1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
1TMOA 2JIMA 1AW8B 1R7RA 1Q16A 5FTLA 4KLNA 2E7ZA 1E32A 1YLEA 3H0GA 1ZMEC 1H5NA 3QWZA 1E5VA 1I3QA 3OUGA 1KQGA 5T5ID 1CZ5A 4AAYA 3GTMA 1OMIA 1E60A 4D7ZB 1DMSA 1TWAA 1IW7D 4KDLA 1PYQA 1PQEA 2NAPA 5FTKA 3HU2A 2VUMA 2B63A 2V3VA 2NVXA 2G8YA 3GTKA 1Y4ZA 2JA7A 3O5AA 1AA6A 1PPYA 1FDOA 4RV0A 2NYAA 4KDIA 3CQZA 2VPWA 3GTJA 4C2MA 2EEOB 3PLXB 2R7ZA 1I50A 3TIWA 3QQ8A 2NVYA 1SIWA 2JIOA 2JIPA 1WMKA 3HU3A 4GA5A 3TM7B 2VPXA 1KQFA 1TWHA 2PJHB 5DYIA 1UHDA 1EU1A 1G8JA 2IVFA 1QDNA 3CF2A 2VPZA 3H25A 1K83A 2YU9A 1PT0A 2JIRA 4KO8A 3GTGA 5EPPA 4AONB 3GTQA 1E18A 1Y1VA 2R92A 3QQ7A 4CRZA 5C1BA 1CR5A 3IR7A 2WB1A 3IR6A 2KI8A 2DMRA 1WLFA 2PMZA 4CRYG 4QIWA 3GTPA 1G8KA 4CS0A 2JIQA 5FTJA 1CZ4A 1QCSA 2V45A 3O6QA 2VPYA 1AJYA 2IV2X 4AYBA 4DMRA 5T5MD 1PQFA 2E2HA 2JA6A 1TWFA 1VC3B 1R27A 1TWGA 3IN6A 4GA6A 3DMRA 3GTOA 5DYGA 3QC8A 1UHEA 2Y0SA 3GTLA 1TWCA 4KODA 1R9TA 2R93A 3HKZA 2E2IA 1FDIA 1H0HA 5C18A 1SFOA 1OGYA 1PQHA 2C45A 5B6CA 1S3SA 1Y5IA 3ML1A 1Y1WA 1E61A 2JA5A 5GLFA 4AOKB 3EWKA 1PYUB 1PT1A 4AZDA 3HU1A 1WCMA 5FTNA 2P10A 2WAQA 1DMRA 3IR5A 3FKIA 5FTMA
chains in the Genus database with same CATH superfamily
3VUEA 4UUBA 1QWSA 1N2CE 1B6GA 4JI6B 3ADPA 4UJ5A 1ZN9A 5BUSA 4J7CA 2GF2A 2G07A 1XAHA 4RABA 3RK2C 5CFQA 4AUNA 3Q7PA 1P45A 1XHEA 3V9AA 4W5RA 4JXZA 1VQKZ 4COOA 4RENA 3EFGA 3QIAA 2Z3ZA 1WUYA 2QRCB 2D2CC 3IKMB 1RM4A 3H25A 2GX6A 1XRSB 2CPSA 1UUFA 3CY6A 3ABZA 2HU7A 3A5TA 5DW0A 4HSGA 2ISCA 1MTOA 4PCLA 3WMRA 1Z0DA 3QFCA 3KE8A 1HPLA 1IQRA 1ECLA 5DM0A 3UUGA 3WVNA 2C9NY 4NDZA 4PLGA 4EF5A 1ML4A 1U7DA 1F7VA 4EG6A 3AHHA 5KX5B 4YCNA 2FYUG 1IVSA 5IULC 3ZXYA 3GH3A 2FN7A 5IS2A 2V98A 3TRKA 2XMBA 3GRAA 4TLDA 3GMSA 1PR1A 4PV1D 3IAM1 4CF4A 1GNLA 3AH8A 3VNQA 2AFRA 1LC3A 3RFXA 3IPRA 2XXAB 3NHPA 1K92A 5LQSA 2O8FB 4C0BA 1PIXA 4N54A 5D86A 4CTMA 2WPQA 2ZYHA 3BREA 3WI7A 1RAHA 3E2IA 4H77A 3DDSA 4BVHA 3D3WB 1SCJA 1GSOA 3AR5A 3FVQA 3V9PA 4WKNA 4O4HB 2OHVA 4XB1A 3PPVA 1ACMA 3I56Z 3H5IA 4UHEA 3S99A 3ZVRA 1EQ7A 4WY4C 2LCFA 1TLFA 1Z6XA 4R69A 5A3QA 2IZ7A 2BH9A 3UCXA 5K4AA 1MAUA 4OQMA 4L5YA 2PR7A 1CIJA 1I4DD 4LE2A 4YXWH 2XV1A 4G09A 1FFAA 3WLMA 3VOAA 1PR6A 4QXQA 1ZJ6A 2XOKD 2DFTA 3HKBB 1SULA 4Y6PA 4D4JA 3ZIAD 1XTKA 4KVZA 1JHOA 5TLSA 2GK6A 4RIGA 4KKVA 3C24A 4JMLA 4DUYB 2X4IA 1OUMA 4NU5A 3BXHA 2BASA 2C7RA 2YCBA 1IZNB 4FZ3A 3Q40A 1ORHA 5IBPA 4QUIA 4ZKUA 2V3VA 3UB4A 4RAOA 2E5FA 5FHQA 3MAGA 2EEOB 1L0NK 2KYVA 3VU0A 1XJCA 4CZ2A 3N2IA 1SG9A 3D8TA 4O1IA 3KD2A 2QKYA 4ZJZA 1JX6A 4PQGA 1SRRA 1NVXQ 4G4GA 1OKKA 3DBLB 1C8VB 1WDLA 4ENQA 3L1HA 1DB3A 4KGXA 5KYWB 3NAQA 2Z6VA 4JGBA 3D3JA 5BU8B 3TS1A 1XEXA 1FC2C 1HE4A 1FRVA 1T8ZA 4Z1MD 2EKLA 2VK4A 1YDEA 1VJCA 2BRUA 3CX4A 3E15A 1SFOI 3I55P 4IIJF 5J1SB 2ZJ4A 3LDUA 1DKUA 2QJFA 2ZULA 3FMIA 1YO6A 1SZJG 3MUEA 2ZSIA 1FNMA 4Y9DA 1M902 4UVIA 5IANA 4BTLA 5AT1A 3AILA 2OT3B 3QHPA 4HB1A 1HEYA 6REQB 2IHYA 3GJ0A 1YTLA 4YRRA 3KKLA 3GCFA 1LGYA 1ZOOA 2J5XA 2HSJA 2GK3A 2B88A 1KRXA 2Y99A 1GL2A 3CF2A 4HPJB 3S2ZA 4CDNA 1ECGA 1DJLA 1VQN1 4JOQA 2DH5A 3CF0A 4ND3A 4R7GA 1ZK0A 4TLLB 5J5CA 4BIMA 2JI9A 4FHZA 2AN3A 5KJ7C 4KR6A 1GRCA 3TFQA 3I1JA 4ZZ1A 3B6KA 4ZRNA 1JR3A 5EEHA 1PZNA 1FZQA 2OP1A 4YCMA 4NS4A 3JPWA 2P9TA 3QEAZ 1CDDA 4B34A 3LXMA 3IPAA 1RC1A 3DE6X 4HAIA 1ISGA 4B75A 3GDHA 1E4OA 4OREX 3ZHZA 4LYYA 4BJ5A 2G88A 4G0UA 3EVZA 1EUYA 1THGA 1O9HA 4NH1C 1OZAA 4I99A 4Y2TA 3CUWA 3JTEA 2QUHA 2GTPA 4X65B 1QO9A 2NTEA 1ORWA 4FIDA 5CJ2A 3PDCA 2OHHA 5KLVJ 3A4TA 4J0IA 3ICCA 4XUDA 4B6FA 3VZBA 2C5GA 4G5XA 3OHPA 3JAMA 3B1VA 3OG9A 4N6OA 2PFSA 3AY0A 5FTJA 4AJ1A 1JJBA 1C1XB 1QFXA 2GTHA 5FR1A 4O25A 2CDBA 5LOVF 4MUXA 4CRWB 2G5DA 4QGBA 2QIWA 2ZITA 1DV2A 1KQGB 3K9QO 3NNSA 3K6SA 2DE0X 3OJLA 2OAGA 3MIIA 1GQYA 2KYRA 2RK4A 4RKYA 1F9EA 1B0AA 4U6SA 5CT8A 2VDOB 5H9WA 3NOXA 2WJIA 3LAWA 3K1AA 2XA2A 5DHPA 3QXXA 2CJXA 1LLDA 3MYRA 3AE5C 3KUDA 4LQ4A 2GN1A 4IEIA 4ZQHA 3LUBA 3RPEA 4EG8A 4BMSA 1VI5A 3G0IA 4B1FA 3LK6A 1G8JA 3BE4A 4OXQA 1GPUA 1E89A 1Y7LA 4XIFA 3O7WA 1G5TA 1KOJA 2IDMA 2VRCD 3WKAA 1YB6A 1VRWA 1JY2P 4QTTB 3UKOA 1XZIA 3RODA 1BW9B 3E5HA 1Q57A 3A0BE 1KQOA 4K9SA 5J5VA 1ZVJA 4DREA 4WLUA 5K4GA 3ZGVA 1DTWA 4NMHA 3PC7A 5K3CA 3B3QA 2IS6A 5FFFA 1DCKA 4AM8A 3FNRA 4J1TA 4V2UA 4AY3A 3NYIA 2BDUA 3X2GA 4ARAA 1VYTA 3PUXA 2BLNA 4L07A 2A06G 2FPMA 3C1AA 2LP4Y 4ZYYA 3ZLTA 4R3WA 1TMKA 3L7JA 4JVSB 1K5HA 3BFJA 3JZAA 1NF9A 5E2IA 1UFOA 4Q19A 1TVKB 2DPHA 3EEQA 1SH7A 3HPQA 1U9CA 3KXPA 3NVDA 4PZ9A 2PX2A 3B5NB 3AERA 3V2HA 3FDZA 1CJUC 4KNWA 1ZS9A 2PKEA 2IY7A 2NZXA 3EIQA 2JLXA 9LDTA 2ZRBA 3D7KA 1XEWY 3QFRA 3NDJA 1U7OA 1UKBA 1RRCA 2D54A 3CF6R 1XTPA 1RM3A 3H1EA 2CLEB 3QF4A 4DAOA 3K0AB 3IQEA 2O4HA 3GHGC 2XD9A 3I2KA 3M6XA 1V3UA 1L7QA 2QVGA 4L4XA 2H52A 3PU6A 1KDRA 4MJLA 1YXMA 1OWPA 3JXEA 4KMOA 1UODA 3V3TA 3VTFA 4PIVA 1M83A 5F2NA 4M0LA 4P6VF 4R8VA 5HMMA 1JUDA 1QPBA 3IKJA 2J7KA 3BPSA 4IXWA 1DC6A 3PRKE 1USWA 5CBOA 4JP5A 3V97A 5DTJA 4KFTA 2WAOA 3RGGA 3CUSA 2DERA 5AKIA 2R7LA 1E6KA 1PHPA 2H2FA 3RS0A 2H1IA 3JASB 4ALJA 4OFBA 4IMPA 2L82A 3E2MA 2QD3A 4ZVOA 4MVJP 