1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
b'MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
1TWGA 4C2MA 3O5AA 3H0GA 1I3QA 4AOKB 4DMRA 1CZ5A 5T5ID 2NVYA 5EPPA 1TWCA 1S3SA 2JIRA 1PYUB 1ZMEC 5FTNA 2IVFA 3TM7B 3FKIA 2VPZA 1IW7D 2E2HA 1TMOA 1QDNA 3HKZA 4RV0A 1UHEA 3GTGA 2G8YA 2DMRA 1PQHA 3QQ8A 1FDIA 1I50A 2JIMA 1PT1A 1VC3B 3GTLA 2P10A 4KLNA 5DYGA 3H25A 5C18A 2NAPA 3IR7A 1AJYA 1SIWA 3IR5A 3GTKA 4KDLA 1UHDA 5GLFA 1SFOA 2KI8A 3GTQA 5FTKA 2PMZA 3O6QA 3DMRA 2V45A 1PQFA 3QC8A 4QIWA 3GTOA 2JA7A 1TWFA 2WAQA 1Q16A 5B6CA 1DMRA 2VPWA 4AONB 3PLXB 4CS0A 4AZDA 1TWHA 1KQGA 4CRYG 1TWAA 1R9TA 5C1BA 3QWZA 1QCSA 2JIQA 3HU3A 1H0HA 2PJHB 1Y1WA 2JA5A 3TIWA 2JIPA 2C45A 1E32A 2JIOA 1E5VA 3ML1A 1YLEA 5FTLA 2IV2X 1DMSA 5DYIA 1K83A 1EU1A 4KDIA 3GTJA 4AYBA 1E60A 1Y4ZA 2VPYA 1Y5IA 2E2IA 1Y1VA 1G8JA 1G8KA 2R93A 1WLFA 2B63A 1CR5A 2VUMA 3HU1A 2E7ZA 1OMIA 2NYAA 5T5MD 1WMKA 3GTPA 2VPXA 2V3VA 3CF2A 3HU2A 4AAYA 2YU9A 1CZ4A 1PPYA 1KQFA 2Y0SA 1R7RA 3CQZA 3IR6A 2R7ZA 1AA6A 3EWKA 4CRZA 1R27A 5FTMA 1H5NA 1E18A 3QQ7A 1AW8B 4GA5A 1OGYA 3IN6A 1PQEA 2JA6A 5FTJA 4D7ZB 1WCMA 2R92A 2NVXA 1PT0A 2WB1A 1E61A 1PYQA 4KO8A 2EEOB 3GTMA 4GA6A 1FDOA 3OUGA 4KODA
chains in the Genus database with same CATH superfamily
1JEEA 1L3CA 2JJYA 4W5RA 3ZV5A 2VTVA 3ND6A 3B70A 2FPOA 5J2UB 3RUCA 2VPZA 4B2YA 2VNKA 3DVSX 2V8BA 4DG5A 4A2WA 3NH6A 3CVWA 1XQ9A 3OIWA 3MQFA 4XR9A 2RHLA 1RXYA 4KYUA 1H66A 4H1HA 3I34X 1WBBA 5B7QA 3RWOA 4HZUB 1EZZA 1JIXA 2GYVA 1S72P 4KX5A 3M9BA 2A86A 1W29A 1IVNA 2XVXA 3W9BA 4XSGA 5EIBD 2JFYA 2YBDA 4LYGA 1XOIA 1R3DA 4LYFA 1JHVA 5IBRA 2ZITA 3GGJA 1WV1A 2QE7D 1WDKA 3LIEA 1VQNZ 4UXHA 4Y2HA 3GRKA 1C41A 5ESXA 2O1WA 2LXCB 1LPOA 4MIEA 1TC1A 2YL2A 1J39A 2JLYA 2C5BA 4HAYA 4OGLA 4U5QA 