NM4A 1F0KA 2CE7A 4XM0A 4BEBA 3EXHC 4LWOA 1A02J 2OGSA 2VJAA 4TTSA 3D1VA 2H7CA 1W94A 5JMPA 3UFXA 4IJMA 2JZNA 5K8JB 2EAUA 5CYOA 5CA0B 2KLHA 3N2EA 2LR2A 4BYMA 2YWDA 1MVLA 1TC2A 2A2ZA 2FCAA 5EEGA 4IEEA 3VSAA 3CE6A 4E33A 3D7SA 4R1SA 4YMUA 2UXCB 3SNHA 4I2VA 5FF9A 3VTKA 3OCYA 5FQOA 4J4TA 3U13A 1PBTA 1RE3A 3QKSA 3ZY4A 1GQRA 5LZ2A 3HOYI 2JI7A 1NUPA 2BKAA 4EWLA 1I4EB 5IHPA 2EKPA 1KKLA 4F3TA 3CZBA 2OWDA 3DFIA 1S8AA 2F9MA 4MW0A 1ADJA 2O2HA 1XKQA 2OYIB 1K6MA 1SUWA 1YBMA 4C76A 5L3ZA 1L7PA 4P86A 5BYJA 5EOVA 5KLVD 4PNEA 3AY0A 3G3ZA 1VKRA 3UKJA 3H6HA 1K8AQ 1U4OA 3T94A 3EXHB 2JIRA 2A45I 1PFWA 4B35A 1JG3A 1VZ2A 3E9DA 1HYGA 1N10A 5JYEA 4RPLA 1Y3FE 2AC7A 3F47A 2IW1A 5D7NA 5B5EE 2OXTA 3H1KD 2WMNB 4HDNB 1Z38A 2Q8PA 3R7AA 1FRVA 1UIRA 1DKNA 2GNAA 1S2NA 2Y1KA 2XX3A 5KOIA 1SVUA 2BCCG 4PZEA 4Z5XA 1W30A 5T8KC 1A5SB 1I4DD 1OMIA 2AD1A 1MABA 4DNPA 3JQ9C 2WAAA 4EQZA 1ZRSA 2EV9A 2ZYDA 4YALA 3UOWA 3CRW1 3MOGA 5D85A 1ATIA 3VR2A 4PZCA 4LNUB 3NDIA 4CUJA 2NO1A 3TSAA 1FZAA 3D6AA 1N6OA 3EY9A 3PXGA 3VTPC 2Y2VA 4GUDA 1E3IA 1RZVA 2IY9A 2XWBF 1K8XB 1CVRA 1ZGCA 1UBCA 1P9LA 4QYXA 2VKQA 2OZVA 5G0TA 5FJIA 3DT9A 3BD6A 2PKEA 2OZLA 3OLQA 2FN7A 1TC1A 5FLEX 3SFZA 3C24A 2LBPA 2X58A 4MI6A 2F64A 4ZEMA 2HF7A 3ITNA 4I81A 1NR1A 2POQX 1QVAA 1FMTA 5K45A 1AHPA 3MFYA 1N8R2 1PWXA 1E5DA 5A5FA 3IBYA 1GTWA 2HXGA 3FGZA 4QTUB 4F56A 1E60A 3CLUC 3OCUA 2JWDA 3BORA 5AW3B 5HK8A 1CZOA 1PL8A 2WHEA 4DE5A 1GGFA 4U7PB 3IHLA 1I3MA 2TYSB 3IIJA 1RMYA 1U65A 4A0GA 4TKUA 2AIRA 3EVCA 1Q15A 2JRLA 4ZKEA 3PUWA 3T1NA 2NX2A 1JIXA 4H44D 1N9GB 5KLVG 5CDSA 1XCPA 3LUCA 2QR1B 2O2ZA 1B6TA 2OB1A 4YV0A 5EKTA 3NAGA 5JTUA 5EQJB 1NW8A 2GR9A 2GKOA 4OQXA 2NP7A 3AGQA 5EUCA 3HDHA 2UZ1A 3H1KG 3OFJA 1YTZI 5BQXA 4LTDA 4MQ4A 2JGLA 3WWZA 1YHQP 1DOZA 4BZXA 5J2UB 4YAFA 2W6QA 2G9VA 4NWIA 3JD0A 3WP0A 3LKZA 2YO3A 5KJEA 4I6JA 1C0LA 1KD1Q 1YR2A 4NNPA 3WYNA 4QBFA 2PMZA 2WWIA 3L1JA 1JKFA 4NZMA 3REQB 2H0AA 4F2GA 3RIEA 1M1KQ 1KYWA 4C46A 5H1YA 3OZUA 2EGUA 4FC7A 4Z4CA 4BQNA 2QJPB 4OBXA 5TISH 2HHCA 1EDIA 4GRAA 2W4IA 5JNTA 3V32A 1XLWA 3KETA 2AL7A 4MUFA 3OCXA 3D71A 4ZICA 4AYCA 3S2SA 3IXLA 1EDEA 1AA0A 2JA2A 1ZH6A 2WSEH 1S7MA 1KJWA 3D4PA 4ARSA 3AFIA 4D0GA 2G4CA 3BM5A 2ZR8A 2VDQB 5IZCC 2HTFA 3U1VA 1EM6A 5CCHD 1WWKA 4MD9A 3D6ZA 4OSOA 5A6VA 5JZOA 2I4LA 4OU5A 4AQRD 2J9ZB 4KQ9A 1JH9A 2RGXA 4O2BB 4H60A 3R0JA 4Z4EA 1BQ4A 5DNAA 4WB4A 2BASA 5J40A 3GELA 3A1TA 4JGGA 3WLSA 4IEFB 2P3QA 1R2QA 2GYUA 4RVSA 5EI5A 3PPVA 2PSEA 4QTZA 1NQOA 4XPZA 4R71A 2X0IA 5C52B 3P4UA 3AINA 4M0EA 2GTPA 1KZ6A 3PUKA 4OYRA 3JAMb 3CLHA 3LRTA 3S2UA 1GDTA 1I1NA 4R16A 3ZDDA 3L73J 1DADA 5ELLA 2FYZA 3ORFA 3NT5A 3V1UA 5CBKA 2ATCA 4AMBA 2FYTA 3FSGD 3B3AA 5BOSB 1DC3A 3DG9A 1TZ2A 5DM70 4JVOA 4Q39A 1A9XB 1Q7CA 3IR7A 3GW6A 1E3WB 5AUQA 4JJ6A 4J7XA 5IKMA 2F1RA 4BVAA 1NRXA 3AUJB 3SF0A 1GW3A 3I04M 1E0JA 3JQQA 1XZLA 5L7YA 2IHTA 4NV1A 4L50A 2YJ5A 4BIMA 2OXRA 2PWAA 4YJ2A 5BXQC 1O9BA 2YUTA 1CJUC 2GCOA 3OUZA 1JY3O 2R48A 2VJKA 4OGFA 3WQHA 1YRHA 3FFBA 1RHMA 13PKA 1OIXA 2J4DA 3NGMA 3THYB 2WOJA 1TU4A 4A5SA 3EPRA 1YZKA 2RGBA 3KAJA 1YJXA 5FAKA 5L7TA 4H6WA 2V9ZA 3ANTA 4PIPA 1G291 3K30A 4QT0A 2JJLA 5M2QA 3H5OA 5CBPB 4ZJUA 3IOYA 4BLQA 1KDTA 4MIEA 4DLNA 4OCZA 3HKEB 1XD9A 2D13A 3GPDG 3I4CA 4OGWA 4JSTA 1PJCA 2RKBA 4TLAA 2DCUA 3PHHA 4AW9A 4JKOA 2HJGA 3OKFA 4ESHA 1VLJA 3HSSA 3GUVA 5FQNA 4KRXA 5LP6B 4OOFA 2EHDA 5LYJF 4QQNA 1ZVVA 2B83A 3AP1A 2WOOA 1BEZA 2CGEA 1JVSA 1ISSA 3U0BA 1XA3A 3D2CA 5EIBD 5EN4A 1VYUA 4JBIA 2OBMA 2RSLA 4YAWA 3SC2A 4IV0A 1XPJA 2JNWA 2J6HA 4PLCA 4QFDA 2FA9A 4XVRA 2OFOA 3QA3E 2OYRA 4P5PA 2N1TC 1Z5WA 3OQNA 3P0JA 3M3HA 1U0SY 5D2CA 4L5CA 2A0YA 4N4AA 4KB5A 3E84A 1DAKA 3SYRA 4BN5A 1LPAB 3QX7A 3ZZ1A 4EG5A 1IEXA 1DVRA 3J80b 4BGIA 3IXMA 4MB6A 1U90A 4MQMA 2Q2NA 2FMKA 3PC8C 4A8JA 5LQUA 1V7ZA 3GCGA 2IBSA 1FMFA 1ZU4A 4RD4A 5HIMA 4B45A 3ZLVA 4LY0A 4G2TA 3M6MD 1SVFA 2QTRA 4PTZA 1T0IA 2XMSA 4JH0A 1VQ8P 1KI3A 5I4IA 3IQZA 1K4YA 5H4HA 4LXUA 1M5TA 2OV3A 2GXQA 2NVTI 3GCXA 4HFMA 1U8FO 2H18A 3C7TA 5H2FH 3U31A 1W2BO 4N48A 4U5XA 1J09A 1PDWA 2PGJA 2PRZA 4LK3A 2CD7A 1OYVA 4BFXA 3AU8A 1G8HA 4INAA 4LV8B 5BW6B 1Y8QB 