4K86A 4EMTA 3SIWA 1CF4A 4M0FA 3KYCA 3EXIB 3STYA 4A3FI 3QLUA 5CR9A 3HKDA 2AOVA 4UMDA 3B89A 2P90A 1IWBB 1OLUB 1ZYUA 4RVNA 1BGVA 1I3OA 1IFXA 2J67A 3TRJA 1IL0A 2AFIE 3T0IA 1UKCA 1GRNA 4QDXA 3K94A 1XYYA 2JAQA 4FN4A 4LS3A 5DULA 3TM5A 5KPDA 1YUNA 5JJBA 2OBXA 1MN6A 2HGZA 1FNBA 4LFCB 4FE3A 4TLFA 5DTQA 3OEED 3I3SR 2QUIA 3AEQA 1F8UA 1K63A 4U3FG 4G25A 3IV6A 4HMOA 1JBQA 1B74A 2FYTA 4YO7A 2HF7A 3JQFC 3LCMA 1ZHOA 4TXLA 5L95A 4KP7A 4BNTA 1BHSA 2CJYA 1I7QB 5LLTA 3F6BX 2VH2A 2ZUVA 3GJ7A 1AHNA 2OGSA 3DGFC 2B8JA 2C7OA 3B9RA 1JG2A 4UTNA 3GN2A 3S8MA 5HF6A 3G0GA 1Y80A 4DMCA 3H2KA 4G86A 4E5MA 4S1TA 2J3QA 5J59A 5BURA 5TC4A 1FW8A 1QHYA 1IBCA 2E21A 1BCSB 2WZ7A 2ZRAA 2Q1SA 4OGGA 3VR4H 1A8SA 3DM9B 1JECA 3P5BA 5DLPA 5LYYA 1YZNA 2JDIH 4JENA 1SQXG 4YAGA 1KO7A 1AQUA 2GBLC 2O1EA 1S1CA 1PZGA 4CR6A 5AVVB 1PG2A 5FLXA 5FCDA 2R79A 2BGNA 4FE4A 1Q7GA 1G8PA 4J0FA 4FWIB 1NW5A 1N92A 2NZ8A 1A5BB 2ZJ8A 5IU6A 3GF7A 3L84A 3OOWA 1FX1A 2G36A 2X4DA 3BERA 4OOEA 2JS4A 1JFRA 4HH4A 1Z8HA 4PXYA 3O73A 4G63A 1A9ZA 1G5HA 3Q3JB 5ECDA 1I2MA 2IL1A 3LLSA 2BFAA 1Y7IA 2XH8A 3JR3A 1QO0D 4D6YA 3QFTA 1S3FA 5GTIE 1E3TA 1P60A 2O3SA 1CLUA 2HUNA 4RQBA 1P2TA 2OQ2A 3OQOA 3OSUA 5I8PA 4WESB 2AYDA 1VMEA 2OD9A 4UVDA 4L5CA 5ED0A 2NU9A 2XTJA 7ABPA 3GUZA 1WTAA 3H11B 1ZH2A 3I9OA 4KE6A 2EFEB 3S5UA 2P5YA 1SQXD 3UB2A 1P0IA 2CPBA 2EBWA 2OHGA 1UBNA 4DIDA 4L75A 3NYQA 4Y6GB 3ZQ4A 3CZBA 3CX5H 3HKCA 3KJIA 3S1AB 3VMHA 3D59A 3ZK7A 3OZEA 2W7TA 3L0BA 3R8CA 3FXAA 3WYEA 3ROTA 4GMFA 4MAFA 1TIKA 3OPMA 3UOGA 2AG0A 4NMWA 2AV6A 1JKXA 1E6MA 4JXKA 4JOSA 3TVDA 1KP2A 1CY1A 5CCEA 5GZ6A 3BATA 1YU9A 2GCGA 4KQ1A 4A73A 3EVAA 1NWQA 4WINA 3BXZA 4A2PA 4EI7A 1JQBA 3CH7A 5FP0A 3AEKB 2YV5A 1CJMA 3GROA 4UUMA 1ZI6A 5C44I 3OJOA 5TMDA 3HEAA 2O5EA 1KU0A 3D4OA 3PFKA 1JU9A 3PUYA 3AJRA 4G1CA 4XUGB 2XCTB 2OYIA 4U7HA 3S7TA 1N7SB 4JKIA 1G59A 2CCJA 5JZVA 1B42A 4V0QA 2G5CA 4ZJUA 5KYUB 4PX3A 4C0SA 3NTVA 3W6ZA 3C14C 2YN4A 1X9GA 3EZ9A 2J09A 5JD5A 3V6IA 4IV5A 2ZBUA 3GTKA 4KXMA 5TF4A 1WLYA 1HBJA 4C6HA 2WD8A 3FUWA 2W2LD 3RM3A 2C96A 2PSSA 4EYKA 3C5WP 4M8IA 1X8JA 1T2UA 4W5HA 2ZXEA 1QJCA 2FW0A 5LUBA 3K4PA 4I1UA 4Y3UA 5I7VA 4BO2A 3BCCE 2W2TA 1TM4E 4ND1A 5TV2A 4P4UA 4OIFA 1P3DA 4GFDA 2M2IA 4NEGA 1OFGA 4QG3A 1RPTA 5I51A 1OX3A 3OZCA 4XPIB 4E7OA 1L4HA 4HXYA 2JF0A 2NUAA 3OOSA 3LQYA 3G8CA 3DT6A 2BCCJ 4HUQB 1CPYA 3B3AA 4CIXA 2JJ8A 3W5AA 2WSFH 3ADCA 4EO9A 2ZTLA 3MWFA 2WAYA 3KK0A 4ZCTA 3I8SA 2HI0A 1XXHB 1AU9A 3UBMA 3N2KA 4HXEB 5KDOA 2FE4A 1L4YA 3OP1A 3ZWMA 1LV7A 2ZWOA 2YDYA 4KHPB 1QTIA 3BQMB 4OGQB 3H1LJ 3QZUA 4XYMA 3ZY3A 3IIMA 1ZX1A 2QA5A 3R24A 4NJEA 3ZGZA 5BUZA 5JHGB 4IJUA 1W29A 1WP9A 5AQEA 1S3GA 4B3JA 1RAEA 4KSYA 4MVJA 4ECAA 3ILYA 4JLNA 3C3XA 3JQ8A 4Y2GA 5B37A 3IUJA 4ZV4A 1MJGA 2FN9A 2CK3A 2JGDA 5HJ2A 1SZPA 3N28A 4FFPA 1NC1A 3WMEA 2QXUA 2UYGA 4DUGA 3C3MA 1FLNA 5AP9A 3N8NA 4JI3B 1LPMA 3MINB 4PZPA 1X87A 1NRXA 3R7WB 3QI7A 2VDMB 2DX7A 3HOUI 4QNRA 1OXXK 4QBHA 2QZSA 2VWHA 2HT1A 1T36B 2JVJA 4L57A 4MV0A 1GPYA 3H1TA 3NRCA 1JH8A 2QLTA 3W1VA 3HE4A 4X62B 2D3TA 4R16A 2IU0A 2F64A 3NTOA 2O1SA 5AW5B 1C5KA 2WHQA 2ZVNB 1TGYA 4YPVA 1DNPA 5BXYA 2H9YA 3TINA 4K2HA 2XF8A 5I9NA 2JRLA 3ER6A 5B4TA 3DMGA 2HMTA 2YW2A 2PHZA 4W7YA 4ZIRA 3B2QA 4BYMA 3OPXA 4HAVA 1U7ZA 3ANLA 2GPNA 3GTMS 3UWKA 2QD4A 5ITWA 4JX9A 4MIYA 4O2AB 5L3QA 4DYHA 2DVMA 3PD0A 3D2AA 2QE7D 1F1BA 3L8ZA 4UAUA 3T0GA 2XCRB 5EJIA 2JA5A 3MAJA 4ARZA 3GL9A 3HU1A 1DSSG 1WF3A 5I3ZA 1V1MB 2I80A 3K2IA 1RWXA 2P4SA 2IE0A 3H6PA 3R0IA 1ZITA 1LA2A 5DTMA 5BOVA 5KSWB 3KHUA 1LVUA 2YWJA 2PMWB 2ZAIA 3BFVA 1IBRA 3WGJA 3I5YA 4R1NA 3ROXA 2R6FA 2Q3DA 2ZVJA 3AJ8A 2F3UA 1MG5A 4NFRA 1WNTA 4EFNA 5BR8B 3WLFA 4JI7B 5CBPB 5LKAA 2OTLZ 1NR5A 1HTTA 4F9FA 5F3RA 2Q50A 5EJ8A 5KLVD 2ID7A 2WKWA 4B3GA 4C1BA 3NORA 5BQXA 1RC8A 3K30A 1EP1B 3W5BA 1LT1A 3OCWA 4ZCSA 1UPFA 4YFVA 4M37A 4R1TA 2WOJA 3NBUA 2RGNA 3HB4X 5AVZA 3S15I 3BGOS 1VJ5A 3WWPA 3T54A 1O9BA 1BCRA 4WV3A 1X7XA 4DLUA 2V7QH 3KKZA 2C2WA 2WTYA 2WPRA 3BJEA 3CF4G 3X2JA 4MUKA 1KYIA 2GZMA 2G7MC 2X1LA 3ZDDA 3L4EA 1UBRS 2DPLA 4W6QA 1I1OA 1K3UB 5DBIA 3M34A 1ZJ4A 2YH2A 3VVMA 3WZMA 5B6PA 3PUVA 1HO3A 3ED5A 4B35A 2I2WA 4P7GA 3HO6A 4QDKA 2VEDA 1KD11 3UXEA 2HMAA 3C8DA 2WU3A 4WZZA 5FUWA 1KQNA 4DNXA 4EK9A 1OZ0A 2V3CC 4FYMA 3KSZO 2I8CA 4R54A 1PFVA 1HDIA 4DNFA 1IN6A 2O3TA 3FLEA 3IE2A 2VTVA 2HQRA 2HO4A 1DIRA 3QU7A 3JD4A 3PK0A 4BQIA 1YQ9A 4UQOA 3BWBA 2NO1A 2VP3A 2HC9A 4X9XA 2NNWB 4CTKA 3S68A 4PQRA 4LNUA 3BGDA 5B2EA 1EP9A 1L5YA 3VP8A 1PLLA 2O2HA 3H1IJ 2IS4A 4PSVA 1CEEA 1Q1ZA 1II9A 5IDWA 1LFDB 3ESZA 3AVPA 4BFTA 3RQIA 1W46A 1QP8A 4RHFA 2H54A 1TWHA 2KZIA 1ONBA 3IVXA 2WUGA 2ZWMA 5CURA 4MW2A 2O2ZA 1B0UA 1DDIA 3PQ8A 4X71A 4GYKA 2PK3A 2HWKA 2JFOA 4KITB 2GCEA 2VQDA 3V48A 1U9JA 3V2GA 2DJIA 2I1VB 4EIJA 1XXLA 2JA8I 2VEOA 4Q4JB 1ZAKA 2RHJA 4TZKA 1Q95A 2BWJA 3C98A 1XU4A 1Y3HA 1M66A 3Q2KA 1DBIA 2WT9A 3UAWA 4CL1A 4KYIB 5AWFC 3WRXA 3ZDQA 3RK3E 2VLBA 4F2HA 4BWVA 4W99A 3SQLA 4DCVA 4HL6A 3W1EA 3AKYA 3W6NA 5ELLA 5I7AA 4JP1A 2BCCE 2RH8A 3IA2A 4RD4A 4QU5A 3P9IA 2AFIB 4I55A 2GZ3A 2G06A 2X6RA 3DZGA 4X00A 