3CC2P 1MQSA 3EFGA 4TV8F 1U1CA 2CV0A 4X97A 1WSAA 4L5JA 3RK1A 1ZN8A 2QYSA 3UWSA 2DHEA 5DTQA 1KGSA 3HOWI 1ZM9A 5FNZA 2QTMA 4OGKA 2QRPA 1N6LA 2XX3A 3BG0B 2X15A 1KEEB 4Y0VA 1E4EA 3HA7A 1TWAI 1PJZA 1QIDA 2C8KA 4LHWA 3IT1A 2JIZA 1SFCB 2JFFA 4XWAA 1F2TB 3F90A 1S5LE 2C31A 4TLLB 1G2OA 5DJUB 2KOGA 4LSWA 3R7BA 5JFOA 3OUZA 1D4ZA 2HF7A 4FIZA 3I3SR 1SOMA 3D4NA 3QJGA 1QB7A 5TLSA 4IRUB 4MHSA 5U9CA 3QPDA 4CV2A 4HYTB 2ZT8A 5DCUA 2QR2A 2V9CA 2VJNA 4LOLA 1DBQA 1RYYA 5IDVA 3JPWA 4M1EA 5AD1A 1U3CA 3MCUA 2RGYA 4KXMA 4IIXA 4YWJA 4JGBA 3NBUA 1GV0A 1ZWLA 1D1SA 3D5EA 2E37A 3GEBA 3AJ9A 3FPCA 3HCCA 1PFGA 3RRJA 2RGAA 4Y2VA 4EJ0A 1NP7A 2CJPA 4NPDA 4NTZA 1NT2A 1ZY2A 3V7UA 1JI3A 4HN2A 3G9UA 3A2KA 4KLRA 4RVNA 5LBIA 1EFHA 4U7JA 2GEKA 3HA5A 1WVIA 3PDUA 2Y0CA 3PITA 4KXWA 1XZBA 4UHKA 1E2UA 2Q7DA 5AIBA 4CR8A 1IIRA 3ZC3A 3P19A 3CZPA 1U2DC 2EBFX 3DUWA 3UMVA 2FPIB 4TOIA 3RFFA 4CEIB 2DERA 1JECA 1YUNA 1ZO8A 3TFOA 3AZPA 3DOCA 3GJ5A 4O1MA 3UAZA 4FU0A 5DBOA 3GLIE 2J0EA 5FPSA 1L5KA 3A26A 4LE0A 3R77A 3EF0A 2E4VA 2QA5A 1C2YA 4M7OA 4GRIA 4OTZA 3R8XA 3FTNA 2R62A 5J5CA 3RSZA 4URZR 3K09A 3WLKX 1NUQA 3RASA 4Z6KA 1TFIA 4HMOA 2DBRA 3G6WA 3ZK7A 1H9BA 4EKIA 3FPAA 1XA0A 3OEEA 5C8YA 3HK2A 4D44A 5EINA 3KDAA 1U7DA 3UICA 4YRSA 1M7LA 2ZGVA 4A3GI 4OHFA 2FP4A 3GVIA 2LWIA 1HE8B 1LC3A 3ZX5A 2EGHA 2IXEA 1KDOA 3BD7A 3THXB 3LLSA 1O77A 1N2GA 5HUJA 2OCDA 2BF7A 3JARA 1RWPA 3WLRA 1U0JA 1UMCA 2P7JA 3S5UA 1SCQA 3A9RA 5GGXA 1EVEA 4CWAA 4PJ0H 1OWNA 3WWOA 2XKKA 4Z9YA 3TNFA 2YBEA 2FFQA 4DDMA 2J4CA 2PANA 4HB1A 1ZD3A 2Y92A 4C0BA 1E2JA 2QR3A 5CT8A 1S5LH 1IHOA 1ZN2A 2ZJSE 5DM70 1PYOA 2O57A 2AD5A 4JI2B 2DH5A 5AOAA 5COQA 3CS3A 2GI4A 1AH2A 3L7IA 1KYOE 2YO2A 3PXDA 2VAVA 4YJDA 1UODA 1HURA 3ZHVA 1US8B 3RZDI 2JLQA 2Y6UA 3QXXA 5I9BA 