1QIFA 3K2BA 2C77A 4MGKR 1JIJA 4CUKA 5IBCA 1NW7A 4BNVA 3CL3D 4BKPA 3UXYA 5KTYA 1YMQA 1MV5A 3FOFC 3E0XA 1PRYA 2ZT9C 1EVJA 4GQBA 2EVWX 5LJLA 1HBWA 2IYSA 4H7PA 5L8VA 3STHA 1UM9B 2NU9A 1CUEA 3FA2A 3N70A 3VHXB 3I1JA 3AEQB 4L3OA 2IRWA 1ULHA 5TB5A 1XNRB 1QGZA 1HI9A 2Q5CA 3WIBA 1RRMA 4NJEB 3CNLA 3RJZA 3NCHA 2YFKA 4HYQA 5K7SA 3M70A 3EZGA 4OHVA 3TEJA 4CT4B 4EVSA 1RS0A 1ADCA 4J1TC 1S02A 4EG8A 1NVXQ 3GUUA 3C45A 5ALUA 3MWEA 4YMSA 2FW8A 3NRJA 3RK2D 5JECA 2J59A 1POXA 1YZUA 1YIJZ 2RGRA 1N77A 4YAUA 5CCHA 3MINA 4DLVA 5JANA 2FXIA 5SY9A 1ZH8A 1GZUA 3MLEA 1WMDA 3SQOA 1OH6A 4LMAA 4X5OA 3E8SA 5T67A 4XM1A 5DLYA 1RCTE 2HPCB 5GVRA 3BK7A 3UF0A 2DUWA 4PV7A 3RVKA 4CMBA 3OFNA 2G9ZA 2J31A 2I34A 1M34E 4C87A 1R4AA 2OGWA 4OGLA 3ZHQA 3B6IA 3DBVO 3FUUA 4LGVA 2Q6LA 1G5QA 3PFHA 5BQOA 5JBNA 1PWZA 1DT5A 4D45A 2Q4TA 2ZT6A 2A94A 1JLMA 1I2ZA 4DJTA 2XNHA 4KXUA 2FG6C 3AKCA 3QYPA 5ECYA 4BGDA 3AR3A 2WSSH 1ACLA 2Z4RA 2D2VA 1TD9A 2R68A 5HCNA 3MOSA 3OO1A 2DR2A 4FDUA 3ILYA 3PQCA 1ND5A 3FSGA 3RRYA 3GT3A 2RGWA 5IKEA 4JYMA 1XKXA 1UDCA 1FSGA 3CMCO 3CEAA 3PX7A 1M2GA 3CPJB 4U3JA 1EJBA 1CR6A 1HRDA 2CSUA 4KXXA 4CM1A 1QG2A 1GUFA 2IOQA 3PSHA 2CVOA 2VVTA 1AE1A 1VPLA 2D0OB 3PO2I 5BSFA 5K05A 2X0JA 2OSBA 1D7OA 3DDSA 5KJ7D 5JQGB 5H0IA 5DMHA 1W0JD 1Y1VA 1YJCA 5C34B 3FPFA 1F1BA 3TPZA 1Z18A 3ILSA 4ESVA 1JFTA 1U9ZA 1IULA 3PXDA 2WF6A 3S2FA 3Q1MA 2HJ9A 2Y0CA 1EFPA 2HYIC 2CKMA 1DKLA 1DRUA 2NU7A 4G0OA 1U2PA 3PR1A 1U5AA 4AY6A 4AB1A 1F8UA 2QA4Z 2PZMA 2XXJA 4EG7A 1XTTA 1VE7A 4FERA 1QXSA 3VKGA 1ZITA 1MB3A 3C16C 4V02A 1QK4A 1CUDA 3L0CA 3NTRA 1H94A 2HKIA 1I50I 1O3YA 1KQSZ 4QFMA 2QORA 4KIFA 4JJGA 3H3JA 3NAQA 3RJ9A 2L42A 2CNWA 4UVEA 4MI3A 2TMGA 4JLAA 5APWA 2OMKA 2C0QA 1WVGA 3RYHA 3L7CA 3DCYA 5KQLA 2DWPA 4UHDA 4XWAA 5B3JC 4YJ3A 1HDXA 3L74E 4ZT2A 2BM8A 4HNTA 2POCA 2YC4C 1BOOA 3L18A 2QMHA 1L3BA 4WH0A 3A3YB 4O4HA 4UKDA 3K05A 4H0NA 2J3JA 1LBHA 2CFRA 1EG2A 5GIOE 4WZAE 5EVCA 1KFKB 3GCWA 4CV1A 2BM1A 1IG0A 3JQDA 5CJ0A 1VQ9P 3W7VA 1QE3A 1E1RD 2O0JA 2X0KA 4MGYR 1CERA 4EMUA 5IPFA 5TT0A 3HPQA 3HI6A 5AW9A 4MVJP 4IQFA 1QIIA 3FYUC 1P4SA 1W34A 3FZYA 4JPZB 3C74A 4IX9A 3L04A 4RESA 1E66A 4AJEA 1ULSA 3I42A 2FYUD 5HG0A 3K8OE 3T5BA 4YJGA 2BH0A 2EFYA 1TQ4A 3OZSA 4L07A 4WKCA 4NG4A 3KYBA 4JEMA 3CVVA 3BGSA 2ZBQA 1M1JA 4O3FA 1OT5A 4TN1A 2GCPA 1JQJC 2X1HA 4ZWNA 2QPAA 1UPXA 4OYLA 1E59A 2C4VA 4ASUD 2PUWA 5B30A 1P0CA 1DG3A 1KV4A 3DAFA 3E8MA 1C3LA 1MJFA 3AE8C 4DLBA 4R83A 4BO2A 5I7UA 1O08A 1U0LA 4HYYA 1UPBA 4WZBA 1I6MA 5HIKA 3I2GA 3EG9A 3C3DA 2HPVA 4QHTA 3W8DA 4GSYA 2QN3A 3GTOA 5HRUA 3P4YA 1KK3A 2LIVA 3BCHA 3RFUA 1PPYA 1DUVG 2J0SA 5DGCA 4OP2A 4QYMA 1Y1VI 3PIIA 1QS0B 1Q83A 2WQ6A 2E87A 3QWUA 2D2CC 1TUGA 2QJWA 3SBDA 4GOLD 4X8HA 3L9XA 5AKHA 4RA9A 5B2FA 4N40A 1YGPA 4ZIRA 2VWQA 3ZNNA 1DKOA 3O6VA 3A10A 1EVQA 4YP0A 2JBHA 2FRDA 4XVCA 1XCGB 3KIHA 4J2OA 1QVGY 1K5GA 1N6PA 4GOXA 3IR5A 1Z4LA 2G5DA 4XD2A 4X24A 3JD1A 5JNRA 1EM8B 1CIPA 2REQB 1R4MA 2VPTA 4MMYB 3Q15C 4L4SA 5I9NA 1GU1A 2ONKA 5CHXA 3H1BA 3OEHA 3EC1A 3A1NA 1KYVA 3AW8A 3ZN2A 3D4NA 1ZLXA 2H2HA 3SQDA 2NO5A 3M7IA 1Y3HA 4MONA 2A7QA 4C6RA 3BCCD 1PYOA 1CS0B 3IMFA 3A6HA 3A7DA 1NAIA 3WYDA 4KLAA 4OX9Y 3Q7QA 3FDXA 6PFKA 3WZMA 4RS3A 1VP9A 3S1AB 3A4NA 3D0RA 2FW0A 3QE4A 2VZEA 2FYUG 1DS6A 5F2KA 3WB9A 2R7ZA 4IUDS 4PO3X 2MJZA 3F9IA 3KIPA 1T1RA 2ZIXA 1WG8A 1W4ZA 1XMSA 1QIGA 2ZAMA 4UB6H 1IVYA 3N2GA 3WGJA 3W1EA 3M5WA 4FDTA 4DR7B 1XVAA 5LM3A 2R8OA 3U9LA 2SECE 1SHZA 4DT1A 4TMFA 3TMYA 2WP8J 5AMXA 3NBYC 1P84D 1CUFA 1NW5A 5K3FA 3PXCX 1GL2C 4B2PA 3J7A4 2FKAA 2PY6A 2B99A 3NH9A 2OBNA 4YCAA 2O8DB 4O5OA 1S7CA 3JD2A 2FKNA 1JYEA 3IA2A 4MYDA 1MNQA 1F60A 2V65A 1RPTA 5KJ7A 3MXTA 2YOFA 4PLPA 3UT5B 1TTPB 2FQWA 2G9RA 4L15A 4OG2A 1PJ4A 1LTJC 2NVUA 4EGFA 1R00A 2JGIA 3TNYA 3OLXA 2VJYA 3IE0A 3RYIB 1U98A 2X7HA 1L0LK 1XRQA 3EERA 2W27A 1W4BA 2ADFA 4MEBA 3H7IA 4MHOA 2PMCA 1O94A 1O5TA 2JK0A 3ZHUA 1H1DA 3RSQA 3H11B 3KYDB 3OBBA 4LDNA 1SBNE 4RMNA 3JQ6A 1TECE 4XJXA 4JCCA 4KQ2A 3ANMA 1HQDA 4ODIA 3UAZA 2M1ZA 5CB4B 1O77A 2R92A 3V4PB 1DAIA 5FL7D 2VF1A 2FR1A 4M8NE 5KTMA 4NHOA 4K9SA 5CHYA 4J0KA 1DWUA 3GLFE 2F9LA 2FEMA 2PUAA 2PXAA 2ZJBA 