5JCOC 4A8TA 4HYQA 3HCAA 1RF1C 5IKEA 1EWVA 1N8R2 4ID3A 4O5AA 1SUBA 1LT9B 4H0CA 2H7HA 1JEAA 3N2YA 3K7AI 2HDWA 1BDIA 3JU3A 1YZYA 1X42A 3MYYA 4KR7A 2HRBA 2Z4RA 4D3SA 3H1LE 3TGUG 3KJNA 1E3MA 3H0GI 3LYUA 1RMTA 5LQNA 5K0GA 1CDOA 1DX4A 1XEWX 2P2SA 4JQOA 1KQ3A 4WADA 1QMPA 3NTQA 1OTXA 2YWHA 3ZKWB 4BMYA 4MJ3A 1B6RA 4YRTA 3QEMA 1T1RA 2QP3A 1GGKA 3WFJA 4M1TA 3VZCA 1NW8A 4QQRA 3IDZA 4JB3A 2AG1A 2B78A 2NM0A 3IXMA 1G98A 4JV5B 3CWQA 3JPYA 3T1OA 2IUUA 3T3MB 5G02A 3RHFA 3CZAA 1BRTA 4CIDA 3VSBA 1TTHA 2D0IA 3OT1A 4NENB 3O8LA 1QCSA 1KWGA 1S7GA 4TKMA 2IHTA 1K0UA 4YMHA 5JS6A 1CRZA 3I4CA 8ATCA 1I32A 2JGLA 3NBKA 3M3GA 2PANA 2OCBA 4M1EA 4UTRA 1VQNP 3H86A 5FEUA 5TSDA 3F2IA 8LDHA 4RK1A 1KSGA 4YRFA 4DV6B 1VBFA 2D1RA 4PSUA 2HRZA 1DAHA 2JLSA 1FU4A 2QORA 4HZGA 1THZA 1KMHA 2J9ZB 2ZIFA 3A2MA 3NKFA 4FFVA 1C9YA 1VIYA 1JLHA 2JFXA 5GJVC 1WVGA 1YF3A 5F1OA 3IDOA 3R5XA 5EY5B 1DJQA 3I04A 3JYHA 4Q4LA 4JDUA 2Q5CA 5E9WA 3W2FA 2YU9I 1CDEA 3UV7A 2QJKB 1IOVA 3HL4A 1IQPA 1BOFA 3SEFA 1RPJA 2XVMA 4FT2A 5CM9C 1EUCA 4GP7A 4Z4GA 4WXHA 2VYFA 4XB2A 4PYRA 4MMXB 3IVGA 3KQWA 4TM7A 2BSQA 4O0MA 5MGNA 1F7UA 2LNDA 4F2PA 4NZNA 1R4MB 3W79A 1RKUA 1Z5UA 4RGYA 3GFQA 3FYHA 3GVHA 3N1UA 1HOTA 4ME6A 4ZYWA 1WBJB 4HVCA 4GOFA 2YMLA 3BD9A 2JHPA 4D8TA 4NBUA 3A58B 3G9ZA 1NBWB 2OO5C 2ZR8A 2YXQB 3KKKA 2RMKA 4X1OA 3IUBA 4WD3A 2ZI5A 2X7XA 1QNLA 1PT8A 3I2FA 1DI0A 3CLQA 3N4XA 2AL7A 1ST3A 2O2XA 2IS2A 3TGLA 2NAFA 4EHAA 1XKLA 3UC5A 4B2PA 1E98A 3CPWZ 4KN5A 3R77A 4BZXA 2PS0A 1Y6ZA 5DX0A 5JJ5A 3A36A 5M34A 2W6NA 3ZI7A 4IEEA 2VJBA 1CJKC 3DNFA 5CFMA 1XZCA 2QYTA 4LYDA 1G6KA 1W73A 1KNQA 3MZKB 3GPLA 2H17A 1ARZA 4RY9A 2X5KO 4ZI3A 4IL6H 4FQ7A 1NF3A 2ZU6A 1GFIA 2Z2IA 1RYEA 2Y1EA 2EL7A 5I47A 2R00C 2DAPA 1P0QA 1NNUA 3CT6A 5L9AA 3K0HA 5D3KA 2BGMA 5GADl 4MPJA 4B3FX 4ZM7A 2PZGA 3EGDA 4S35A 1R6DA 3KR1A 2K2QB 1DQSA 5EUQB 4RA6A 4MGHA 1A71A 3ZD7A 2ZRHA 1I3CA 4TS3A 5KNDA 1N3IA 4GSYA 1FOSF 3S16I 2ANCA 4Z8YA 3Q7SA 2FOXA 2ZW9A 3PT5A 4DLWA 1Q21A 3I6MA 1C2YA 1KI2A 2NUPA 3MGAA 3O2SB 2XE7A 4COKA 4DSAA 1WD7A 4J49A 1M57D 4MW0A 2KM1A 2FR0A 4IIJA 2C2XA 5BRAA 1T5TA 2UZ1A 1RZUA 3P9CA 1KI8A 1NVDA 1V9CA 1ZD3A 4DW8A 4H7HA 2IUTA 4TYYA 4WQMA 2YV1A 3WL5A 1T0BA 4W7ZA 2QVCA 1WX1A 4XVQA 1CUYA 3JVVA 4BMPB 3H1IE 4AKHA 4PQYA 1GGEA 1FFDA 2R2GA 4OK5A 1NWCA 5I45A 4FKBA 4D96A 4JYPA 1A5AB 4BNYA 3UJNA 2YWFA 3GA7A 3W8RA 4GECA 2CN1A 3GJTA 1PQUA 2HNBA 5F1KA 4D9FA 1NH4A 4NIMA 1PQPA 4I1SA 2QR1B 1IBSA 2B7LA 3BIJA 3Q10A 4M9XA 1CP3A 1DIPA 1AQNA 3NKVA 4J29A 4RPLA 4Y6LA 3WWOA 4IH4A 1D3AA 5CX1B 2WJHA 1C0KA 3ZNQA 1AZWA 3O4RA 1Q7YQ 1URQB 5JAMA 5FUQA 2NO7A 2PKQP 3B36A 3DBIA 2XUKA 1F8GA 4OQLA 4BO8A 2A5LA 3F5DA 4XTRA 2CCGA 1WUTA 5DNYB 3BAFA 3P2OA 4N76A 3RSLA 1YE8A 1R8EA 3R44A 2P5SA 3VR1A 4A6EA 4BJHB 3SEQA 1CUAA 5CA1B 1I10A 5H81A 4UARA 3SHQA 3BFXA 1EINA 1H42A 4AJPA 3GVXA 1ZH4A 3DHVA 5EIBD 1DQRA 3MWGA 1NN0A 1H0TA 4JP8A 3EDYA 2PRKA 2QR3A 4OBXA 1S02A 4Y0AA 1V71A 2NAPA 4LE1A 1JWBB 1A7AA 1FFHA 4RA9A 3EPHA 1TTPB 1SFCC 1T5SA 2VSXA 2JCVA 2HSEA 4HH2A 4FLMA 1M8KA 2JLCA 2YNYA 1USUA 4JI4B 3LYHA 2AS0A 4QFBA 4RLSA 1GZ6A 5LOVA 2Q2WA 3CCU1 4GI1A 1U3TA 1T3GA 2Q28A 3GTGI 3DBHA 3HP7A 2E2JI 5IEJA 2R8YA 2X15A 2FW6A 4B3SB 1E2LA 2HPZA 4JCCA 5DK4A 2FK7A 3CO5A 4RDIA 2XNCA 4DM7A 1MDFA 3O2QB 1ZN7A 1W5FA 3IJPA 2HCJB 3R0VA 5ANRB 1Z8NA 1XAIA 2OV1A 4FU0A 4POOA 5A0VA 4F5WA 2HJSA 2R62A 2XQKA 4NECA 5SZKB 1JIVA 4WCFB 1EFCA 2VDWA 4YJGB 1SG0A 4HNGA 3CC4Z 2V55B 1GDHA 2CF6A 2R6R1 4PQEA 1EFVB 1WY5A 5FPSA 2NVXI 2OGWA 3OQIA 4TLBA 1NLMA 4UMFA 1KFEB 5EQDA 5AW1B 5KAIH 3HLTA 2D1TA 4A8JB 3MIZA 3FWLA 3DGEC 3KOUA 4F6RA 1L7DA 2W83C 1EI9A 1CQPA 2GPWA 5CH3A 1RQRA 5CBNA 1L1FA 4BNLA 1R5OA 1HA3A 3LIIA 4EZBA 1HX7A 2GYVA 4C7RA 3TTXA 4QRHA 1YT5A 2H57A 2P6MA 4ZOQI 1NASA 2D1SA 4D44A 2HT6A 4B2LA 5C4JI 3FB4A 1E79D 4QO8A 1C9DB 3P4UA 1X38A 3AX6A 5I9TA 4BMCA 2R3SA 4L0QA 3G85A 1WZ2A 1ZOPA 1T3ZA 1JEOA 1O4VA 1KL7A 5BR4A 3MRSA 5CHXA 4LY9A 5KMGA 5SZHB 2XVYA 1XTJA 3MELA 1JB1A 4B6JA 2X2OA 2IE8A 1HG0A 1GQSA 1UJMA 3NC1C 2IODA 4HLNA 1ZLYA 3N8GA 3ZV7A 4G0OA 3V2QA 1FVHA 3OWHA 1Y82A 4H7FA 3MJRA 3O4HA 4FHEA 4MS3A 2Q1WA 3NC4A 4QWWA 4DJDC 1R15A 5B66E 3ICVA 3NHJA 2YTZA 3PL1A 5HM6A 1Z3CA 3OFSA 1YGYA 4MGZR 3BGWA 1IDN1 3C5HA 5BSRA 1XDSA 3TQFA 1X1TA 4UCXA 1Z6AA 1NQUA 1SKQA 4GOMD 2CLCX 2R5BA 3MA0A 4RKWA 4KIWA 4FQ5A 4HDCA 4N5MA 1TWCI 3EFEA 3Q0IA 1TC1A 1A98A 3W8NA 3I52A 3FFXA 3LP8A 4UBNA 2IQIA 5I9LA 4IX1A 4RBNA 3NZEA 3WXMA 3LLMA 1RXYA 3DV0A 1RLTA 5B57C 1JQ5A 2V4HA 1NNLA 4ITRC 3H0CA 3IUMA 2VUMI 4IVNA 3EK2A 4MPRA 4G1EB 1P62B 3FHOA 5F2KA 2RGXA 1EX1A 3UJPA 2GAEA 3NHUA 5CEJA 3AJDA 5B7PA 2AMVA 2NOAA 3OE7A 3EMKA 1OFUA 3NWJA 3I83A 2B2NA 3O7MA 4RTNA 5AIAA 2IW1A 4YJ3B 1V7CA 2DG2A 1W8IA 3CKKA 4D9MA 3CXRA 3SWYA 5FWDA 1L5NA 3L35A 3AF6A 3DTVA 2IPXA 1A69A 2IPOA 4CU5A 4KGVA 4X5OA 4DG8A 3WB1A 1P31A 4IWNA 1JY3O 3B8EB 4IQ4A 4F4JA 4AOKB 5CCHA 1EFPB 4Z2AA 3RK3B 2B21A 3L72D 2ZUTA 3KKQA 4M88A 5B3LA 2IY9A 3ZU5A 1Y89A 4DVJA 4E0BA 2FPXA 2VRNA 1QZTA 4M1SA 3VHXA 2V03A 5AVWA 3UIEA 4A0GA 4EMUA 1XFDA 3QXCA 1QG4A 4YCDA 3DBRB 2D0OB 1DKLA 