3GRRA 2C45A 3MONA 3G0BA 3L93A 4MS3B 1B6SA 2RI6A 2B3DA 2WITA 1OW6A 1H1LA 1EB8A 4Z4HA 4MYHA 3CHYA 3G02A 3R2PA 4BLTA 2J3MA 4YA6A 5LOVA 3D59A 5CBNA 2NPSD 5H81A 3BRCA 5TF4A 5DBFA 1XG5A 2G6GA 2WPDD 1NWQA 3R3ZA 4HQ6A 3DMGA 2X8JA 1J8FA 4XGNA 4CFYA 4WBXC 4G1VA 1KSFX 3FGPA 1SQSA 1O87A 4OQDA 3R0ZA 2XRFA 4GX5A 3SFZA 2R6CA 4D4MA 3LFHA 2UXBB 3MFQA 4N3GA 2IZOA 3G4SZ 4XX0A 2UU9B 3T1OA 4AMZA 4JKOA 4OSEA 4V24A 4NXMB 3WDLA 4TV9A 2TMKA 1MPTA 4G1UC 3I2IA 2IE0A 4R4MA 4RVSA 4LDQA 3DQPA 4TYMA 2YW9A 3L7MA 4MYSA 3O1LA 1D9XA 2OLEA 3WWDA 4EIWA 1SN7A 2V5VA 3L8HA 2A1TR 5A0FA 3GY0A 1O3YA 2QM0A 1G0OA 5KTSA 3FCSB 2FKWB 4MQ6A 1H2AS 4DLAA 1YB5A 2CPSA 2HYDA 1FL9A 1MXHA 1M2OB 3WNVA 4JBXA 1SQXJ 4RW0A 3G2HA 3G2JA 4EUEA 3IRVA 4RFVA 4Z49A 4HDMA 1KYOD 2Y4NA 5GOTA 1H23A 1XKXA 4K8OA 4JYMA 2DBYA 2NQ8A 4R8KA 4NZPA 1WUKS 5JECA 1FXSA 1ZIPA 4YVFA 1SU6A 4EL0A 2VJMB 3H3JA 3LLMA 4WKGA 2W7TA 3KP1A 3HR7A 5FBQB 3WUUA 1NAIA 2ZIWB 1UJBA 3R5HA 4E4RA 1PT9A 3FDXA 5FFMA 1L1RA 2F1OA 5KBYA 4I8IA 3H65A 4YNBA 4G1FA 4DDTA 3T06B 3I8SA 2WT7B 3OE5A 5HUQA 1NVGA 3OE1A 5EZYB 2PAFA 2OP0A 1OFIA 3RRXA 1KYOH 2E75B 4CODB 4EARA 2X0NA 3K1YA 1X8LA 1YQTA 3GVHA 1TECE 4X7MA 4XWKA 1DIRA 2GHIA 3RYHB 4G0WA 1DWQA 5CXUA 5KOJA 2J3LA 3MELA 4ISCA 1HOTA 1XRPA 1RBYA 5FLMI 1TZJA 4UC0A 1BGVA 2F3UA 3RTAA 3J7AC 3GFQA 4Q12A 3JZAA 1T9ZA 2WM9B 3TINA 3SOZA 2RBLA 3L70J 4B3BA 3C48A 3UJBA 4P6VF 4OQPA 3WLPA 1AQYA 4PLYA 5AXAA 4OVNF 3AR3A 2W9XA 3GNTA 4JUBA 2DQYA 2NYUA 1IU9A 1M34B 3NEJA 3HO1A 1RAFA 3THWB 2MCFA 3EOAI 4QXQA 1SU8A 2GZSA 5BT8A 1IEWA 3TQIA 4L5IA 1H5QA 4OHUA 2B8TA 3L4SO 5JAIA 2YR0A 2HQRA 3F7MA 1QV7A 3IDOA 2HREA 1JALA 3DDOA 4DCPA 4NFHA 1F7UA 3N7AA 5LA6F 1V3QE 1MD9A 4B35A 4HZGA 2CT8A 2K37A 3OZCA 1FFDA 2V5UA 4KL8S 3H1KJ 4K88A 3BIJA 1JCCA 