2EQ5A 1ZGJA 3NMUF 5KQMA 4ENVA 1YCHA 3OQIB 3H1ID 1ECCA 3PIRA 1EMDA 4EI8A 2VRCA 2QAGA 3ZHOA 3BRSA 2ESRA 2FQYA 4ATNA 1CF2O 4EP1A 1Q862 3RFCA 3T15A 1LTJB 2G1UA 1E4EA 5HJEA 5K4GA 4KQJA 1CNFA 2QN2A 3FBWA 1L8OA 2BP7A 1QYDA 3OBIA 1DWQA 5CDFA 1A2KC 2I1WA 4K9PA 3UC9A 3N53A 3DB2A 1THGA 3N2KB 3M4JA 3AKEA 3OLVA 3B85A 3BH0A 3MTBA 1E1RA 5E6SB 1Q812 1M1NB 3ER8A 1Y3AA 5TC4A 3V9PA 1OXZA 4Y1RB 2VF4X 3QX3A 1YFZA 1R16A 3S44A 3L8HA 2GCGA 1ZZEA 4JFAA 3WGUA 2DHCA 3WLQA 3VZSA 2NSYA 4RDHA 2XITA 4F04A 2FLVA 2QTTA 2PRRA 1OV4A 5FJJA 4NL4H 3UQZA 5J4HA 1OWOA 5B6JA 4JQZA 4UM9B 3IP8A 4AJHA 1QONA 4GR9A 2R7ZI 1GNQA 3NNNA 3ZQJA 1H5NA 2WJIA 2IDKA 1PJ2A 1XTQA 3N2IA 1UKAA 2C2ZA 1DCFA 1TKCA 5DXFA 5B4UA 3COPA 1BDJA 4OQLA 3EIQA 1UDAA 1P4GA 3NTLA 3IHTA 4I8XA 3A05A 1VQ91 5KYUB 3IURA 2O3UA 1QJCA 2PICA 2OT3B 3QVUA 1QUEA 1XRNA 3D1LA 2JA1A 4QRIA 1YQTA 4MVCA 2AN9A 2SNIE 3RFVA 4BZPA 5CA1A 5F2EA 2H2DA 1QB7A 1QTNA 3BFPA 4F12A 4OHUA 3GJRA 4M6WB 3H1IG 5AW2A 4AVYA 2CV1A 4E46A 3PL5A 2IF0A 1FTYA 1EXNA 2J7PD 4B6RA 3L4JA 3BL6A 1DIHA 1PGNA 2VOJA 1U5BA 2PGNA 4J1NA 4D43A 2R92I 5KYNA 1D4FA 2K87A 4JWTA 3G1WA 4B6QA 1YL5A 1Y80A 4JLUA 5KNCH 5ARDA 4NYIQ 3G6EP 1YRQA 2C5AA 1I1OA 1K75A 4PLTA 3A06A 4PZAA 4NBUA 1L1RA 3R7DA 2QV0A 3SSAA 1XV5A 1USVA 2XDYA 2WHYA 3MGBA 3HKCA 4C7XA 4IL6X 2GPTA 1RZ3A 4M46A 2VTDA 1GNTA 3PQ4A 4DBLC 4IZ6A 1GFZA 1J1EB 4PLFA 3OH8A 2WJAA 4A4DA 3EZLA 2WAYA 3L6OO 4I4IA 2BTEA 1BAPA 3SJUA 5G53C 5IABA 3JCUH 4HXEB 2A33A 1A95A 3CY6A 3PRYA 3A1CA 3DHVA 1CQIA 2E75D 4PSDA 1RCUA 2ETVA 2YWRA 4KV7A 1Z35A 4YAJA 1RBQA 4R05A 4BAUA 3O9MA 3GF3A 1PU2A 1GRVA 2FK7A 4XLZA 4B46A 3A6DA 1E5QA 1VQPZ 1NASA 4Q3BA 1WXDA 3PEFA 1YONA 4ZKDA 5A3JA 1VKNA 1UIIA 3H0GA 1NVVQ 1Y4DE 5LQRA 2BFPA 2NV2B 4LJYA 1YDFA 4V0LA 2IXTA 1UKBA 3TLZA 5ARCA 2A5FA 3WU2H 5LZ7A 4RKUJ 6ABPA 1J90A 2YL2A 1MEEA 1AXGA 4B7UA 2BH2A 3KFLA 4MS1A 4IGKA 3CNOA 1JTEA 1BE0A 3UHJA 1DELA 1U1CA 1UC8A 1ZH2A 3EYWA 1TVMA 4MRMB 2DERA 1YCDA 1DAHA 1KIAA 5A4AA 3RYTC 2FSGA 3D43A 4IZIA 1EK6A 5B7QA 4Y2VA 1QFZA 1OX3A 3SHTA 1YHQZ 2R5BA 3PNOA 5ER9A 4QUHA 1NKNA 2Q4EA 3A36A 2RHLA 5C1BA 1DJNA 2E1RA 5FL7A 1CDEA 1ETUA 1WOYA 2HA4A 1N7SC 2WFMA 4IGFA 2XUGA 4BGVA 4RVHA 5D00A 4YRCA 1LWOA 3OY7A 1VG8A 4KXMA 4JI2B 1RXVA 1UZUA 3E18A 4HKTA 2XYRA 5JAUA 4MEAA 2C7OA 821PA 2AE1A 4P92A 5AI0A 2FFHA 2GWHA 3FHCB 5E79H 3NEPX 4UULA 3NC4A 4EA6A 3D3EA 3REGA 3PT5A 3P19A 1KZ4A 3ZJVA 5JE8A 5TNXA 1PQEA 4PV1C 4RHFA 2BMEA 3QBVA 4OH7A 3AVYA 5KKNB 1TZCA 3AI1A 3GW8A 2FMTA 2P77A 1E1QD 2HJVA 2ZITA 3RV3A 3IEUA 3C6KA 4E7PA 3TQFA 2LE0A 1OV6A 4ASWA 2EQAA 2OTLZ 1DINA 5AM5A 1E2JA 1Z5VA 3ECAA 4L85A 4DFDA 2WJYA 3LMKA 1PD0A 2QA4P 3IAS6 4UFOA 4JQOA 1E9FA 5C4IA 1QKKA 3HY4A 3K20A 1VP3A 3OPYA 4G4IA 5KYWB 4GIBA 4Z9FA 5CCXA 5HQJA 1R7RA 4AJLA 2GZDA 4H6VA 3RADC 3GTQA 4NBBA 1GEEA 4WESA 5A9RA 1EDOA 6REQA 2BFEA 1NBMD 2H63A 2I6SA 4ZAVA 1BWQA 4AY4A 4WY8A 3PTZA 3K15A 1MJNA 1O8BA 5FWXA 4XPIB 5IN4A 1VSTA 2CB9A 4QDUA 1TF5A 3L73E 2F17A 1F6BA 1X86B 1CETA 2J33A 1HUCA 2IKSA 2C9MA 4EATA 3WJ7A 1P84I 3OPQA 2WG2A 4NLLA 4F0JA 2A5YB 4DDMA 4ESEA 5FH9A 1RM5A 4B34A 1TAGA 3LW5H 3C6BA 2G82A 1XTVA 5A6SA 4JODA 4C6HA 4DQXA 1DJQA 4U3FE 4WGFA 4GMFA 3OU2A 5ADWA 1CUHA 1GZVA 1G3RA 1MUUA 5TMBA 1WHTB 1OHHD 3RFTA 1THMA 2PO7A 1GU7A 4BP1A 1OFVA 3N2NA 4FN5A 3HDQA 3MTJA 3PGXA 4JKYA 4N5MA 3OEWA 3T9EA 1WQ4A 2V1UA 2JDIA 4YCCA 1YULA 4KOEC 1G8PA 3E5NA 1Y8AA 2JAHA 4GXNA 2J5BA 1KJYA 2PWYA 1ESNA 1HE1C 3JQAB 1F2TB 4OKNA 2J7PA 1YQEA 4RH3A 4HNRA 3E70C 1TRHA 1M33A 3BMXA 1KBZA 1XR3A 2O5VA 3IQWA 2GSDA 3EXFB 3CX5I 1VLVA 2C2XA 2QTMA 1DJMA 5HZMA 3I04A 4AJPA 4AJ2A 2A45G 4MN4C 4BVFA 1RCFA 1A50B 3FPSA 3K0AB 1RF0C 3ZWKA 3AEDC 3DMFA 3ECCA 1GKKA 3CRQA 3LVBA 3L0IB 2PWZA 1YTZT 4HVCA 1Z34A 2IPAB 4GZLA 3NUZA 2B7CA 1NM5C 3N76A 2JBAB 1ZH0A 2WD9A 1K0UA 4A6PA 2KLUA 3IT3A 1R10A 4AONB 5TQ0A 3EFGA 4HH0A 3N4XA 3WRYC 1Q1BA 2GBIA 4DMHA 1ONSA 2QN1A 4A91A 3BCSA 4LJ8A 2QKDA 4HAZA 3NWPA 1Z2DA 1YK1A 4P1ZA 1U7OA 5KC9A 1QLED 4LGDE 1E9RA 2FWIA 2GLXA 3OY2A 3PNSA 2HG5D 1Y1WI 1E4VA 2CVPA 4P7JA 3CURA 3G6E1 4KT0J 4YFYA 3OPYI 1KHHA 1M2OA 1K7FB 3PVZA 3GAFA 4JJIA 3DE5X 5FI5A 1JY2O 3P5BA 