4E2YA 1GZSA 3EXHA 4S1OA 4FHGA 3LX6A 5AK5A 3D6MA 4OYHA 1XEXB 2R2AA 2ZUEA 3NBXX 3RARA 2DWOA 2G71A 5E0KB 4DEXA 1NIJA 4Q4AA 1QU3A 4XX0A 4KWIA 2W6CX 3GTQA 3GJ5A 4I4LA 4AF6A 2MOKA 5DN9A 3JV7A 1CWUA 1TYAE 2IBZD 4QIWA 1TZBA 2BBWA 4IRMA 2O7NA 3DF7A 2IHJA 4JUCA 4C2UA 2QN8A 2XWPA 2IXDA 1IUNA 2OKCA 1NY6A 2JIZD 3GTLA 4JKYA 3WBBA 1LV8A 4KUGA 1Z2EA 5B7QA 2IYPA 2JFWA 1QDLB 3B70A 3DVAA 3L7MA 3MJ4A 2J3IA 3B5ND 2X40A 5K3EA 5DEOA 5KNBA 3B6MA 3DG9A 4Z4IA 4LJSA 1H5NA 2BEWB 1FNDA 2ZB4A 4BNUA 2N9BA 1RZ3A 2NSDA 2JAOA 2QMYA 1KQSO 2ZWVA 4CM7A 3AECC 4XWYA 3H2YA 3QY9A 4IKEA 1Q862 5DSTA 3RS4A 5F76A 4DDWA 5ERXA 4EDFA 3OCYA 3GNLA 4BLOA 1HYBA 5EERA 2GZAA 1G21A 3T1HB 2XA1A 2D74A 4FZVA 5AVXA 4OUDB 1OXZA 1W75A 3AMVA 2W71A 3NMUF 1PYOA 8MHTA 3HMQA 1FZBA 1AN9A 5H7XA 2IBZI 1YE5A 1O95D 3DQZA 1TF7A 2P2CA 2Q62A 4PC7A 4CCWA 2HODA 3SYNA 1LY1A 3WOHA 2C4VA 2J4CA 4N48A 5LZ7A 4PSAA 1HUQA 4U7DA 1OPRA 3ZNOA 3EN0A 5TMBA 1E9DA 4HY3A 3KTFA 4HH3C 4N3GA 1PT1A 1JAZA 2CDCA 2Y8EA 4EG4A 1OV4A 5HJ5A 5LB2A 3ERCA 4KWHA 1XXHE 3CO0S 4Z1MH 2ZBPA 3AR2A 2Z5HA 4TN1A 4REQA 2P8JA 3LPLA 3T7SA 2B63A 3I07A 1AKUA 2HU2A 3HXMA 4EHDA 1L9XA 4X1KB 1Z45A 3CNLA 3EDRA 2I8DA 4A4DA 5APTA 3LCRA 1V11A 3PITA 2Q6LA 4V0SA 4RPJA 1IXZA 3WKDA 2PL3A 5FT9A 4HN2A 2D8AA 1O08A 3Q3EA 2GCOB 4XFDA 2PUGA 3ELUA 4QDTA 3I6BA 4P84A 4UE3S 3R3JA 3VR3D 2R1TA 3UJ8A 3K6SB 4DOMA 3N7TA 1HBWA 1AKQA 2XWBF 5CH8A 4DT0A 2BFCA 2H9AA 2PK7A 4K35A 1L5KA 4CQLA 3GTOA 2BH0A 5D1OA 2A9FA 1MABA 3K1AB 3IAHA 5EIOA 2ZTMA 2FP4A 1M1NB 1RM5A 2FG7C 3PHGA 1O5TA 5CFPA 1L8OA 4HDRB 3FNHA 4Q7KA 2QEQA 4EKIA 1W25A 1UMBB 3BL8A 2Z0MA 4BO0A 4KZPA 4DB2A 2QY9A 4A93I 3M89A 1M72A 1T4CA 3ZWNA 2EJCA 1WWKA 4UM9B 1HQYE 1MZVA 1A4XA 2WU8A 4JC0A 4DY4A 2YJNA 1J2RA 4AJHA 3IXQA 1QHFA 1JFTA 3FHTA 1U8CB 2PYDA 4PZYA 1NONA 4M6WB 2DBYA 1KDTA 2RSLA 3PF9A 3IR7A 4EFLA 3AVUA 4EPWA 1G9SA 3FWZA 5FX2A 2PKRA 5I7RA 3AGPA 2JJMA 4QOGA 5CIYA 5EP2A 1E7SA 1ZD9A 4OG2A 3T5TA 2EATA 1PVOA 2W03A 1N78A 3DDWA 4GT1A 1MKMA 5KQSA 3LX8A 5HX7A 5HF9A 5CFRA 4CNQA 4EWLA 1LTBC 1ENZA 1FLDA 5JZOA 2R8RA 5IFLA 5THKA 1XIVA 1N6NA 5ALQA 2LEXA 5JQWA 2PUCA 1XMSA 4KRGA 3C7AA 4DZRA 3IDAA 4R2HA 3MWDB 3LFHA 2I7DA 2GB4A 1PHRA 1VXRA 3TOSA 5C5CA 3S5JA 5A71A 1OASA 2VO1A 4WBNF 1CE8A 3KR2A 2EQBA 4MQUA 1ESEA 3TZHA 1E3WA 5HS6A 4FCTA 3B6JA 1OC4A 3TLMA 4N65A 3L1JA 1NQ5A 4ECEA 5KOIA 4GPTA 1KYOE 3LY8A 5AJVB 5BN5B 1N1EA 1YDFA 4W5JA 3V33A 2VOEA 3ZDYB 2XUAA 3HUSB 2O19A 1W35A 4KPUB 3E9RA 3NIGB 2C9OA 3UFXB 1XZHA 3RYIA 3CNBA 4N12A 2WD7A 1I94B 4ZU6X 4RTSA 1G8AA 5REQB 1O9GA 3F89A 4NMMA 3VV3A 2F1JA 3K9BA 1SZDA 3TI9A 2VPQA 1VKJA 3H1HJ 3ABVC 1MEEA 4B4DA 3AL2A 4URFA 1BXGA 4RK7A 3OQNA 3G5TA 1R12A 3HUUA 3OF3A 2XVXA 3H32A 4EG5A 1NR1A 2Q5QA 2PRYA 1EDEA 4EECA 1VQ51 1W93A 2OM6A 4ZT6A 1C8BA 2AOWA 4MYHA 3T9FA 3LSTA 1N2IA 4QYIB 3BCCJ 3VPAA 2FG6C 2A0YA 5LB4A 1XCBA 1TPZA 1KI7A 4FGWA 2XE4A 1E2BA 4YRZA 4NPCA 3SVTA 1C7QA 3K0CA 5I3CA 3ER9A 3OEHD 3ZVLA 4IXTA 3J81b 2FW1A 1I3NA 2EBFX 2QI9C 2WSLA 3GK3A 2HMWA 5FWXA 1ZMEC 3NIFB 1CUUA 1ND5A 4B4KA 5JNVA 1JVBA 2PGXA 1NBME 2OHIA 4EUSA 1ECPA 4D7AA 2Q27A 5T7BA 1TMGE 3CCL1 2NZJA 2D62A 1GCGA 3MWEA 1QYRA 2A35A 5DGHA 3I2HA 2A8YA 1GQFA 1D0SA 1ZIPA 2VT3A 1DRWA 4MQFB 4LCEA 3CME1 4WZBA 1ZESA 4LJKA 2PWBA 3NEYA 2OAQ1 4BNFA 1JHVA 5CGZA 5HJ7A 4F84A 4B86A 1RVV1 3DQPA 3L6RA 1MHPA 2PZKA 4YIHA 5BNTA 3LPDA 4E21A 4JXJA 1H0HA 4K03A 3RVQA 4DA0A 3Q3VA 1ZCZA 5T8KC 3SI7A 3WJ2A 1RD4A 4NCAA 1Q3HA 1GZ4A 4DSNA 2B89A 3MTEA 1M3SA 1N8SA 4Q3LA 2GEVA 2XDWA 3EPKA 1CC1S 2N46A 4MRVA 3NANA 4KVAA 1FPMA 4WY4A 1D6NA 1WABA 1U0OC 1P0MA 3DEYX 3VX3A 3H9EO 1DD4A 1NO4A 3TIWA 3QQ8A 5DOZA 5H2FE 3RVDA 1EG7A 3H97A 3TQOA 2J0SA 2Y2UA 2PX0A 3KVOA 2WVRA 4BUJA 1E77A 1XZDA 3UMMA 1RFLA 4EW3A 3GGPA 3MIWA 3FUTA 3WHKA 4KKXB 2B94A 2BHRA 2XAUA 5CLFA 1F4PA 1Y9ZA 1YI21 1AC5A 5FL7D 1RWOA 5APWA 4F45A 2DFKB 1MRNA 3QUBA 1W5SA 4YAEA 1AS3A 1ZVQA 4IIVA 4D8XA 1XMPA 1F4LA 2RHCA 2I5PO 5ALIA 621PA 1R4NB 4HX2A 4XPZA 5CK4A 3M0AA 4P2GA 2HBZA 1FNCA 1HFEL 4YN3A 4A2QA 1KAMA 3CNQS 5P21A 1I3MA 2B6NA 3FPEA 4I19A 4K6FA 3HU3A 5A3SA 4KQCA 3AUAA 2VP6A 1SIOA 2VYND 3QQ5A 4G1BA 2FQYA 4KK4A 1U1IA 2GYWA 1I2DA 2W2KB 3PUWA 4NEQA 5DZSA 3IURA 4LQCA 2ZIVB 3AF4A 3REGA 2O3JA 2QOEA 3LF1A 1YBMA 3IB3A 2ZVOB 1RU3A 4CMBA 4PZ0A 2OYIB 4EQ6B 4N3AA 2PKYX 3JATB 2PKWA 2LE0A 3VX4A 2RGCA 3WK5A 2QSZA 5K99A 4JJZA 2Z98A 3UK1A 1VRCA 2DJ5A 1JB0J 4MV1A 3A9CA 2FDXA 4ARUA 3FE2A 1YUMA 2WJVA 1JL3A 4GI3A 4TWBA 2LGJA 2PYIA 1ONNA 3UHOA 2HLPA 4MWZA 2F8LA 2IP1A 3F5SA 3QYJA 4O3FA 3RBZA 3RIEA 2A84A 2P4EA 2F4NA 4IXNA 4OF4A 5CDFE 1BGYJ 4CIYA 4ZD6A 2NUAB 1P29A 3SMQA 4H7PA 3OU2A 2J4FA 4AJEA 3JQGA 1IONA 1MAAA 3I12A 3WNVA 2C7QA 5CM2M 3RSHA 1DT3A 3WYGA 3CG0A 2C9YA 2OBYA 1J5EB 1CS4C 2PTGA 1EVLA 3HKZA 4X85A 3FVRA 5BPFA 1OXVA 5AUOB 1QG0A 3L71E 1MH1A 1QH1A 4ZQCB 4E94A 5LZ8A 4IHJB 3IMCA 1FVXA 1P2UA 3U5ZB 4UOQA 1JIXA 1TT5B 3BGVA 1Q1AA 4F0JA 1U11A 4PAGA 2ZRPA 1MAHA 2AN1A 1AQLA 1B73A 5C5EA 4GKKB 3G4S1 3PEUA 1JA0A 2ZRFA 4K9NA 1G16A 4KQIA 4BVGA 5DHAA 3ZHBA 5JIBA 1R3DA 4N6JA 1KRWA 3QVGB 1LW7A 1YRLA 4JJ4A 3PXXA 