3E15A 4V0ME 4J75A 2C07A 1YS2X 5LP6B 3DOIA 3ZZUA 1R12A 1JDNA 1M1K2 4EG4A 5EJMA 1MZPA 3GBVA 4RKRA 3I9FA 4Z4QA 4ALMA 1VB3A 2FXMA 4ZKDA 2R11A 4ZYYA 1EXNA 3N2IA 2BTQB 1E2DA 3HI6A 1TWHA 1RJDA 2PSJA 4X60A 1VP9A 5A4KA 3DZJA 4ALLA 3FTDA 4DV1B 3ADDA 3R40A 1EDOA 3WV5A 4DJ5X 2Q41A 2CE7A 1Y82A 1EI9A 3PWTA 1XZQA 2V5AA 1DSSG 4ZAGA 2I3ZA 1T6NA 4YRFA 4I7EA 2HKIA 4RK4A 1U0BB 2G82A 2ODNA 5A03A 2IIVA 4BEVA 1N0HA 2GXAA 1SKQA 5G40A 5HBRA 3JQQA 2ORYA 4YMIA 3CH4B 3G68A 2AKEA 3LNTA 1T15A 4KDRA 2Q6QA 1XRNA 3I1FA 3H9CA 4LVNA 2XMZA 5FRDA 1RWNA 2CLOB 3DO8A 3DE3X 3UMCA 4C7NA 3ORFA 2VQSA 2X40A 1REQB 1U5BA 3G49A 3IDZA 2KIKA 1XGKA 3CEPB 4DLYA 1MX3A 1BRMA 2CMHA 2AEMA 4Z86A 1E1DA 3G8DA 5CK5A 4J9UE 3OPVA 2FK8A 3N2GB 3KFXA 2HJWA 3GF7A 2VBGA 4V1CB 2PO5A 4JLSA 4JI0B 4KQHA 2QL5A 1QVVA 3BRTB 2P0EA 1M1JB 2DFLA 1MAUA 3EGOA 4RO0A 2GK7A 1S0UA 1WS6A 1K8XB 4DSUA 3BJIC 3C5CA 4OK3A 2FUCA 3IB3A 1V71A 3RUPA 3UK1A 1J0DA 1YHQP 4QTUB 3A28A 4R51A 4LOAA 2MJLA 2HFJA 1Q3TA 3FAKA 3RJZA 4GBJA 4OP2A 4P3NA 1AQJA 1QF9A 4HHEA 1N5JA 4K9DA 4Q7MB 3A2NA 5KX5A 3KSZO 2NXCA 1KFCB 2OVFA 4J0IA 2X0DA 2BP7B 2HGZA 5A7FA 4R7ZA 2YXBA 4EENA 1LTHR 1VQM1 1JJVA 3N05A 3TJZA 3F3PC 3C74A 3WI7A 1X94A 3PB3A 3GZTB 3CVJA 3RK2B 4QPDA 3NFQA 4P58A 2P9CA 2ZJ2A 3ZK8A 2EFDB 2A35A 2BGWA 3F3YA 3VDQA 4PYJA 2NQTA 3WK7A 3V00A 1FXUA 4K9MA 3F6RA 2X2OA 2QMUA 2PFXA 1SZPA 3SMQA 1P19A 3ZCQA 1J25A 3MJEA 3LPMA 4W9NC 8OHMA 1FS5A 2FU5C 5JSZA 4BLOA 1G1AA 2WJAA 1AMUA 2EX0A 4MPJA 2WZQA 3BWCA 1Z7YA 1GG2A 3HYRA 5B6IA 1XPUA 2I8DA 1R6AA 2C96A 4D7ZB 2ZYTX 2WWYA 1MFPA 3GRAA 1DXHA 1Z29A 1OZFA 3R0XA 1HTTA 3UJ7A 4QHSA 5EXPA 4ND3A 1E3WB 3O8RA 3O4GA 4R7GA 3JD3A 4MW9A 4FT2A 3EA4A 3B9PA 1EM8A 3GTLA 4Q4AB 2XLBA 4HQKA 2EFEB 2B20A 1RJEA 5JALA 1XZKA 4MI9A 3VR4A 4MIKA 3TEMA 