3ESBA 1T9HA 5C51B 4I6EA 1VQ8Z 3ON5A 3T95A 1LLQA 4PQRA 5ENZA 1BJRE 1E2LA 2C2GA 4LWPA 2P9GA 4LBWA 4Z9XA 4ZYLA 1K7SN 3KKEA 2OK8A 1R12A 4IBOA 2VAWA 1KTIA 3NH6A 2B9BA 2ORWA 1NLZA 1OA9A 3BBLA 2MMCA 4NVRA 1AXEA 3ZE1B 1CUCA 4WJZA 2IEZA 5APQA 4BO7A 4RTSA 1LC0A 4NENA 2P5UA 1NXOA 3BEDA 3DMTC 3WLIA 1VG1A 1QFYA 4TTPA 1KMQA 3HO1A 3A1UA 2CUTA 1LPMA 2DTDA 1VIVA 1GA6A 3ZVKA 3NG1A 1W87A 1JH8A 1JE0A 3JD4A 2Q4DA 4BUCA 5HOEA 2Z3VA 3KB2A 5TR9A 2J08A 3G0IA 3QFTA 4CI9A 2Y1WA 3CXHI 1Y63A 2FQ1A 1OXKB 1QNLA 3U5ZB 4X1KB 2Z4EA 1YDGA 3IVMA 2JK1A 2C9BA 1C4OA 2Q28A 3HJNA 5F1YA 4J2TA 4PAWA 2Y0EA 2IE8A 2RHRA 5KREA 3L92A 2O20A 4GPTA 5B1YA 4KKXB 4ND6A 3SQNA 2VP9A 1Z5OA 3CLTD 4C4RA 1L4AC 1F0PA 5B37A 3GXOA 5I5GA 3THWA 4I6MC 1ZK0A 1DEOA 3DEFA 1YNJD 3QQ8A 5FULA 4ZAFA 3MMNA 2Y4OA 4Q4JB 5FWAA 2XCQA 5AT1A 3W5SA 2O1WA 1T36B 1ZC4A 1SG9A 4LF6B 1PHRA 3MGCA 1MKMA 3JQFC 5CH3A 5H4UA 1O03A 1DI0A 4TSRA 2H51A 4B81A 1JE1A 4JENA 1MO2A 4ACBA 2IZOA 5JD4A 1YFLA 2H7YA 4UHBA 2A4MA 3OTHA 4IXWA 3LOQA 3K5IA 3D9XA 2FP4B 3LYHA 2FPKA 4HCJA 1YUBA 3EWKA 3FZNA 1G6HA 1LLCA 1X80A 1E5LA 2OC9A 2DBYA 2AF4C 1G38A 1M901 5BVHA 3OQOA 5IN5A 2XUFA 4ZAXA 3LCJA 3KFXA 2C7RA 3GLGA 1NBMA 1JECA 3OT1B 3FGNA 2A5GA 2ERXA 1W19A 1IATA 2R85A 3QWBA 4DDHA 2FW6A 4BQEA 3AMVA 2ZE8A 2P1DA 4CQMB 4M54A 5TMDA 1LT9A 2FZVA 4C21A 3SKYA 3U37A 3K31A 2B87A 4W5NA 2DP4E 2BOVA 2P35A 1QDLB 2UZ4A 4XVHA 3HCRA 4AURA 1P45A 3SM3A 3FVQA 2R97A 1W4CA 4ID3A 1R6AA 4B79A 1KL7A 3NBQA 5L9AA 3MS7A 4INZA 3TZQA 2QA41 3VX4A 2F3SA 4C30A 2GK3A 5KMGB 4A5OA 5A5EA 1R6UA 4PSVA 1E9CA 2Z8XA 5BR1A 2HJSA 5FADA 2FXOA 2OYIC 4Q3CA 5B58C 3CIOA 3UWOA 1LTAC 1OR8A 1KMHA 4TMVA 4LY3A 3KLNA 2VXBA 2H4YA 4XARA 1P1KA 4EKEA 2XU6A 1BSVA 2I3BA 4I4TF 2IPXA 1OLSB 1YR6A 2IHYA 2RKWA 4M1WA 4GKBA 2CHFA 1RM4A 3G17A 4NQRA 3MQ4A 3TQQA 1T8SA 4OM8A 3Q0EA 1ZO8A 1Y5NA 2AH5A 4N76A 3KDSE 3DAGA 3QXXA 2I8AA 3GPLA 1AA9A 1U02A 4OB7A 3RSCA 3OI7A 3PQFA 3LWNA 1QORA 5BVGA 1U2DA 1GM5A 5JFGA 4ER3A 2VDUE 3U1CA 1KDRA 2VDKB 2R7KA 3FLAA 2IP1A 3JVVA 4I08A 2EQBA 3A2NA 4OHPA 3F6PA 4ZC1A 1GILA 1X39A 5IYZA 3TI7A 3AE2C 3JSVC 3ZJTA 4Q6BA 1QK3A 4JLNA 2ZUVA 5A71A 1V47A 4YY3B 4ENWA 3NXKA 1P19A 1SCKA 3MUNA 4AS2A 3HO8A 3IP6A 3W04A 4ZKUA 5HM8A 1EVYA 4JJ8A 4UTVA 2OARA 1OXBB 1GL9B 2GJAA 4P4SB 5LZ5A 5JARA 1PDOA 1Y9BA 4MYSA 5KYXB 1VQ9Z 3UB3A 4QU0A 4P84A 2OUKA 1J39A 4IG4A 1RPNA 4MICA 5G1PA 3F96A 3U7FB 3WNDA 3OUTA 4KTTE 4C4TA 1T43A 4K81B 4GDMA 1H23A 5A0TA 4EPTA 3ELDA 3CXCY 1ADYA 1W2EA 1YQUA 2XMPA 4IWYA 3ZZMA 4AQYB 4FQ8A 2HLPA 4IHJB 3K6SB 1KHTA 4N6OA 1B4DA 2ECFA 2OQIA 1KQPA 3X2MA 1T3TA 1JDBB 3EMBA 1UFKA 3Q6MA 1QH8A 3X43A 1XCJA 4CMGA 1YITZ 5F1PA 1EC5A 2JJ1A 4KRFA 3T7KA 4IWNA 4HYEA 1ZVJA 3B1XA 2CNDA 1TPYA 3T4NB 1FLNA 1IJKA 1MX1A 3C39A 1IONA 3SUJA 3PUJA 5DTEA 5EWMB 3F6EX 3WG9A 2ZE6A 4TKZA 4EHJA 5AVXB 3EXEA 5AP9A 3QVGB 4BMOB 5C18A 5CMZA 2X3UA 2WIAA 1VQPP 4A2CA 2EFCB 4Z86A 1XVVA 5BV8A 2CJXA 4RMHA 2QTBA 1WDKA 1TZJA 5DTMA 3VH4A 2BDUA 3L77A 5H9VA 4AICA 1L1FA 1DC6A 1VQOP 3CN7A 1HORA 3C8DA 4HV4A 1I6HI 1VSVA 1ZNWA 4FFBB 4P38A 1GFWA 1X7XA 3SF8B 4DC9A 2QJPC 4G0XA 4MIYA 4C78A 4LC0A 5D3MB 1KPHA 2C1ZA 3ZZNA 2ZQYA 1AQIA 2IUSA 3JAWA 3OLZA 2ODBA 3QVSA 2QVAA 4NY1A 5IM4A 3L6DA 1PIWA 5AOVA 1U7XA 4ZDJA 4WLFA 4GG1A 4M1OA 1BXKA 1P7CA 5EWLB 1P1JA 1WMSA 3N8IA 3PSAA 4EYEA 4WBNA 4XCQA 3W5BA 2WSCJ 3KXPA 1YR9A 4UTZA 3G5AA 2B4RO 2ODEA 5FI3A 1RHKA 4V0KA 1XU4A 2QRUA 4WBXC 2L5GB 2KE5A 4GPIB 1EVKA 3L71J 1VI5A 2VP0A 4OLAA 2GPSA 4BLVA 1Y4ZA 1E2MA 3H1HJ 1QCCA 3A6LA 3OQBA 5BSWA 3SX4A 2WE8A 4QPPA 4FFSA 3Q10A 4HOYA 3ZUGA 3EFOB 4JYAB 1OBCA 5M04A 1MO3A 4ZQFA 1KRHA 2WU3A 2VYCA 3LYAA 3KSBC 2PZFA 2O52A 3GYBA 4D3ZA 1OFTA 1TM1E 2BFBA 4NMWA 1OMOA 4Y0NA 3GHYA 2G0NA 2HRQA 2PEZA 3FMOB 1L9KA 4PCLA 1RWQA 2YZ2A 1FP6A 4MZXA 4O0LA 1ZJ4A 1EFLA 2RGUA 4NJOA 4PYJA 3WQQA 3JVEA 4YN3A 2CDNA 2DG2A 2V0CA 2OTLP 2PYIA 4KSBA 4FFRA 1G21E 5JW6A 1SVSA 3AHEA 3FMPB 4RK7A 3UEOA 2RHJA 3EG5A 2VNSA 3THRA 4LPKA 3OLCX 2Q6OA 2CF6A 3ZQUA 4AIIA 3D7RA 2IIVA 1BDMA 4IFTA 5ICGA 3AHIA 3Q3GE 3OFND 3LVRE 1PFYA 3QEAZ 1JIVA 4QVKA 3JWEA 3MGKA 1IY0A 1PTKA 1KILB 3GZTB 3IAHA 5I7SA 3IF4A 2MDTA 3ZV3A 