4QEZA 3NGXA 2YZ7A 1JS1X 4CV0A 5AFSA 3WZ2A 2QQ0A 3FNQA 4INJA 1PL7A 1RDFA 2O0LA 3OU7A 4PZDA 2OY0A 5I7FA 1CUFA 3CC8A 3RKRA 2PI8A 2JJ1D 1K2VN 3QLEA 3GIDA 4ZGBA 4I08A 3V6MA 4KXFB 1QPZA 1I0IA 4X41A 3ML1A 3HE4B 2CUZA 3H1HE 2WIFA 4U6QA 1A0OA 1K27A 3FZYA 3PCRB 4EL0A 5BQFA 2FZGA 2IV7A 2H1FA 2FSUA 4IXDA 4ARBA 1G2CB 2G3YA 2FDCA 3ZUPA 2QIPA 1WSBA 2IDJA 3TSZA 4HBZA 2C95A 4EFMA 2QVXX 4AZVA 2ZJFA 2ZBEA 5AVRB 1G8GA 3R3VA 3JW8A 1OX5A 1KIFA 3GUVA 1BGWA 4XYEA 3IC5A 2QENA 2PUBA 3LGAA 3OUZA 5F2OA 3TRHA 2Z83A 4M1OA 4IH9A 2WEKA 1CZHA 1SVFA 5LWQA 3BFKA 4YI5A 3R4CA 2F00A 3FOCA 4PAWA 5KSYA 3TH5A 2ZG6A 4NB8A 1XUOA 4HSEA 4KAJA 1EVQA 4G6ZA 4ARZB 2QTFA 2BCEA 5D7BA 4RLQA 1IEQA 3A6ZA 4WE3A 4DQKA 3CCUP 4IMRA 5AVQB 1FJ2A 4JAVC 3HD7A 1XO1A 4IIDA 1JU3A 1B8VA 1Q0UA 3TJZA 4MD8A 5ALWA 4YAFA 3GBVA 4IJKA 3QKTA 1SOVA 3TDKA 1GZ7A 2GBPA 3JCUE 2FJUA 2ZT5A 3C0KA 4ZT5A 5JISA 1P1JA 2H00A 3ENKA 4RTMA 1Y9AA 2W6JA 5LBTA 1GNQA 3GG2A 4EA7A 3HGQA 3VR2D 2NIPA 2GOYA 2OCAA 2Y9YA 1H6AA 2ZCVA 2ZI4A 1FS6A 5B1SA 3FOFC 4U7FA 2V6BA 1YDWA 5IT9f 4RACA 2DETA 4J6FA 3L8FA 2ZSHA 3P0RA 4DMUB 1T6NA 3ZEAA 3I1YA 2OYHC 3NPMA 3ILVA 1U94A 5DHFA 1UJ4A 2Q4OA 2RB4A 4NV3A 3MUNA 1X1AA 1EM6A 4RD1A 4L6CA 3DM5A 1QR2A 3GHGA 4H27A 1V1RA 1MW9X 4A0RA 3T52A 3L7LA 3WNQA 3BF8A 3HFRA 5HKOA 5HKKD 1J0BA 3BQ9A 1BCRB 4EHJA 4MWSA 3NI2A 1X7XB 1FYDA 4FC7A 3SXUA 1EB8A 5DN6D 3THRA 3M4XA 1XCMA 2CHUA 1QQAA 2JIMA 2O1JA 1PJCA 1VECA 1JG6A 2OHOA 5T5ID 1VGQA 3H0EA 4ZRDA 2NU6A 5A0FA 2W42A 1ZKMA 4GXTA 4MMZB 4R5HA 4GIFA 5KLVG 1XTBA 1JEQB 3DZHA 4F4FA 2HK9A 1N2JA 3OE4A 4AF7A 2ZS9A 1YL7A 4GLBA 2GLXA 2GN2A 3JSVC 1FRQA 1XZBA 1K3FA 2G0TA 2E74C 3D0RA 1P2GA 4CRZA 4RPGA 3CXHH 1D04A 4D82A 1CZ4A 3CPWY 1JY3N 3VO1A 3IHKA 1P9OA 2IDBA 4F21A 3LQRA 1BDBA 3PJEA 3KR0A 5TVKA 5FLMI 3N3BC 4J0CA 4A23A 2C5FA 4Q48A 3FJ1A 3JQFA 5CAEB 2PSEA 3HYRA 1OI3A 2PWZA 1VC2A 4D3XA 2YFQA 5JARA 1YYCA 1ACLA 1J22A 5AM5A 5FI3A 2JFZA 3PEWA 1PJ8A 1ZCAA 5EGSA 5HGJA 2ZT8A 1AHIA 5K0JA 5AKEA 3VU8A 2I3GA 2HV8A 2LWIA 2R7ZI 1RYDA 3FW1A 4XVCA 4YAKA 3AKZA 4BLUA 1RI4A 3E7WA 1R6XA 2ATEA 1FJPA 4PC2A 1NJ6A 4UULA 3KZKA 4LDZA 4JMPA 2OHXA 1ZM2A 1Z0FA 4DUZB 4UPEA 3SFDC 1JBEA 4I7EA 1H9AA 2H08A 3OC0A 4EDHA 1NOHA 4DCMA 1JV2B 4JC8A 3LXXA 4DV3B 4LRXA 1ELOA 2GBLA 3UC9A 3M83A 2EIHA 5LZ2A 3H1PA 2XCUA 1GTZA 4P3PA 1Z17A 2HX1A 1ENPA 3GZTB 4HPWA 4F6LA 4ZVUA 1LTJA 2KE5A 4NXMB 3D7SA 2OB1A 2QVZX 4DA9A 3QLJA 2C42A 1BGYE 2RK6A 2A1UA 2C9ZA 2R48A 2X22A 1U3CA 1JDVA 4M0CA 1BSVA 5HW0A 3QXHA 1BXZA 3RU3A 4R8KA 3ORRA 1FSPA 3GFGA 4GP6A 3W2HA 1IN1A 1SIWA 3NEAA 3L06A 1C8LA 5DYIA 4J75A 1RLJA 4R0MA 3EYWA 2IH2A 1UT8A 5DISB 3ELWA 3EA4A 1V37A 5IWCA 4LXYA 2ZUFA 6AT1A 4PJ0H 2ZSAA 4X7RA 4HNRA 1U57A 3IAEA 1RJEA 3BD8A 1SURA 2Q1KA 1OLXA 2QVBA 2WIBA 1FSFA 2RHRA 3PSHA 4MRNA 1WL8A 4I8XA 3GKQA 3PA6A 1VL0A 4FBMA 4NOLA 1Q0LA 1HFWA 3HQ4O 3AYXB 1VL5A 5K8TA 5CLQA 2XYVA 3LCJA 4F46A 1TYCA 4XYLA 3RF6A 5H4GA 1CB0A 2ZT6A 4NCJA 4YTEA 2GPSA 3AU8A 1FSGA 4WNAB 4CG1A 2OXCA 3ZZ0A 1MIHA 3E18A 1I2CA 1NT2A 4JHXA 2BBSA 2L19A 3E1RA 5EZSA 1LBHA 2AOTA 4IRUB 2KQUA 3WLLA 4J0JA 2V96A 3KWJA 1M8JA 3N58A 5U4XA 4CUZA 3FSJX 1V39A 3HSKA 2GPJA 4TROA 4AECA 4J43A 1U0LA 1ESNA 3GGGA 2OXFA 3ZLVA 4AC9A 1UXIA 3MD9A 4D4MA 3ETNA 5G4KB 5HCUA 1IOZA 1SBNE 4XIJA 3EX7C 4HDSB 3V4QA 3BSYA 3I9V6 1K6EA 4BNZA 2ZUSA 4FNOA 2H06A 3KXDA 1TWGI 1J6UA 5EHQA 4BFWA 2EKQA 5THQA 5E6SA 4BRUA 4QHYA 3SGLA 1VQNZ 5DKFA 2BMEA 2IOFK 4PCUA 3COVA 2OBMA 1SC6A 3NTUA 3H9BA 5H5JA 1C2TA 1OILA 2KNCB 3EDCA 4UDOA 5LBUA 1VDZA 5HK8A 3TI7A 3MWLA 3R3ZA 5JCZA 1N2GA 2XNKA 3LL7A 4Q7EA 3AUYA 4X8LA 3WG9A 5K0ZA 4ZU1X 3J81A 1VZ3A 3GUHA 4TMXA 2BMWA 3MGGA 1Z06A 1G8HA 1Q14A 4Q7MB 5JJCA 5EHIA 1EE1A 4X8HA 3LVBA 3AB8A 3V46A 3PWTA 2FCRA 1O94D 4ZEMA 2BFNA 2ZR7A 2LDBA 1OVMA 2EGTA 3PDHA 4U9UA 3NVAA 1SP4A 4RGBA 1AHPA 2O2IA 3A32A 1TC2A 1UBKS 2C8KA 1L5HB 1O58A 1FTSA 1HJBA 4N5IX 1UDXA 4UMEA 1TPYA 4ESHA 1K8A1 1PDOA 2R0QC 1U8FO 1X39A 1CJBA 4PLYA 1UFVA 3M6UA 1AOXA 2V7WA 5BR1A 1ZFNA 5A06A 3R5KA 4U8GA 2ZRJA 1OTHA 5GJCA 3OTIA 4OBEA 4TYWA 1YS6A 2O8NA 3TTYA 4GL4A 2VCHA 3BZWA 4Q7LA 4NOMA 5A9RA 2H1RA 5IXSA 1VQP1 3ZDRA 2A0UA 1L1OC 2X9QA 2Q3LA 3LDFA 7ADHA 1RO0A 4PE5B 1V16A 3L4FA 1MP0A 5FI5A 2O8BA 4UEKA 2ORIA 3DHNA 1L5SA 3E9MA 4DNPA 4RHYA 1U2DC 3CINA 3OZBA 4LRWA 2CXPA 2FPGB 4EJ2A 3O8OA 3CT4A 3GJ4A 1H6DA 4BMVA 4YRBA 2GKGA 2UUPA 5T5QA 4ENSA 4IMIB 1U0NA 4XGQA 1X3ZA 4KH1A 1GL7A 3WLTA 2QW0X 3HCFA 4OQQA 2W6BA 2A1IA 1JIUA 3HDGA 1I4OA 5BW8A 3MEQA 2WSCH 1MVOA 4V03A 1PUXA 4HZIA 2ZSFA 4YDRA 4TXJA 4OHPA 4KLNA 1RRFA 2RH5A 4KIFA 5CXSA 3K5HA 1MPTA 4O4IF 1SUIA 1CJTC 5KCZA 3B82A 3PWZA 3E22B 2NUPB 3DZIA 2WHPB 4P35A 4YDHB 5JRJA 5GOZA 2ZLBA 4U9IS 3M2PA 3DONA 1WKCA 3G2MA 2YOGA 3FNIA 2UZ1B 3JD3A 1C30B 1J33A 4QVGA 1U81A 3O90A 5C8XA 1N6LA 2O14A 1OOEA 3EEDA 2RT9A 2RN0A 4Q9KA 2R7NA 4N8DA 1MPXA 4Y2HA 1FE8A 4P5EA 1U0JA 3EUFA 3LPNA 3VNBA 3UHJA 5JZMA 3GFRA 5JAHA 4CXMA 2YWGA 5E8JA 1UKAA 2BGWA 4EY6A 1CBUA 1SQ5A 3THSA 5ER9A 1SBQA 1NBOA 3G0DA 3L1IA 2NPFA 3TIXB 4NK5A 2B36A 1W1WA 5KOHA 1CG6A 2W6AA 3CPJB 1ZRTE 2VHJA 1N9ZA 4J0QA 