1I7LA 4DAOA 4R3NA 2MYNA 1FW6A 1RXVA 1ZOIA 4G26A 3VC7A 5HOEA 2ZTMA 3O8NA 4HAOA 3U4MA 3K5WA 4CEJB 3ZWXA 1V4BA 2ZJFA 3WMGA 4FGZA 1DG1G 3HUFA 3VHXA 3B6IA 4PZEA 3AEUB 1F9EA 3HA2A 4CUKA 1PJLA 4U7DA 1Z0UA 5CRIA 3F9IA 4K6KA 3A4VA 4M8KA 1U6IA 3C97A 1G21A 3SDBA 1R27A 2GCEA 4WZ6A 2V4HA 4XYEA 1NN5A 3HN7A 1K7FB 4LZPA 4IGFA 2P91A 3LX4A 4CLHA 1K7CA 1Y80A 1OYOA 4I9NA 2YFYA 4OL0A 4GC9A 3JYOA 3K8ZA 4LZNA 3Q2IA 1SP4A 1D3AA 3GIWA 1LQ2A 3EWNA 4AZ0B 4MJ3A 3GB9A 2FPPA 5FPPA 5CYFA 1H0KA 3CPEA 5ALTA 4XOIA 1N92A 2HNAA 3VNUA 3DMRA 3K4HA 1AT1A 1LCIA 4OV6B 4QKQA 4TTVA 1DOZA 9ABPA 4RKFA 5TEWA 1JMKC 4PTYA 3VNSA 3WL5A 3FKSD 1YBVA 4XR4A 5EGNA 3SS8A 4ER5A 1OGIA 1OWLA 4D98A 2NT4A 1I3OA 4GX2A 5DYTA 2NVWA 4B7UA 3AWIA 2BV3A 2AXCA 4GIBA 4K1XA 4V2UA 1PS9A 5EJ6A 1UBNA 2VKQA 2H4ZA 1M2HA 2OC4A 2VP5A 3EX7C 3PJDA 3U4QB 3KB6A 4HC4A 2FR8C 2G3YA 2VSNA 3LT5A 5BURA 4DPLA 4ZQIA 2WQZA 3L0IB 1NF3A 4IHAA 4BQFA 2FFDC 4PYOA 5HG0A 3DW3X 2CZGA 3ROTA 1NUHA 1TQ6A 2WE7A 1XIVA 1Y4DE 1ZH6A 1PV3A 2LIYA 4IEIA 2ZCUA 3I2JA 2AGVA 1XCGB 4LBVA 4UVGA 2Q6TA 1D7OA 2R6ZA 1N2HA 1F14A 5TQVA 3L73G 4V02A 3JPYA 4WUTA 4ITVA 4YCMA 4RSRA 5GWXA 5LBTA 4KMMA 1RI4A 2BBSA 1RR6A 1YIJ1 3Q7TA 5L53A 2O3QA 1CNFA 5JNUA 3ESZA 5DNCA 5FO0A 3DULA 2BH2A 3QU7A 2HYNA 3ONEA 3PHJA 1JEQB 4GOLD 5G02A 5BYKA 5FEMA 1F1BA 1NSYA 5IXSA 1YVEI 4NMLA 3H0EA 2FPGA 4B4DA 4IZHA 4E22A 3CF0A 1VQPZ 3DEJA 2X86A 2E9SA 4CF5A 3RAFC 2JS4A 3L0BA 1NLUA 1M0SA 4HCJA 2WFZA 2QMQA 4M60A 4UE3S 4NL4H 1Z33A 5B7NA 3DFFA 4O4JF 3S2GA 4Z3DA 5B6CA 4H7KA 4OXKA 4TXLA 3VH4A 3HPQA 1C29B 2JL1A 4WLFA 1Z2DA 3E7XA 4IDFA 3RM3A 2B87A 2RIRA 2ZJZA 4NV3A 3OJ0A 3OTWA 4BMDA 2QJYB 1NKNA 5DNYB 1CUBA 5BWMA 5I51A 5HKKA 4UNRA 1JQLB 3K5PA 3D8RA 2WVJA 3A4IA 2MR6A 3VYWA 2NP7A 4XWTA 5HX7A 3QWAA 1NTZG 