4DJJA 3FZQA 1YR3A 2P10A 3OJCA 3FNFA 4ZU3A 3VU9A 2BFAA 3DC2A 2WT8A 2GD6A 4JP8A 4D9IA 2C9CA 3IB6A 4LZAA 4F93B 1M0SA 4R8RA 4Q3AA 1W2WB 3HE4B 1AQJA 2W8BB 1N3YA 4ZO9A 4UUQA 4M1TA 1WCWA 1C9DB 2F67A 1OIPA 3PLNA 2UYHA 2ZBDA 4FMDB 3GJSA 1AG9A 3VVLA 3H99A 3JWHA 4G63A 2IS2A 4A0FA 1C7ZA 5IMBA 1RRCA 1F3OA 2G71A 2VBFA 4NARA 1RHZB 4U3FJ 3LY8A 5C8YB 2AJBA 2ZJAA 4WKOA 1QGYA 4S2EA 1C1XA 1DQNA 3RBAA 1XYGA 1T9BA 1Z2PX 5EXXA 5LP6C 4NDZA 1EG7A 4UEOA 4MV1A 5HF8A 2HCJB 3LT2A 7GPBA 1V4VA 3RSHA 1AKYA 4O9BA 3CPWZ 5E2IA 3GTGI 3A04A 2IXEA 3K0SA 4RZQA 1T2FA 1HSZA 2B34A 4IL6H 3GZNA 4DR5B 4MARA 1DC7A 1T9DA 3P26A 2NTJA 4ZTBA 3D1JA 2MSKA 3BEOA 4FD2A 1XPUA 4OATA 1ONPA 4KDLA 2J3MA 5FHRA 2YW2A 2OFXA 3D4IA 4NAHA 2HBRA 4HDOB 4C7OA 3P2OA 4MWDA 4AAYA 4C0JA 3TM7B 1JQLB 2HJHA 2NG1A 4L57A 1Z9BA 5A7GA 4RD0A 5JJIA 3L93A 4UUBA 4ZTZB 1ZC3A 1V5FA 1UPFA 3A70A 1JHXA 4MQ5A 3HVJA 4RK0A 2RI1A 1HE8B 1KJQA 3RU3A 2YR0A 1ADBA 2K1AA 2WAOA 4POOA 3WLTA 2CNWD 4B33A 1QFSA 5LMZA 2QLNA 3M9QA 3TIXB 3R7NA 3M0DA 1T26A 4HX9A 4CNBA 5GOZA 1AHHA 3ZKWA 2CV0A 5IJAA 4LRXA 2HU7A 1JCCA 2IYUA 3O84A 3FX2A 5A06A 3JWPA 4OHKA 1OXUA 4HG2A 2GRJA 4NXNB 4IHAA 4H1UA 1LDYA 2YQ5A 1A69A 3PQEA 1LJ8A 4F6RB 4BKUA 3GCZA 4EECA 1X6VA 2QROA 4TXMA 3BIOA 4PLYA 1RWOA 2I99A 3I12A 4FWIB 4A26A 1N5RA 1ZD9A 3PPWA 1BE1A 1IB6A 3GRUA 2PGLA 1PP4A 3S3TA 4Q9NA 4ARIA 4EFMA 1WXHA 3DP7A 2HU5A 3BUSA 4G5OA 4IIHA 3CWBG 1NTMK 4RHUA 1IG3A 1UBFA 3FWHA 3DDWA 1EHCA 5K0NA 3JX9A 2C58A 2A0UA 4I2LC 5DISB 4EGCB 1NQ5A 1TQ6A 1E9AA 3AQ4A 3TOSA 2KP8A 3RS7A 2GB4A 4ZVTA 1R0CA 3UXMA 5ALNA 4H0FA 3Q3VA 1NA5A 2VUHB 2QPLA 4A3II 2I3DA 4XJSA 2RAFA 5HMLA 1JP7A 3OOWA 2B82A 4QEKA 4Q1CA 3AH8A 3L0BA 1Z4KA 5ECWA 4JIGA 1N2JA 5D5QA 4NBFA 1U2QA 4TXHA 2PR7A 3G6EZ 5HS4A 1FTNA 2BZGA 2EOAA 3WMEA 1R74A 4CU5A 4KQGA 2B30A 1IY9A 1VQP1 1XRJA 3WBFA 1WRBA 4B31A 3CF2A 4M4SA 1CUVA 2GZHA 2VHTA 4YCLA 2KS1A 2ENUA 4Y2RA 4TLCA 3QPBA 1VQO1 1I50A 3D64A 5FTNA 1ZD1A 3MB8A 2GPWA 3QHPA 3MJEA 3VO8A 1DT3A 4FFNA 5TS3A 1OZGA 4DIMA 2NU8A 4DV5B 3AB8A 2JI9A 3N7UA 3C1AA 1EUDB 3ZS9A 2VHZA 1YVDA 3D0KA 3FQQA 3MD0A 2J32A 1ARZA 3VO1A 3V46A 4B2LA 5CVDA 1LDNA 2C8LA 2JEZA 1ZL2A 4JV5B 4PZDA 4UVIA 3WMFA 4C2UA 1T8UA 3O0TA 4OLHA 3S6JA 1YHQ1 1SCQA 4BLRA 1O54A 2DXIA 5H82A 3IO3A 1OIWA 3OEHD 5AVOA 1JA9A 4KV9A 1P29A 2D8AA 4NI5A 3ZHYA 3GTKA 4WNAA 3LT0A 2ZJFA 4BLTA 5ALJA 3IEKA 2NZ8A 3M0AA 1CZ4A 2QLFA 3BWXA 3VJMA 1CE8A 4KDEA 4Z7JA 3KQSA 4KL8S 3NDBB 2WU0A 1E2QA 4MMZB 3AYXB 1P80A 4P7KA 3VAZA 4AJIA 4DDVA 4HNQA 2HMYB 3BRQA 4A3LI 1WCV1 4JUCA 3N2ZB 3K0KA 4PPFA 4HQOA 2VDWB 1P1RA 3M3YI 4PCAA 2BFDB 1IBKB 3RS5A 1T1JA 4XVUA 5C4XI 5E95A 3RO7A 3ZWPA 1ZI9A 5AHXA 3SYNA 1HQYE 2AKEA 3LQ2A 4RKRA 4I1OA 1ML4A 4JT8A 2R00A 4WZ6A 4G65A 3W6UA 2OTL1 3DMPA 4P9NA 3TW4A 2FN3A 5D7BA 1UBLS 2QN9A 4I5EA 4LXGA 2PQ0A 5LC1A 3OJXA 4MLDA 2R2AA 1BCRB 3OIUA 4C0KA 3CONA 3LPMA 1A88A 5C8XA 3N8DA 2BJHA 1PG5A 3RK3C 1S3FA 4TMWA 1PSZA 3D5TA 4HT3B 2ZB4A 1I36A 2QVBA 3GFGA 1X7ZA 4MOWA 1XN1A 2O8CB 3D0OA 1NKVA 1XTUA 1O7JA 2ZYTX 3MWJA 4PIVA 2OZEA 3OMWA 1SQQK 1NU1J 2QM3A 1O94D 1FYWA 2AOWA 4OXXA 3SZRA 4RW0A 2AVDA 2F3PA 4MUMA 2C0PA 4MS3B 3DOOA 3ACCA 4AJ1A 5EZQA 1Z07A 1SJ9A 1H0TB 4H4EA 3VR4H 1UBSB 5GP1A 5T8KA 1B3RA 4BKQA 3ERCA 3L35A 2X8WA 1XZKA 1L0NG 1GN8A 2AZTA 4YRMA 3G0BA 4G97A 4P3PA 2FHPA 5T4BA 5FWDA 3HYNA 4MUJA 1J1IA 5A4IS 2AKLA 1G1AA 3QMMA 3AFOA 2VRCD 3M6AA 4GSKA 4H3SA 1OB2A 3RK3B 2ZIUB 1DEAA 5LQJA 3HJFA 2ECQA 4F9EA 2E2WA 2C4NA 4Y2SA 4KIGA 4NJMB 3BULA 2OO5A 2OLKA 3IVGA 1M2EA 2NVQI 4IR7A 1HDIA 2VIIA 1I7SB 3Q8XB 2CW0D 3SY8A 4DUGD 4DJAA 2PIAA 4XKJA 1EYZA 4PHHA 2B63I 4OA8A 1DQPA 5C39A 1T5BA 2FU5C 5EPOA 3GTKI 3ZBPA 4HGZA 2R7NA 3F46A 2XQGA 3AC0A 5ITZA 5DWDA 3B9RA 2ZFUA 1T4BA 2WT7A 1GU5A 2JJMA 3FDZA 2H54A 4JC4A 3PENA 3AE6C 2C1XA 4J4HA 2PRKA 2PZEA 4BQQA 3HU1A 1G59A 5FOVA 4DCSA 5I8WA 2YINC 2WSSA 1VE1A 2W2NA 4KZPA 5DMXA 1UJCA 3C97A 3I28A 3B52X 2EYQA 2GEVA 2NVXI 3WGLA 1Q0ZA 3O4VA 3CQZI 1YBFA 1I32A 1SXJE 4PFJA 1JSRA 2QL5A 3AIMA 1WW8A 2Q6TA 1YITP 3B1YA 4G0MA 1UMDA 2CK3H 2PFXA 1JHZA 1DV1A 2GCNA 4C22A 2R1VB 4XFJA 3EQ2A 4WLVA 3LQRA 3NYIA 3PS9A 3RWOA 1N2EA 1KA9H 4DVGA 2CJFA 