2IEGA 4AKIA 3N5KA 3NMDA 5JOQA 2P9HA 1JQDA 2VQ3A 1AUXA 4QGGA 4RTOA 5LU8A 2QI9F 1R8SA 1TIBA 4QM6A 4KQWA 1D6JA 4OI4A 2R9VA 2B87A 4LZNA 2Q9BA 3K72B 3UJ9A 3TMYA 3L8DA 2PGLA 5GLXA 2XNHA 1K5DA 1WXHA 5F3DA 3A7EA 5ALEA 3C8UA 4P4SA 4NPAA 1IUKA 3DMYA 4TVBA 4HB0A 3CWZA 1NVTA 1SZCA 2WFLA 1FL9A 2ZDGA 4R3UC 3AESA 4B31A 3R9WA 3AR7A 2NO4A 2BCCG 2I1KA 3A11A 5DM4A 4OQDA 2LZ0A 3E9ZA 2AN4A 3RTAA 2JASA 1EFAA 3RIGA 3GA0A 5JROA 3QPAA 2ONYA 4M83A 4AFNA 2VUIB 1ND6A 3TCKA 2ZP1A 2O57A 3FYSA 4K1XA 3MT7A 1U2ZA 1S3SA 1F0KA 1NTRA 3BWMA 3KUUA 3QIVA 1BFDA 3PGA1 3PNYA 1VQ5P 1EGAA 4DSOA 3B13B 1M74A 3BFPA 3H1BA 1RS0A 1OA1A 3L7AA 4JT8A 1J25A 3H1LG 4AXBA 4NKRA 3KWLA 2G09A 2P11A 4YAOA 2PA0A 4FZRA 4TT3A 5ALJA 5TJHA 1J9EA 1ZN5A 4X93A 1KK3A 3AF0A 3K20A 2VT6A 3ZDZB 4XYGA 4B9EA 1H2ZA 3RK3D 16PKA 2FQWA 5T3UA 3H3XA 2B3DA 4NCBA 4W5NA 4PX5A 5DB4A 2CKDA 2QY6A 1VE5A 2ZBDA 1NAYA 4QARA 4EBFA 1RE4C 1XRLA 4ZCLA 1KOGA 3P7KA 2XYRA 3LL4A 3I53A 2B30A 1RYYA 3MBKA 2BCCD 3OJFA 5HHTA 3E6AA 1XVIA 3CCLP 1VC3B 2C5HA 1C1DA 1L9KA 3WGHA 5CVUA 2JAHA 3ZJ5A 4TKLA 4WGGA 4WUTA 3AETB 5A5GA 4FDLA 4K6OA 3KEFA 3CMEP 4DRYA 3NO4A 3CB4A 2XNSA 4ZRMA 5C7OO 1GT91 2H48A 2BH2A 2X6TA 4AAYA 3G6KA 1Z0JA 3ZTTA 1KJYA 3JRXA 3H1LD 4C4OA 2LR0A 5KEIA 3IP8A 1PVDA 1GTJ1 1YDGA 2A9RA 4GVPA 3E58A 4P58A 3RVJA 1E1DA 4X95A 3RYTC 2F59A 4IJWA 2OORC 5TS2A 5IHXA 2QXYA 2YYZA 1DU4A 4MXDA 1VIAA 3W5DA 3V8EA 2VN8A 5EJEA 1W36C 2GZDA 3B52X 5EXSA 2HU9A 1K73Q 4AZSA 1KEEB 2E4YA 4C0XA 2PUEA 2IX7C 2DU8A 2JGAA 4ZAWA 4BVKA 3QVXA 1UFRA 2DFNA 4Y1RA 3ER8A 4WN3A 2AIRA 2P10A 1EQUA 2OCXA 1X80A 5FTLA 1DBQA 5ALZA 2QM7A 3C3EA 3UPUA 2EX1A 1LB1B 4HZUA 1M6WA 3I58A 4WBNA 2KPIA 1O6GA 4Y9SA 2FKWB 4E30A 3BC1A 3SIXA 1YI2P 3ZH2A 5IJWA 3LQ2A 4LOAA 5AOCA 5INTA 4HFNA 2J3DA 2AR0A 5JCOA 2C84A 4IIGA 1PBNA 4LX8A 4F4HA 4OSOA 2ZT9C 1QL2A 1RF1A 2GNOA 3VPXA 2GNAA 4N6NA 2CBZA 2GBGA 5E4JA 5DGCA 4XR4A 3K9WA 4EUEA 2Q49A 1KE2A 3TAHA 1B15A 1WW8A 2ACKA 1A02F 4OH1A 1AJEA 1NMZA 3ZY6A 3LVQE 2YHAA 1RKQA 1NBAA 2ODEA 5CLJA 2AJBA 3KRTA 3EODA 4HEQA 4P22A 3WADA 3V2UA 2YZKA 2WJZB 3C74A 3QU9A 2YYYA 1L4LA 4V0MA 2IEZA 5AW9B 1E2QA 3PFWO 1YZTA 4CKWB 3ZNPA 2BEZF 1Q2XA 5HF5A 4A3CI 2HPAA 5JI3E 3K8ZA 4P81A 2WV7A 1I14A 1Y4SA 2Y67A 3SM9A 3BA6A 1KC81 1NAFA 3VHQA 3LGXA 4FBGA 1JLLB 4HQ6A 3D64A 1C4OA 1RTKA 2NVYA 2W2VA 5AW7A 4HTFA 4WLFA 1IQ0A 1KQFA 4KAXA 2G2KA 3BBLA 3VN0A 1THTA 3VOBA 2B7BA 1B8PA 4Q37A 3GXBA 2H7VA 5IN4A 3OAAD 2ASVA 3HO8A 1PBTA 3SF8A 4C2TA 1KI6A 1N6HA 3C3YA 5AKKA 4J1NA 1S0UA 1FZFA 1YQEA 4UM9D 2IT1A 1VLHA 5COAA 1OW3B 2JVIA 3RRZA 4LPKA 1Y4AE 3DAHA 5LQDA 3B38A 4E32A 3STTA 1KVSA 5AVWB 1UXKA 4M38A 3H1IG 3KQOA 3UUEA 4QUHA 4WLEA 3EWNA 4I66A 3QW4B 1RHJA 2O6HA 3BMNA 3DWGA 3C9IA 3TAXA 4XQEA 1G55A 1R8YA 3DCJA 3UGJA 2FN3A 3NHBA 1OLOA 3A37A 4X45A 1UR5A 3JC22 5ALRA 3I23A 2VHTA 1P74A 3TB6A 1QLJA 2WD9A 3ENNA 4JBXA 1Y6RA 4UASA 4YCCA 2G9NA 4N41A 2HJVA 1JIJA 2YJ5A 4K2AA 2X5JO 3FOAA 1HH4A 3G4SP 2WJ6A 3F90A 3O2NA 4MGYR 3L72G 1MRSA 3HVUA 4XX2A 1Z62A 1P0CA 1P2SA 3RFFA 2GUVA 4M8LA 4PYJA 3ET4A 1R0RE 2CE2X 2OO5A 2QN9A 4E08A 1I7LA 3QE4A 3RVRA 3THXA 2R6GA 3HZOA 3H1ID 3MBOA 1QRTA 2Y66A 1GKYA 1P77A 1GFSA 1DD3A 5DYYA 4IILA 1SPBS 4YXDC 5AI8A 2W2MA 5NULA 1SHZA 1EVYA 1G21B 4MH4A 2WTXA 1E6UA 3O92A 1YMUA 3SG0A 2AQKA 3TOZA 2IBZG 1A1VA 1W9HA 3ZU3A 2XWQA 2C83A 5CT6A 5GV7A 4ZKPA 3ANTA 3OZTA 4EHLA 1VLZA 4NONA 5FUMA 3A14A 4GOXA 3CHYA 1NAIA 4CMIA 3F49S 1H4SA 2VDNB 3COWA 3O38A 1LJ8A 5DV9A 1OXUA 1NY5A 5JZSA 3S70A 4U2BA 4YRLA 4FNGA 3E1KA 4GKGA 2H4WA 5GZ1A 4FMCB 1EIZA 2X1HA 2EW1A 1N5KA 3DLIA 4CMAA 2R5FA 3EUAA 1X7ZA 3CR8A 1XNGA 3A3NA 3OFJA 1A88A 4KXVA 4REQB 4NC9A 3NUQA 2HLDD 4H60A 1OD6A 3AEXA 3HJNA 2AOUA 3O91A 1OXBB 4ER5A 4CLHA 1E4VA 4FSDA 3AE8C 2QN7A 2HU5A 1GLGA 2JGFA 4MVJE 4RV5A 1UEIA 5FL3A 3PXCX 4I1LA 3QA3E 2L5GB 4HMPA 4J76A 1YNSA 4C29A 3BDVA 2C5LA 2R1TB 5HP4A 5AI5A 4PC1A 2ZYRA 5FLYA 3EF1A 3IMGA 4D3FA 2ESRA 4BTVA 1W96A 4UBKA 3I55Z 2YC4C 4FKZA 4MWOA 1UK8A 3LBNA 4XM2A 2BLLA 3D0QA 5CNJA 2HW8A 2GO1A 2XECA 1MABB 4NPHA 2XDQA 4G37A 2R85A 3D3EA 4CCSA 2HD4A 2G1UA 5EIWA 5EI5A 3A6FA 3LUSA 2QUKA 3ONEA 1JG7A 4C4XA 1GL2B 4MLPA 4WIAA 4II2A 1M5TA 3UG6A 1M0TA 4H6WA 2A6HD 4BPBA 3O8NA 1NJFA 4LYFA 1GZVA 3V32A 2ZANA 1P73A 2IZOA 5CDSA 1JWHC 3FPHA 2OILA 4K9DA 1TJ3A 4YUXA 4S2EA 1GQQA 1CU1A 3O0DA 3Q3DA 1VPWA 1NPYA 2BC9A 4HGQA 3TYYA 1K83I 2ZS7A 2B9VA 5A5DA 1V3TA 2GXUA 3BTVA 1EFLA 1LDEA 3NHFA 1WMAA 1H4TA 2WAAA 2DMRA 4ZWNA 4CEIA 4AMVA 3PXGA 3ABQB 4BECA 2HIGA 2GA9A 5F98A 2NLOA 5K0SA 3HDVA 3QLTA 3T5DA 1NLYA 1YNOA 3FTQA 3MJDA 1J1DB 3C1TA 4D26A 5C18A 5G40A 3KU1A 3IAXA 1SFCA 2NPSC 1OREA 3GFPA 1VLMA 1E2GA 5JPDA 3U5TA 2DBVO 3HFSA 4OJTA 3HLKA 4A0HA 4PHCA 5HFJA 3RQSA 2B5WA 3NW9A 3CW9A 4MHTA 4PSDA 2BYTA 2XWJI 1OFTA 1QF8A 4CIAA 3WSVA 1XMXA 3GQBA 1Q2NA 3L6DA 3VR0A 5HTKA 5IVDA 7MDHA 2PP6A 3C3KA 1N0VC 1VMIA 1GFZA 1VMAA 2F55A 3I9FA 1CE8B 1D8AA 3W4IA 3O9VA 3EC2A 4FK8A 5TARA 1EQAA 3I73A 1E3WB 2J6CA 5K05A 1X2BA 3A04A 4BCCA 3BAZA 1PR0A 5JNUA 2GVDC 4RULA 1GPAA 2F3RA 2J30A 4HH0A 4E12A 3CA8A 5IZCC 1SBTA 3FJOA 4I4CA 1NL3A 