3M0AA 1L7QA 2NU6A 3ZV3A 3PVSA 2ZE6A 1HDIA 3T99A 4UHEA 4XWWA 3JD4A 2AFVA 2KQAA 4W4TA 4Q4CA 4XAQA 2J5KA 1CUZA 3RFXA 2ZVJA 2HLOA 2FX5A 3MWDA 3KKLA 1E3LA 1NVKA 2UVQA 1JU3A 1XLTA 5IKOA 4C0JA 4NBSA 4QBFA 2XNJA 5BU5A 4AVYA 3ONFA 1JSLA 3BCHA 2EDAA 1NONA 2Q07A 4KAFA 1WVGA 1E63A 1F5NA 1KRXA 1TK2A 1TFUA 3IAFA 1FX1A 3MILA 3R5JA 5LWHA 2EF0A 1AK2A 4RS4A 2ZP1A 4AECA 4BO7A 3KB2A 3ZDZB 1J7JA 3I5CA 2W6JD 2YASA 4X1IB 3C0KA 1JMYA 1X1BA 3EF1A 5DM2A 4G01B 3O74A 4R1SA 2FFAA 1TUBB 3FTCA 4H0FA 1AURA 1E7YA 2XVZA 3GF4A 3DXZA 5ANRB 1J8DA 2ZR8A 3KEFA 5JAPA 1SZCA 2C2KA 1V2GA 2AT1A 1YR3A 2IP2A 4MWDA 3WYNA 2YMKA 4P1ZA 1JHZA 1VSQA 2AE0X 4DSZA 4UQLA 4ZI7F 1G7RA 5IHXA 3LXMA 1AKMA 2YVLA 3SHVA 4DNOA 5DNAA 3RRZA 2I1LA 5ARBA 3L1UA 3UK6A 4W8HA 2XQFA 3AU8A 3DAGA 1W1WA 2JRLA 2ZRQA 3DOEA 2YZ7A 2XYHA 3IO3A 1KFNA 3F7NA 3ROFA 3N8HA 4U6SA 5KSZA 1TKAA 2K5UA 1JG7A 3C5WP 3LHDA 1Z17A 2BJHA 1HYHA 4C04A 2GRUA 3RVKA 3K9CA 1ZNXA 3DTNA 1U0RA 1L0NE 4L51A 1Q6ZA 5CT6A 3QVGB 3T52A 4X64B 4GMHA 2GD6A 2PZEA 3RROA 4OXIA 5EESA 3EXIB 3F89A 5CDFE 3L77A 4OQQA 1KDTA 1SQPG 5LVAA 1S89A 2ZUUA 4KTVE 3M8KA 2GAOA 2QXYA 4UTVA 3VO8A 1CY8A 2E74C 1DMRA 3CF4A 2XCIA 4Q18A 4HR7A 3D2AA 3EGVA 2QXTA 1X1RA 4I1LA 5EP2A 3T9CA 5IUNC 3U9LA 4BBSI 1U81A 4BNVA 4BOYA 2PT5A 3U61B 3BT7A 2ZSDA 1PR3A 1FA9A 4LJYA 4F85A 2R9VA 4EW1A 2ZRPA 2OFWA 1ZIOA 4BVJA 3ZHYA 2JI7A 3I42A 4WOCA 1LBSA 3RT1A 1YE5A 4B6SA 1POXA 4J16C 4RXTA 4KVGA 5FI0B 2W48A 3C14C 3SJZA 2K5RA 4M0LA 3JVIA 5HKBA 4ZV7A 3ZCTA 1D09A 3X1KA 4JI3B 4FCTA 3ZOZA 3DT9A 5ICMA 4BY9E 3BRQA 3L6UA 1NBAA 4MVCA 1QFJA 1T2VA 3TMAA 1AE1A 3BF8A 5E2BA 1P7YA 3ANNA 2LDXA 2IYAA 3WMXA 4BMOB 1JJFA 4BQEA 5BQPA 5ALJA 1HDRA 3H5IA 4RV5A 4AMVA 3BWMA 4BVEA 1U11A 3LW5J 1OIPA 4HOYA 1X13A 4HNGA 1APBA 3TD2A 1S2NA 