3UJCA 4GQIA 3EBPA 4ZYUA 4WKPA 3L01A 2LIYA 3U7QB 1G2OA 3DD5A 1EX1A 4N8DA 3KTFA 4E5MA 1CY6A 3IAM6 3V2GA 1IXYA 1VQ81 1HNZB 3U80A 3OQMA 4L7VA 2IEDA 1BKDR 3H1JJ 2BISA 4R69A 3WIUA 3AG5A 4H7FA 1AW8B 1YVPA 3T6KA 5LB4A 4NMXB 3WYFA 4Y9UA 4E88A 1WB9A 2VHXA 3QTBA 1MLDA 2VPWA 2V3VA 2XVMA 3RV4A 5DTRA 1VBNA 2JFGA 2GDJA 1PEKE 5FXMA 3CGGA 5C5EA 1UOEA 5PGMA 4ID9A 1VMAA 5IASA 1GDDA 5IVHA 4NH0A 5APVA 1B00A 1A7JA 3TZLA 2NTNA 4DRXA 4X6XA 1AKRA 5G4KB 4YIKA 2OCXA 2WAQA 2K9YA 3WADA 3ABQB 3B8EA 4NFYA 3L0OA 1XXHA 5IDWA 1EK2A 1NYLA 8MHTA 1XOIA 5ICSA 2CHGA 1XD2A 1KP3A 1MPXA 1JS1X 2JA8I 1PEYA 4HB3A 4Y67A 2XE4A 1G3IA 1W5BA 4QTXA 3V2HA 1UZMA 2PL5A 3GUZA 4ZT3A 2OTKE 3ZWMA 2A9QA 2ZE7A 3M6IA 1C7JA 1P2UA 3KQUA 4HL6A 5I7OA 3EK2A 3CNHA 2K9JA 2PE5A 2XMDA 1G3MA 1XWFA 4UZSA 1QRRA 4BOYA 2HBYA 3VVBA 1EQ7A 1NWHA 2CZGA 3KE8A 3P7MA 2GUVA 3S16I 1ZCJA 3PICA 4H3VA 4URWR 1CG6A 5AJTA 5EMJA 2AXNA 4AY5A 1G8JA 2CUKA 1HUQA 4YPCA 2JGNA 3BRWA 4DLAA 2VSNA 2WAXA 4JUFA 3HCBA 5IK2D 1NQWA 4TL6A 3VNVA 4X6AI 4GI5A 3ZW8A 1WC2A 3LH5A 3CJQA 3G85A 4MQEA 3QPWA 2DE7A 5EIEA 1LTGC 2YNMC 2ZUEA 5ALDA 2NXEA 4HDAA 1CY4A 2G3YA 5AJWA 4IUBS 1KJJA 4E11A 2GN2A 3VHQA 5GQSA 1MGPA 5SZHB 2ZQ5A 4UJ5A 1SB8A 1TM2A 1EIZA 2H4JA 1WMKA 1O4WA 1UDXA 3K0BA 3FKSD 1GTRA 1MA0A 2W9XA 4BVBA 1JAIA 4A15A 3CX5D 1LTHR 4JOBA 4M8SA 2P7JA 3G79A 4DGSA 1PJLA 3EMVA 4YREA 4FFDA 4RJLA 4KQMA 4QQRA 1FRQA 3ZVNA 3W2TA 1Y47A 2G9NA 2CPBA 4D9EA 4AZ3A 1H8EA 2KYRA 1E77A 2R8RA 4OAOA 3GA0A 2ON6A 5TS2A 4KO8A 4YP5A 2YRWA 5JRJA 4FR0A 1BN7A 1XDGA 1C1HA 1F4LA 2P67A 1Z37A 1U81A 1SQFA 3PLAE 3O47A 1OBFO 1N8TA 1FU7A 1LZLA 4UMEA 3K09C 1JXMA 4UBKA 3UGTA 4B6EA 5KNCD 3TJRA 2MR5A 4DUGA 2PTGA 5DLDA 1QKIA 3SHOA 3AFMA 1B7GO 1QCSA 3FPBA 1AH2A 3RVBA 4D4JA 4ZOQI 2ZWVA 1E89A 3OQHA 3DAPA 1O87A 4LHVA 4FHZA 3BJIC 4KRGA 3LUFA 5DP1A 4YTEA 3GPBA 5L40A 3IILA 3ZHCA 3L6EA 3UHPA 3O93A 3FFAA 3L7MA 3U49A 4Z4FA 5KOJA 2HT6A 2PJDA 3CLRD 3KXLA 1KYXA 3KZVA 4G5YA 4ENTA 2NZVG 1BE3G 4KUHA 4JBZA 3WRWA 3E7XA 2IZ4A 4OSEA 3WLRA 3ESCA 4L0DA 3QIAA 3PEUA 4JZYA 1FBMA 2JHFA 4RQTA 1UIMA 4AZDA 2JLXA 1ZMTA 1NJI2 1IXZA 4X3CA 2Q0QA 2NTYC 1U80A 2AFIE 1BSNA 2EZUA 5AN9F 2PRYA 2VTBB 1Z0KA 2P1ZA 4XLTA 3KDAA 1NQXA 1SQVK 3Q5RA 5JLJA 3UYKA 1VG0B 2QU7A 1L8LA 1UPCA 3K35A 2XQVA 4N0MA 3KRTA 2UUAB 1RWWA 3VBEA 3UV7A 1JU4A 3S81A 3HXMA 3OZDA 2F4OA 2HLHA 1E2BA 2G09A 5EMHA 1UEIA 3CXHD 1GRCA 1U7HA 4AQ7A 1QAMA 1KFEB 1R0LA 1ILEA 1J1EC 3K53A 1VMKA 3LVFO 3N58A 4KN6A 1VLAA 2IEAA 1L5SA 5IWAB 1MF7A 5CYGA 2JDID 4EFNA 4JD5A 3VU8A 3MRXA 2XGOA 3QEBZ 5HMMA 1GL3A 5AVWA 2DVMA 4RO0A 4Q3NA 5B1HA 3OICA 1EFKA 2WAMA 3CNBA 4MDYA 2JBWA 4J1TA 1VYHA 2I2FA 1YIT1 1L7EA 4RPHA 3JYPA 1V3UA 5ALZA 2SPZA 3EDOA 5FR1A 1KAGA 1BX1A 5L53A 3AVXA 4MW6A 3IPYA 1A7AA 1W4AA 1YQXA 3M4XA 4D9GA 3KTAA 3WYCA 3R20A 3CCSP 1FZBA 3O0DA 3PLXB 3DLCA 3LX8A 4HVLA 2KM1A 5IX8A 1TEHA 1GPLA 4FCVA 1E2NA 2PSHA 1UAAA 1YL6A 3L7OA 1WKVA 3AECC 4FNAA 2Q99A 3GF4A 4YAIA 3OCCA 1SVWA 2GZRA 1FRFS 1T5SA 4LHEA 1N2CA 3T5DA 4HH3C 3OPMA 4Z0NA 4HEHA 2NIPA 4BWGA 1G2PA 1X1SA 1ESEA 2W03A 4RD2A 2GYVA 2G70A 2WSLA 3CWQA 5DM1A 3JQGB 2WYOA 1WXXA 3THSA 3K0CC 4CGZA 1O6ZA 4BLWA 2V1XA 2ZTLA 4CM7A 1EP9A 3V00A 4WEOA 4EKNB 4EJSB 1XLTC 3A0BE 3Q3DA 3H1KJ 1A8IA 3BN3A 1B8VA 1LTTC 4CEJA 3GI1A 1T3SA 5CAEB 3GUCA 4O4IF 1JMKC 3A2LA 3B6KA 3OLWA 1SQXK 3H9CA 5KKAA 3IJPA 5IJ9B 2ISCA 5CT5A 1Z0FA 3INYA 1XROA 1NBHA 3P32A 1X77A 1VQOZ 1RNLA 1YVRA 1DIPA 4UPEA 4PINA 2RBLA 3BK2A 1SMKA 2OQQA 4PGFA 5IWCA 4DG8A 4Z6KA 5IK2A 3TD2A 1QIDA 3DV9A 3SBOA 3KQHA 2Y4NA 1QM5A 1OFIA 4IQGA 2GJKA 1W93A 4JB8A 1WZ2A 1OOEA 4TWAA 2Z5HA 2E4ZA 4S24A 4M76B 4D6TD 2GESA 3W3AD 1KEEA 5BRJA 2HUNA 1TADA 4A8TA 2BKXA 4NYMR 1MB9A 5I9BA 3PJEA 5HQ3A 4Y9DA 1S6YA 2YOHA 4TRRA 3WKAA 3LLSA 1DQRA 3M6FA 8GPBA 4TV9F 3UY4A 4AZ0B 3HS3A 3FKSA 3JYOA 4E5DA 4TS3A 2XB9A 4G81A 1BW9A 2PXHA 3ZWQA 2A68D 4UEQA 5D86A 4YRIA 1I2CA 3QEOA 3L71E 1KIFA 2XQIA 3RAJA 5D87A 3BMOB 2Q7OE 3H1HE 2HLNA 4WE3A 4X0EA 3LIEA 4BBZA 1KYYA 2JAPA 5E9AA 3R40A 2Z2YA 3F6SA 3EDMA 1RVV1 1CK4A 4O29A 3MIIA 1AJEA 3AL0C 1VJ5A 4Y2HA 3L7IA 4WFJA 2A69D 4IDBA 1FUKA 1SUIA 4PIMA 3AIIA 4CLHA 1CPYA 2H3EA 