2Q2NA 2QYSA 1FFYA 1H4VB 3KS9A 5F21A 2AEJA 1FRZA 3HWWA 2RHDA 1QIKA 2DKFA 3CR7A 3IKLA 1SM4A 1B76A 1J0DA 3IO5A 4UNIA 1VP9A 3V4FA 2CLMB 4KE9A 5CW1A 3RYIB 2OECA 1IN4A 4E2FA 3PWSA 3SE0A 1G2OA 3L4SO 3DPUA 1PJLA 4RLHA 5AM1A 3T1YB 1SXHA 2W83A 2YQZA 3HACA 1NNI1 3RC9A 3IIJA 5ALHA 3BGIA 2WLSA 5EPEA 1SHTX 3H32B 4BE9A 3H1KJ 3BSWA 4FG2A 1TGVA 3QUAA 1B4DA 2NVUA 5ESWA 5ALVA 1T3JA 1DAOA 1C50A 1F3LA 1ABFA 1R0WA 3DOUA 1LZLA 4EMSA 1DTWB 2PZFA 1SU7A 1XZLA 1P44A 1I5OA 1FP7A 4E4RA 3A4NA 3A6HA 5LFAA 2PMZA 1E6CA 4KJMA 3CRMA 2IZ0A 1SBIA 3JVDA 4TKZA 2Y4NA 2FV8A 5DW3A 4NICA 4ZAYA 3WMWA 1MB0A 3QVUA 3I64A 5P8WA 4FGUA 2XNDD 4OJKA 3L41A 4TYNA 1QGYA 5B55A 5AVOA 1VJTA 3CZ9A 5KLIC 1O8BA 4DR4B 4RMGA 4XZ3A 1DDOA 3SZLA 1SD1A 3L71J 3AERB 1FBMA 3QKRA 3FDZB 1XVVA 2QJYB 1P5FA 4QBFA 2PL1A 4FZ5A 1SBYA 1DO2A 3KDSE 3CBGA 2VH1A 3MP7B 5FYQA 2I22A 4XDGA 1T8WA 5CYOA 4OHZA 4FDTA 2ICAA 3QSYA 4HMQA 3QF4B 1ZWKA 1QYXA 1N34B 3WDLA 1JG4A 5AHXA 3UGKA 1NG9A 3W6UA 3CCE1 4D8WA 1H2EA 1ZGAA 4DYDA 1GOTA 2FWAA 2FUEA 3KZNA 4PS0A 2H2IA 4DR6B 4OH8B 1BROA 4M1MA 1IZYA 4BQSA 2C1ZA 2OKGA 1PJ3A 1VJRA 2EDAA 2GASA 2IKSA 4TXNA 4K9KA 1YQTA 3Q7EA 3KYCB 3CLTD 3ZCQA 4BJ1A 3DZCA 2N9UA 1XZEA 4DJ5X 1N7SD 3OD1A 3HKDB 3LBHA 4TMWA 3GELA 5KWVA 3CE6A 1K6MA 2POQX 2FMTA 4BO1A 2YNMD 2XITA 3PJRA 1FDRA 5FOXA 3JYQA 1NHGA 1JR4A 5CVTA 1LTIC 1C7EA 1N6KA 3I42A 3DBVO 4L15A 3U3DA 3SSMA 2J31A 4KXNA 5C8VA 1HSZA 2AJLI 1YJW1 3RVPA 2KI8A 2OB2A 4EYQA 1JHQA 2XA9A 2PNJA 2ZZMA 2WWVD 1H3FA 5B1HA 3AEQB 4MHSA 4U3JA 1PN3A 4CDMA 1EFRD 3CMA1 4KAFA 3LHIA 4NBWA 4YR9A 1KXJA 4OYYA 4O29A 3TZKA 3X1KA 3GCDA 4O2BF 1PR9A 3CUKA 1MGPA 4UVGA 3SQXA 1Z12A 4D57A 1FFWA 3G89A 4DLNA 2I1WA 1GYQA 3K70B 5JSFA 2R8OA 2WUFA 1DHRA 5CG2A 4LOJA 4IFMA 4EJSC 4ZYLA 4NOJA 2JA7A 2VXOA 1H0SA 4LXHA 1J2JA 4LDPA 2AHRA 2LTAA 2JAPA 5C2JB 1H88A 4QOEA 4C4RA 4X60A 3QKIA 3FJYA 2YVUA 1Y1PA 4YMIA 5A7HA 2YUJA 4D74A 1ZH8A 4MPPA 1T2VA 3FB1A 3I2IA 4OGQD 1PSDA 4J03A 1V5IA 1G60A 3L1VA 3R6GA 3CC71 3HM9A 1PK8A 3HDHA 1VQPP 1GNVA 4G0MA 1Y1VA 2FFBA 3BWYA 4OLJA 1C3XA 3HHPA 1H2AS 4XRGA 1J1UA 5CFZA 4AYBA 1VQM1 1ORTA 2E4WA 1WZIA 1S1CX 3EEIA 3S1QI 2Y4OA 1XPRA 5IP9I 1JWAB 5FRDA 1MQAA 2ZYWX 2P9QA 3EEYA 3JVUA 4QGFA 1ID8A 1KY3A 2POCA 3RROA 4BMZA 13PKA 5J43A 4KK3A 1K2WA 1BKYA 4OHRA 1Y7PA 3DCNA 1L2PA 1JM0A 2P2NA 1V48A 5F3WB 4KU4A 1F12A 2BISA 4QJ4A 2B4RO 4YRAA 4LQLA 4MUIA 4B7CA 4ENGA 1RJGA 5B7NA 4UB8H 1E5LA 1U0HC 3K15A 4PO1A 2WYWA 2ZYGA 1JUNA 2NU9B 2LCIA 4Q4DA 3ZE6A 2FPKA 3U1VA 4CR7A 2IUFA 4OAPA 1UPAA 3VAZA 3GVIA 1JHRA 2P69A 4K0RA 3RC7A 5A4MS 3BG1B 3FR7A 3HKCB 3PNPA 1M901 3KLMX 5LR6A 5KWSA 3BEDA 3U0BA 3KTAA 4IP0A 1YDMA 4Z6KA 4NBAA 2CNDA 2E5WA 4NRDA 2PRZA 3CLRD 4P7KA 4AN0A 3R74A 2ODNA 1SVOA 1JMYA 3HLYA 1O6FA 5D1HA 1W0CA 1K9MQ 3VZDA 4QOJA 2YWBA 5JNLA 3KG2A 2BGRA 2D8MA 2WUVA 3T7JA 3TSIA 3OFKA 4CKEA 3LVRE 1VFPA 4EVRA 5CNIA 1KMNA 4Q47A 3U9SA 2PXCA 3P5SA 2GCPA 5EAIA 4MRRA 1GW4A 3DEZA 2PO7A 1YB2A 1YZKA 1A50B 1I80A 2JEZA 1ZLXA 1NW7A 3HYTA 3IDQA 2QRGA 4Z4HA 4AWAA 5KHLB 2JLVA 2WOOA 2ZPAA 3LY7A 4G5YA 3WB9A 2Q5FA 1L7OA 4S1PA 3V1YA 5CMZA 2QG4A 3T9DA 2JR8A 3TNLA 1OX6A 3EISA 3W5UA 4A6DA 1G42A 1KOFA 4LYEA 4PZUA 1M2KA 3PGMA 3H1KE 2M9MA 4ID9A 1GUZA 3OZWA 4QAJA 4M60A 2ZXEB 1KYOD 3L8YA 4CDRA 4R84A 3GUYA 5GGXA 5FFMA 2FN8A 3A6DA 3AFGA 4F2DA 4NE9A 3MJFA 5ARDA 5KJ7A 2FFRA 3OUUA 4HNUA 4QD3A 3HMKA 2EWWA 4H4EA 1AKEA 3A0BH 4JU9A 1TZKA 2IYAA 2QRMA 4HVTA 4G01B 1PUJA 1QVAA 1SHUX 2B1QA 1SXJC 3PX2A 5E7QA 3WO0A 3DXYA 3DZFA 2WUWE 1RKVA 1U9YA 1IPHA 3H3FA 2Q6TA 1GAQA 1Y1LA 4KDEA 4DNQA 2B4YA 1GL6A 3N2KB 1DRVA 1JSXA 1LTHR 3TM4A 3P0EA 3HD7B 1NOJA 3DV2A 3UJ3X 4C08A 1UOPA 3PNVA 1XP5A 3L6CA 3R0ZA 4NG4A 2ZB8A 1KFBB 3WV4A 3IOEA 3DC7A 2FSFA 3CCUZ 1DJPA 3GJYA 4AB1A 2ZXUA 5IVIA 3LPCA 5SYAA 3WIOA 4NJEB 1MB9A 2E4XA 4KV9A 3RTEA 2XKJE 1KYOI 5HE9A 3OIGA 3H5RA 2HF1A 1YJBA 3M6AA 3ZHCA 5KJ1A 2OC4A 3JQ8B 3TZCA 5I8ZA 2ZBFA 4NXNB 1JDUA 2JGDB 1KP9A 3C15C 1Q0ZA 4P4LA 3G17A 2QV0A 1SCUA 2IZ5A 2Q6QA 2JJ2D 3Q5PA 1IY0A 3QPBA 2JH3A 2LPMA 2NPIA 1JEDA 1ZBQA 1ZQ1A 3ZJVA 1NBMD 4O63O 2C61A 3KJGA 4P34A 4MR9A 3CCCA 4MCIA 1E7RA 3D6UA 2M6RA 4ZI7F 1V1RB 1HL7A 1E6WA 4NBDA 3KPEA 1WXFA 1GHTA 3KV1A 2C4KA 1Y63A 4TZTA 5TGDA 4XWAA 2D7JA 4ZCIA 3LTEA 3W67A 4MH0R 3M9QA 4L4SA 4O4IA 3GU3A 4A1OA 3Q8KA 3G0CA 3KL4A 1YCDA 1FDUA 3B7WA 1ZD1A 4X20A 2BP7A 3O8ZA 1R64A 4Z53A 1DBPA 4WZAA 1HOXA 3UFBA 4ZIRB 4MR7A 3W06A 5CIWA 3CLSC 1SXIA 3SKYA 2X41A 3O8RA 2DFLA 3TEFA 3A0RB 1RFGE 3OZSA 3GZNA 5L3QB 3RL0C 121PA 4NZ9A 1Y5NA 1QK4A 2YMKA 1LTGC 2CD9A 3WNBA 1GCAA 3TM7B 2CGEA 2MINA 4F5YA 3KYDA 1HC7A 1GAXA 4FOSA 5APXA 1IB0A 1FNSA 3ZWPA 1Z15A 3RD5A 4QDZA 4KYVA 3UOAB 2Q3FA 3DXFA 1C4KA 4FYKA 4CS0A 2OWDA 2UKDA 1EPUA 3T3GA 3JAKA 1DWUA 4EPYA 1UWVA 1EG2A 2FEWB 5B3JC 3TTSA 3W9YA 3L6UA 2YWCA 3VR5D 1X0XA 1MC4A 4E2ZA 1YB7A 1CVLA 5CYFA 3BXOA 2OCKA 2PUWA 1XD9A 4ESVA 3K2QA 3I8OA 3UG7A 1E7WA 2I67A 2R1UA 1TMOA 4YMLA 1EB9A 5FXMA 1J0AA 4MITA 2INGX 1TWAI 2ZTVA 4DLBA 1GO2A 2PVPA 2EFGA 3PD1A 3V2RA 4BLPA 1JN0A 3A9VA 2O4CA 4PS1A 1P5JA 3R3HA 2IFNA 2CMHA 3DYIA 2B1IA 5FWNA 1MO3A 5FUYA 1RMYA 5LMNB 2J87A 3HADA 2WICA 4MQEA 3DEJA 4DMHA 4YMUA 2MR6A 2C03A 4L5BA 2I6QA 3CMCO 5FPHA 5AVZB 4X84A 2OV2A 4LDQA 3ZOKA 1ZP0C 1YK0A 5CRIA 3U6BA 5BNWA 3U7GA 3L0PA 3S9OA 2LKMA 1FUEA 5T8KA 2WVGA 5LXTF 4RORA 3I9MA 5JDCC 5MFPA 2OBLA 4CM5A 2GBCA 1UJCA 5LQRA 1LTJB 2AD5A 3QVVA 3SICE 5LM3A 2QE7H 3T3OA 1FZGA 4C43A 1D09A 2EEPA 4ML3A 3OKCA 1T2NA 2A1UB 2GJ8A 4YACA 1ONOA 4JI1B 1N8KA 2FUG6 1KB9E 1WCXA 4WRRA 3IX0A 2J7PA 2O4UX 4JBNA 4ZVNA 4AURA 1W5TA 3NBQA 2IEDA 3EH2A 3N59A 3I5CA 3CRW1 1PCXA 3EGCA 1UC8A 3K2BA 5ALSA 3MTUE 2H59A 2XRYA 1VF5B 2P9FA 2VCYA 3V7NA 1GILA 2MCFA 3AZQA 3BIFA 5JVDF 2PXHA 4C78A 2H18A 1P5RA 2WF9A 5CTAA 1IN8A 4LHXA 5G0SA 3OSZA 2GERA 2A9VA 4FHDA 4IJ5A 4G0YA 3W3ZB 3FVVA 3EVNA 4D8UA 5C1DA 1Q1NA 4RANA 1MAVA 1IIRA 4LNUB 3FXDA 2RBLA 4ZC1A 2OCLA 2AWNA 3U49A 3WQRA 1G2PA 2DY0A 3PS9A 4QSMA 3RRXA 2JJYA 1YFLA 2B9EA 3RWOA 3GBPA 1L0LK 2EERA 3B1FA 3OEWA 4MDEA 3CKMA 4LRTB 4I9GA 1IU9A 1Q5PA 4DABA 4HUTA 5C31A 2E9SA 2RGWA 4CG0A 2DSNA 2PRSA 1FQKA 1XCPA 3PNLA 3HDTA 4RZSA 4R3NA 1WXQA 2EG5A 3H1HG 1DZ3A 3G9XA 4FFSA 4RJJA 1I4EB 2C82A 4B4VA 3TIIA 4OU5A 1WSAA 4JIMA 2XEXA 3TMAA 4UATA 3QMMA 4INAA 3TIGA 3IRUA 1TFIA 2DWUA 2HM7A 1PWHA 2OXRA 5DLDA 1GNPA 3X2MA 5FAXA 4BGIA 1GU1A 2RKBA 3L6EA 4RESA 3BCCG 3D54D 2GZ1A 2N1BA 4LJRA 3WSTA 3GLVA 3F4LA 3O84A 1SUDA 4MYDA 3SC2A 2H51A 3EF0A 1Q821 1VKRA 2ZYTX 1SXPA 4D4HA 1FEZA 1XJWA 4J3FA 3VKFA 1USKA 2JGMA 3FTEA 4OPMA 5B6IA 1IC6A 2BUAA 4YDQA 4LHZA 1JDPA 5GIPE 5JZ9A 1V8DA 4GDOA 1GPNA 2C4NA 2MSKA 1JPJA 3SS9X 2WSIA 4WA8A 3MG9A 3A6GA 4MQ4A 2M1XA 3DO5A 4TL7A 3H1HD 3FGPA 2W58A 4I55B 5KCMA 1NI3A 3P27A 3M6WA 3I01M 1K7XB 3CUVA 3FFWA 1SEPA 3LBIA 3IS3A 2D59A 4GH5A 1PD1A 2NG1A 4PPGA 1Q20A 3IKVA 4FI3C 3BG5A 3EH1A 1N2SA 1M8GA 4QU8A 1PV4A 3AG5A 2N1MA 4IDCA 3BCCD 1KZUB 4E5VA 4IIFA 3SY8A 3AUFA 2QLBA 4UOEA 2PT6A 1S2DA 3B1JA 1YIT1 2L0XA 3HR4A 2HWXA 1XTUA 4RVUA 2V0NA 1RI2A 4MKGA 4D4GA 1GVHA 1XSEA 3QEMB 4CI9A 4Q21A 5J23A 3NASA 3HCPA 4RKUJ 1DBWA 3GIWA 1QSGA 4DLPA 4MUBA 1NIPA 3KB2A 3BRWA 1G41A 4Y9RA 3KYQA 4ZDIA 4JFAA 1I33A 4R41A 3RIXA 1PLKA 1V16B 2WT7A 2V5UA 3ZBUA 4ASVA 2PIDA 2HTEA 4KG7A 3WL3A 1CR4A 1G21E 3OT1B 3GEDA 3C45A 4KREA 4Y67A 2O50A 4QTXA 1TD9A 3F78A 1GZ3A 3GD5A 1ZUWA 4MYSA 2NTNA 2RE8A 3FM9A 4BUCA 4HDKA 4HGRA 4PGAA 3KQVA 1JQLB 1W44A 3WY9A 2VDLB 2YO3A 2H07A 1Q7Y2 4AUWA 1WETA 1DX7A 2IOQA 4Y2SA 2FXVA 4BLTA 4TL6A 4XD7A 1ORIA 1SY7A 4LIPD 1URQD 3F9CA 5SICE 1KMHB 3AXTA 1T1EA 3VTKA 4P36A 4D9JA 3AR4A 2CHGA 2H31A 1YI0A 4PGHA 5DNWA 3JYPA 3M1YA 3OFND 3CV3A 2HO5A 4I4NA 3UV3A 1WDTA 3K05A 4M1QA 2RBKA 3MQ4A 1WCMI 4CW7A 2MSCB 5H3CA 1DKQA 1G2QA 3KKPA 4RK6A 3WU2E 3ANYB 4GQBA 5DNCA 1J5XA 3QWZA 2BUBA 2K5UA 4AG3A 1R00A 2CMFA 2H2HA 4FR5A 1EUCB 3T1TA 2A33A 2Y1XA 4LZAA 4L8LA 2PZEA 3WV5A 3ZX4A 5LYJF 2JGNA 1SWWA 3S44A 5D5HA 4DLSA 1QFSA 4LRYA 2QP4A 4R4JA 2ISQA 3ZZ1A 2ZYAA 3H8WA 3JQBC 2ODAA 2IYLD 3I5XA 3R1IA 5AUPB 3UCFA 3M6LA 3OM0A 2ZJ2A 3RAPR 3SQDA 4DT1A 4DRZA 4QDUA 1D2HA 3SR4A 1W49A 1YRWA 1EUDA 1C7ZA 4J2TA 2JA6I 2H88C 3WA7A 2HHHB 3BF7A 2XB9A 3K96A 3CL3D 3SJZA 2ZUUA 3DLBA 4YASA 3I1FA 1DFIA 1RCFA 1Y5IA 1SOWA 1C0PA 2EARA 3QH4A 2B87B 1YC2A 3JQAA 1G17A 1S5LE 5BV8A 2HKIA 1QHGA 4ZV9A 3WFZA 4AD8A 1M1ZA 1Z5PA 4UTPA 4P4SB 1HNXB 4LUCA 3O8DA 3RTDA 2OYHA 3OETA 4F3RA 1X1EA 2GJSA 2H4JA 2ZWAA 3SS8A 5HKAA 1K8YB 4IDBA 2LVBA 2PVCA 2VZ9A 2NYUA 1BGYG 3H83A 3U26A 2QMZA 2IYWA 2JBWA 1JR3E 2HBYA 3NBYC 3VPDA 3GUUA 3UICA 2C98A 4UCQA 3D5TA 1SQVJ 2O8VA 1II8A 1L7RA 5DOVA 5CPBA 5ALFA 4JUFA 5BV1A 3R23A 4J4BA 5C0OE 2MHCA 2GLTA 1MEJA 5JCJD 1Q1GA 3E7KA 4Z0HO 3ZXSA 3GTPA 3BHNA 3CCR1 3EGDB 3L77A 2R4UA 3QG5A 4DDUA 3AP1A 2IV2X 3V1MA 5H0IA 3TIVA 4G89A 3AG6A 5FOUA 2A3RA 4EB0A 3IA7A 4RA6B 3W4JA 3UIAA 3UK0A 3DUWA 1RXCA 3VGPA 1TM1E 3F98A 2O06A 1KN7A 3GGDA 3F6CA 1D2NA 4URHA 5B6CA 2M5AA 5G0TA 1XL0A 1OE0A 1VQ5Z 3SYMA 1XWWA 2EJTA 3HYLA 5DM2A 3P5JB 1Q19A 3U7JA 1DLJA 5BVHA 1R8QA 4IIJB 4ZXPA 1XTTA 3B71A 3WLHA 2Y9MB 4CBVA 2E6UX 4QOHA 4QPJC 3INGA 4RHUA 1NTKK 5KWIA 3K1ZA 1BGYD 4OXYA 3MGNA 4TGLA 4YCBA 4QGSA 1D2EA 3FGOA 1PT0A 1VJGA 3W8EA 1KTMA 4ZCMA 5FIUA 4UB6E 1Z2CA 1UAAA 1C1DB 3Q9NA 4JA0A 3RAFC 5C35A 2XRFA 3EA0A 3CCLZ 3ZWCA 1H85A 2VBFA 3NCTA 1BW4A 1Z7GA 4JR0A 2J0QA 4U9HS 4G5FA 3X2SA 3TLAA 1OGYA 4PWYA 2ZXXA 3OLWA 4R0NA 3O75A 2VT7A 3QU5A 3CMEZ 4FONA 4B3CA 3O74A 3O3CA 3ENQA 2GPYA 3IP3A 3CCEP 4MWEA 3G2LA 1FTQA 3ROEA 2Z8YM 1ZSVA 2BFBA 3P1JA 1ATIA 1M56D 4JSYA 1EDDA 3OZFA 1M2NA 4RV4A 2V8OA 1NKVA 4LKOA 4C89A 1EXJA 3WDMA 1U8YA 4PAMA 2ROQA 1XMOB 1K4YA 5IT9b 5ISMA 4C88A 1T5HX 3DE1X 4ICIA 5JJIA 2JI7A 3RADC 2G7ZA 3U3MA 1K06A 2MJLA 3FYUC 2FFHA 3AIIA 3CUTA 1BQ4A 1RO2A 3FXEA 3OE1A 2AQHA 1G9TA 4RF3A 2E37A 5DYWA 3A28A 5T4EA 4KO8A 3MZ0A 4IJMA 5ADHA 1H0TB 1I2BA 1NBIA 2CXRA 1EK6A 4Y1RB 1ABBA 4BGVA 4DJFC 4RA9B 3ZCTA 3GT7A 2R4TA 4ISBA 4DBLE 2HJHA 2VHEA 1A04A 4WJLA 3DLTA 3KLOA 2NXEA 3RFVA 3E9CA 4HZUB 3NXKA 5LOVB 2A9OA 2VF5X 4RVFA 3OCVA 1RWBA 1YJWP 4Z99A 3FFAA 2M3BA 3DBHB 1S8NA 3V4PB 2JCYA 5MF6A 3RZOI 4AMGA 1GK4A 3CMAP 1YI2Z 1FZAA 1EE2A 4FR2A 3QUQA 5C80A 2FMFA 3QMWA 2VAXA