2M1XA 4FGZA 4DA4A 3QGMA 5KNCA 3TD9A 3F6YA 3OQ1A 4S04A 4W9MC 3H1FA 4WNCA 2IU3A 4WT7A 1NSFA 2A86A 3BRTB 4MK4A 1KPGA 2GFIA 4W4TA 1DP4A 4JUBA 5H83A 2OCKA 4CM8A 2A6ED 1WY7A 4GZ3A 3CXRA 1L3IA 4HUQA 1Q0PA 4WXRA 3I09A 5KYYA 3DMGA 2IZ3A 1Y1WA 2P9JA 1XZJA 3T4PA 1W5EA 3Q7PA 3AEEC 3TCKA 1W85B 1SHJA 2XAUA 1MOZA 1ZOLA 1KZUB 4RHTA 2J5KA 4CMIB 2IOFK 3SLRA 1Q91A 1TZKA 1NVKA 2P9CA 1U28A 3I6BA 4MQUA 5DHSA 4FOTA 3I53A 4E5PA 1HOXA 2AMYA 2WBLC 3TLEA 2ZI5A 2UAGA 1KI9A 3UAXA 1YK0A 2PBFA 4GX1A 4D6TG 2HK7A 1BZYA 4QGBA 1JAHA 2JLUA 1NH4A 3EXIA 2R6CA 2ACVA 2CBXA 3QVKA 1E1CA 3NHAA 3DBHB 4X64B 3VOPA 3ONWA 5ALFA 3FCYA 4R98A 1XTSA 1EE9A 4KFCA 2ZK7A 4NBVA 2ZSIA 4OIMA 3Q0IA 3M6WA 1KQSY 1YO6A 3D5QA 3QVWA 3X1ZA 4FJ2A 2LVBA 4P3NA 3G71Z 3JWIA 2YYSA 2OYOA 3EA4A 1MTZA 1DMSA 4N5HX 2WG0A 5D5HA 1ONNA 4F1JA 3RC2A 4X7RA 2YRXA 4U2GA 5JDIC 4KQHA 1ZVKA 2PT7A 1ZA1A 4O0MA 4D98A 2P0AA 4PY2A 1U3GA 2F1OA 3DMHA 4QYIA 2ONYA 5BN1A 2HODA 1XK7A 1NNLA 4TV8B 1L4BA 2QVZX 4EZIA 2FW1A 3LL7A 1G3QA 5J2TB 3MAAC 3AJ8A 2H92A 3OF3A 1MVOA 1RWKA 1CSBA 1XT6A 3IBFA 4D9NA 2J5XA 1C3OA 2OCAA 4F4CA 2XJ4A 4AJ4A 5FX2A 5THQA 4I4CA 1HQKA 1MRNA 5FKJA 4NCAA 2QJKB 3NQ41 4WN9A 1GKLA 2MKVA 4BATA 1P4AA 4MVJE 2R5FA 2VEDA 3NASA 3QWOC 4AMYA 3I4LA 1SOUA 3KWMA 2HQOA 1EHIA 3KHTA 2CWWA 1Q20A 1FNDA 2GOYA 3OSUA 1QHHB 1IFNA 3T9FA 3G13A 3T9DA 1AUPA 3PC3A 4QQ8A 5HW0A 2CY0A 4UD2A 3ZU3A 5AK3A 2FFAA 4GVLA 3AERB 1NN5A 1N86A 3DNMA 3EZ6A 1KMCA 1FZTA 1NT2A 3OUUA 4JLDA 3FYSA 2QUHA 4HMQA 3WISA 2R32A 3NHRA 2ZAIA 3ZW9A 1FNSA 1JWHC 2OYCA 4OFZA 4FDAA 2ZTHA 2OQRA 4J16C 3TTYA 2HXSA 4TWJA 4DLUA 3IAAA 3CCS1 3OWXA 4LVUA 2PS9A 2QQEA 3EPHA 1LX7A 3O4IA 1M6EX 3JQBC 5TF0A 5K8UA 4YS6A 4BMDA 2ZYWX 1ZCBA 3B3JA 2QI9C 1ODFA 4HWRA 2Y27A 4E2YA 3QE3A 3EIFA 1WA5A 1V5GA 1OF1A 5HA5A 3F1LA 1G9TA 3HP1A 2QRHA 3W3AA 3QUSA 1IXRC 5B6CA 5BUQA 1EP1B 1OBVA 3V1TC 4ZZ0A 4QUIA 2JJ1D 5FNVF 4YDRA 1H8AA 3SXUA 5EWJB 3V4SA 4M9SA 3EGOA 3I45A 4RPGA 3BCUA 4EB8A 1U8TA 1CZRA 4F38A 5DU2A 1NVUQ 4D92A 3S2IA 3ZWOA 3QLJA 4AWXA 1HURA 1ZSVA 4NESA 1Y81A 2GAFA 1UFOA 3H83A 1K732 4YDQA 3B53X 1Y8RB 2D7CA 4HN9A 4XCXA 3E82A 5DM2A 3KL4A 4LRTB 4ZDIA 4GODA 5BSTA 3NC1C 3TL2A 2D2IA 1JEYB 3AL3A 1SC6A 4PQGA 1IMOA 1N7JA 4TUYA 3HEMA 4NCXA 2JIMA 2CDRA 3VTZA 4OI0A 3TZEA 4TWBA 3B71A 1YD7A 4ZANA 3H5NA 1ZSYA 2KJQA 3VBCA 2VPZA 2DPMA 3BE8A 5CFRA 5JBIA 2YY7A 4KLNA 2XTJA 4EB3A 4AFNA 3IFMA 1W88B 2QV7A 4U6QA 6GPBA 3R9WA 1YB6A 1RKBA 2ZT7A 1DAPA 3ILVA 3NYWA 4E22A 1PKEA 1JLHA 3B9BA 3MWDA 3GBPA 2FTKE 4DZRA 3DAOA 2WTYA 4EZBA 2WJ3A 4HQNA 1OYWA 1NBIA 5BXYA 1KZ1A 2JC3A 3B4SA 3ZYCA 1H9AA 3AI3A 4E4RA 4XIGS 1SKQA 2FWAA 4MRAA 1TVEA 2OHGA 2P62A 4KC0A 2VDPB 4UTOA 3PNVA 2COKA 4DDKA 7MHTA 2Q21A 5LXTF 1RJ9B 2P2LA 1Y33E 1UQRA 2JFXA 1Q17A 4DOMA 2Y9MB 3KM0A 2LXCB 2OLJA 3W06A 3L8MA 3MCTA 1E62A 3PRJA 1L7XA 4OL0A 2I7CA 1Z8FA 3SIPA 4MKRA 4BWVA 1GADO 1BCCD 3K1YA 3IKLA 3CCMP 1Z06A 3C15C 2WJWA 1SQBK 3TW8B 1OWPA 1L8XA 3FNBA 1LNQA 1B74A 1UADA 1ODIA 1WPXA 1FBNA 2XOXA 2C2MA 2CJWA 5EZYA 1IRXA 4IICA 4RKWA 2AOUB 4KSCA 4GFDA 4TL8A 4YJDA 5K0FA 5CDYA 1AUVA 2E4YA 4DJEC 5JATA 5F73A 3LX6A 2Z1DA 1ZIXA 2VF8A 5A7HA 3K0FA 1KQGB 1E3LA 2XA9A 1WCXA 1IOLA 2ID4A 3V8QA 4ZZ2A 5AW7A 2VTKA 4O5AA 2IP4A 2R6R1 3U7HB 2JFVA 3F49S 2O7NA 3EVFA 2PFSA 3E61A 5FUWA 3MCAA 4R01A 4YWJA 1NU1E 4PG5A 4RVUA 4XYLA 4JOQA 3VUEA 2GILA 4DR4B 1JZTA 1QAQA 5BOVA 5JT1A 4UHHA 5LLTA 1P91A 3WHLA 2BBOA 1GGEA 4YXDC 4GPD1 4WOBA 2RH8A 2B5WA 4PC2A 1DIRA 1DEEG 2XLCA 4TYWA 3O92A 2DCMA 1C9EA 3FPHA 3CRVA 3PTAA 4Q93A 2PL9A 4Q34A 3RW9A 2PI8A 2DMRA 2FSVC 1N1DA 4GMHA 4CG1A 4JGBA 4D6XA 5IMSA 3EWIA 4W9NA 2JVKA 4UVGA 3M4OI 4PO8A 5KLIB 2JEOA 1QGOA 3GVCA 3L4BA 1UWLA 1V1MB 4PLHA 4EHKA 2P78A 2JH9A 3HOXI 2MSWA 2OSVA 4ARZA 5E4TA 3BG1B 5F7OA 1KFBB 1O0CA 4GKKB 3K5BA 3BFJA 4MR8A 1JDBC 1IZ8A 2G72A 2BEJA 3DTVB 3ENZA 3RC9A 2ZM6B 3IUQA 1SA0B 3NWEA 4NC9A 4E5KA 4J75A 1E9SA 1ISFA 4L76A 5JO0A 4HPWA 3OURA 1F20A 5H5JA 1ZR2A 2EX1A 4POAA 2WM9B 1P0IA 3V4OA 1ZXGA 1BE8A 5CCGA 3ZIDA 5FA6A 4CLRA 3DMDA 1VA4A 2NTEA 2DC1A 1AKNA 4C0QC 4CFZA 1NFFA 1TT5B 1NVTA 1T13A 5EQFA 2BE9A 2OP1A 1ZUHA 1BCCG 3I9LA 3QH4A 4MXUA 4OGQC 2IUYA 4ZGGA 3W6ZA 4DCKA 1WV0A 3F97A 3ND6A 4EF5A 5ESXA 4RXMA 1JG2A 3PGJA 2QRJA 5AUNB 1GU4A 4BQIA 2WMMA 2OLEA 3WKEA 3PGLA 5JXHA 1G8MA 1CUUA 1ODKA 1UHDA 4MULA 3WUTA 3GDHA 5U9CA 2NVBA 3II6X 1ILWA 1XZFA 3P9RA 3GVIA 3ZK9A 5IEBA 3I6ZA 2JFUA 3AUAA 2IS4A 3CYFA 3GCFA 2VSOA 4EYOA 2EL9A 2PH1A 2BI4A 2ZU0C 1H6AA 1XD8A 2RBEA 3KUCA 5BUSA 3BREA 3TYXA 3GPIA 1PHPA 1M6NA 4GYJA 2ZSEA 3M1IA 3AY7A 5CG2A 4C0BA 3S8MA 3G8CA 4M7WA 4TYNA 4D99A 5BN5B 4Z8YA 1A9QA 2BKLA 4OGQB 1GZ7A 5JJLA 3T3NA 2DY0A 3GG2A 4G86A 3H1JE 3HM9A 3KZNA 1A02F 2D54A 2WZBA 3TQTA 3D3QA 2XNKA 3TG2A 10MHA 3M3DA 3FVVA 4RFSA 2QX8A 8ABPA 2P4SA 3X1YA 1DXQA 3RGGA 4Q9LA 3QVJA 3AXSA 4DKXA 4U39A 4IP0A 3ZCRA 3GTGA 2QRDB 1XRRA 3ZWBA 4WQMA 3AKZA 3IPCA 4QAJA 3FAKA 1X8KA 1ECPA 3RSZA 3FPEA 3LQKA 2D7JA 4EUEA 4X8LA 1L0BA 3IPXA 1LPOA 3IP7A 4KR0A 3HNRA 5DJTB 4FYYA 2FN4A 3IIEA 1X7YB 4TLBA 4PSCA 1ID1A 5DHAA 1JLLA 1KAOA 4E4YA 2WVGA 3PI6A 4RF4A 5CEFA 1LJUA 1ZEJA 4D26A 1CR0A 3AESB 5ES4B 3LO5A 1ZI6A 3QF7A 5CEJA 4E2ZA 2OD7A 4ALLA 4V3CA 1FFWA 1KP9A 1VFNA 4P53A 2ETXA 1P6XA 2P3YA 1KILC 3QOXA 2WQZA 3D70A 4OFXA 4E2FA 1Q1GA 1E58A 4M8IA 1XMIA 4X8MA 5KTBA 2ASEA 4KQXA 2QJTA 3GKQA 3GH1A 3I8XA 1RQNA 5I4BA 1YKSA 1QIMA 1NN3A 1T3ZA 4ZVUA 4WY4D 3CH7A 5D6NA 4G0YA 1WIIA 3OM1A 1LLDA 4AD8A 4UBJA 5F1KA 5FRDA 4UB8E 2X4GA 1L7MA 1ACJA 1Q2UA 2BI8A 2D2XA 4B85A 3L40A 3WICA 3H32B 2FUKA 3H6GA 1YDWA 4ZYTA 4QATA 2FEOA 1GRRA 1V96A 3FMIA 4EGAA 5SYAA 4WLEA 2QEXP 1F48A 5EJAA 1XQVA 1US8A 3D2AA 3AIOA 2R44A 4CR8A 4HJGH 1CZLA 2DHRA 5KOHB 2YZGA 2HW8A 5HFJA 1ZOPA 2W0MA 1H69A 3GLIE 2F1JA 2O3SA 1JHRA 1VJDA 2V6GA 1WO8A 4IINA 2I1KA 3BCCJ 3M8KA 1KOLA 4R1NA 2H4FA 3BIJA 2E89A 3JALA 3DBRB 3L07A 4XGIA 2O2EA 1IZZA 1QYXA 2LDXA 4RXUA 3QBEA 3B7PA 1FXSA 4B09A 4LJRA 1RKQA 2H4XA 3UBMA 2QNIA 3TSCA 1Z33A 4TM8A 3WV4A 3C3JA 4WNYA 3QW2A 2ST1A 5EJMA 1IFIA 1VI6A 3ZY6A 4F72A 4IFDK 4MRRA 4GEGA 1HYBA 3CCM1 3I56P 2GN6A 3RBVA 1TFUA 3IESA 3CWBD 3A2AA 1RF0A 2BZSA 4D8UA 3JQRA 4UDXX 4B5KA 2RT9A 1Z6GA 2V96A 4ZAYA 3WL8A 5JVDB 3DZFA 2ZJ3A 3LC7O 1E1YA 2I1LA 5AVRB 2H2IA 4U2KA 3G71P 1P1IA 4HQ0A 2BSXA 3L36A 1H6DA 4I50A 1BW4A 1TUBA 3GPCA 4DDWA 2ERCA 1EWRA 2IEYA 3KVRA 1NY6A 1CBUA 4ZRMA 3SZUA 4ZEVA 2GEJA 1VZ3A 2FPOA 3A4MA 1PZXA 1NP3A 1SM4A 3F7TA 1LPSA 4QXPA 2DFNA 3W6OA 3RVJA 5D1OB 1BQ3A 3KSDO 5B4VA 4CKBB 1Z4IA 5C8ZA 2ZS8A 1M90Q 2ZTUA 2IBTA 4W7IA 1GZDA 2JFPA 3L6RA 3NBFA 4EYQA 4OHZA 4TTQA 1Y37A 5EHNA 5AQEA 3B5EA 2I71A 4C5AA 3LWZA 4L9SA 5DNCA 3L43A 5DYGA 2BM9A 3MSXA 1GOTA 1U7DA 2YMLA 4PXYA 3T7TA 1WF3A 4NH4A 5JCOC 2GS9A 1T3JA 1K88A 3OZFA 4OVNF 2XOKD 4MHTA 4PSKA 3MZKB 1FDUA 3KQYA 1CEQA 4RLHA 4YAOA 4HAWA 1U0NA 3AIKA 4UUAA 2D62A 4IMIB 5AK6A 1YRWA 2O1JA 2JH8A 2NWQA 4M8KA 3SWWA 5IT9A 4W99A 1FQWA 4H1TA 4G37A 1R9GA 1B0ZA 1KI1A 5IKPA 3Q9SA 3HV0A 2H1OA 1RABA 2GEDA 2QDKA 4FEYA 1FZGA 1E2HA 1W25A 3HK2A 1SH7A 2B9VA 2BCCE 3KWLA 3IH5A 3TM5A 4ZI7B 2FWNA 2ZZMA 5EFWB 2P11A 2A9PA 4DMFA 1FC2C 4DUYB 4MCJA 5GJVC 4XX0A 5BUCA 2ZS9A 4GC9A 4FD3A 5EYPB 3DZGA 1A97A 1WSWA 2Z3ZA 1TF2A 4Q03A 3ID6C 4NBSA 4X85A 3WIDA 2BFFA 2G83A 3K1AB 1QHNA 3Q87B 3UNXA 4YGYA 2IKQA 2V5UA 4MPJA 3CLUD 4LOLA 4EMTA 4FYKA 5KAFH 4MYTA 4MVWA 5BN4A 1RAFA 2WSFH 2W2TA 3VU0A 1JY3N 2KNCA 1V11B 2GBPA 2WSSD 4TRMA 2QPTA 3EAGA 3DFUA 1HF3A 3NJ4A 4WN3A 3HLKA 3QVOA 3QF4B 3R9KA 4MV0A 5C44I 1KYQA 3ZE8A 4QPDA 2C29D 2OXFA 1UMBB 2GPBA 5K9ZA 4QPZA 1U7JA 4U2FA 2UV8A 2L69A 1W5AA 4N7BA 2DPGA 4BKMA 3HYSA 5REQB 3CCSZ 1PJSA 1QP7A 2I3GA 4YXFA 4N7JA 3E2IA 5AW6B 1QUFA 3QKIA 1QZTA 4WCFB 3OVMA 4CCYA 3TTWA 3WNVA 4RMJA 2V7VA 5IJWA 3B5NB 3HU2A 1ZU5A 2X8JA 3TRKA 1T4CA 4Q47A 4D0SA 5CVUA 3Q1LA 4X41A 3DUFA 2VJMB 1RRPA 5KLVE 2IZ0A 4N39A 3ENQA 2ORIA 4F2HA 2FWRA 3RS0A 4WY4A 1ZFNA 4V0MA 3VR4D 1B41A 3RC8A 5IFLA 3NFRA 3NFYA 1R8EA 3TLAA 1Z88A 1NKSA 1TTQB 2M3BA 2LD4A 1XMQB 1ZMEC 3H1KE 5I9LA 2FDCA 1L0ND 4Q4HB 4XIJA 5EC8A 4CFSA 5AW0B 1ZQ9A 1U2ZA 4J91A 3VR6H 4OK5A 2F1HA 2FPRA 2XMGA 3C48A 1TOAA 1JPUA 1VPWA 3D8HA 1VC2A 1EFVA 2B63A 4MPRA 3R77A 3WLHA 3ZD9A 5IH3A 2X19A 4RGQA 3ZIUA 2RHBA 3PWKA 5FLXb 4GL4A 1NMXA 3AWIA 3DWFA 1QZ3A 2V03A 4LYEA 3RVDA 4O1HA 2K5UA 3GP3A 1JEQB 2ALJA 3EXHA 1UOOA