5CAEA 1I94B 4F1WA 1BS2A 1D6MA 4YDQA 3NCTA 1DC6A 3SGLA 5HCIA 4ASUD 1RKQA 4A5SA 4D92A 5IP9I 1QH0A 3COZA 4QQRA 5AVSA 1JVSA 1L0ND 5D7NA 3V5BA 1PLKA 4IIHA 1K732 3ZV4A 2ZT9B 4H3KB 3IDQA 1TAQA 3P9RA 4M0FA 3L71J 2ZT6A 5J9FA 1VMAA 1U31A 5KAFH 1M6NA 4RK1A 4F60A 1WDWB 1YMUA 3Q9UA 4H13C 4ZRNA 3RYCB 2AC4A 4BFTA 4QXOA 3NNNA 2K3RA 1K5GA 1CQIB 4US2R 1K0UA 3UHFA 1T3TA 4PGMA 2EKLA 3B8EA 4OKNA 2YYSA 2ZSFA 2BBOA 4K6GA 3T35A 3ECCA 5CFNA 2I7TA 1LP1A 4A6DA 1F4PA 1JXOA 4YAGA 1FJ2A 1U0NA 3QWZA 1P8AA 3SXUB 1OFUA 3I4FA 3O8DA 1V11A 1DAGA 3L46A 4XLTA 4ECAA 4BNWA 1FS6A 3S15I 4JROA 1VQ81 3K1AB 2QJKB 4GC5A 5KO2A 2PM8A 1V1MB 4DR3B 4IDEA 1J06A 1D7MA 1AGXA 1BCSB 2PRKA 2YNMC 1UBTS 4M0PA 1XE3A 3ZXSA 4YCSA 1F4VA 1X0VA 2G4LA 4N6GA 3BMOB 4E5DA 2F8MA 2YWDA 1G4HA 5B1DA 1X92A 3QVMA 2QG4A 3ZXYA 3NBFA 1QLJA 3LDAA 3OPXA 1KD11 3C9IA 1UJMA 2B4RO 1A7UA 5CB6A 1F8XA 2WJWA 4NONA 1XDWA 3W06A 4N8EA 3DR3A 1VE7A 5HM6A 3QEJA 3UWOA 1CXZA 3HFGA 2V6GA 3CO5A 2V4ZA 3CXCY 2ZRHA 1B0PA 1SVKA 1HYQA 1A8UA 3OJFA 4GE3A 2Q50A 3HCAA 1KEPA 2V97A 4P9NA 1Y3DE 2PEZA 1EP1B 4C7RA 2ZIGA 3VMZA 4HDNA 4MH0R 4NF2A 4Y6RA 1PNTA 5JANA 2YS6A 3U4IA 8LDHA 2GRAA 3A6DA 3K72B 1ST2A 1CUJA 4NBLA 3ZIUA 2YO3A 5ICFA 1OE0A 2X58A 4KBFA 5GV7A 3VM6A 5DTIA 1G55A 1OJ7A 4WLNA 2QMHA 1RRCA 2FUEA 5KQGA 4IIJF 2GM4A 4TMYA 3TCKA 2PBZA 1ZXLA 2A1IA 3ZVLA 3AR2A 3F7TA 1YQGA 5ALQA 3VI4B 2EFHB 2WRZA 2PZJA 1YNJD 1EA5A 4ND4A 1YE8A 1VQ7P 1I3MA 2JIZD 2VF5X 3OCYA 4YASA 2WKRA 2DQSA 2JFZA 1CP3A 1V26A 3KIPA 1OUMA 4B3TB 2P2GA 3ZU3A 3CME1 2JFGA 2GA8A 4BC1A 3CKLA 4KV7A 4S2UA 3VXKA 5JSFA 4U2EA 4MGIR 1W7AA 1P5RA 4POAA 3HI4A 2Z6UA 2O0HA 2NYRA 4O4LF 2UUPA 4LMAA 3U6KA 3ET4A 5EXSA 1K3UB 4NESA 3QE2A 2VDVE 4KR7A 4U2FA 3TNYA 1O6GA 4ZO8A 4XOUA 4DR4B 1YOVA 5GJWC 3B7GA 3I52A 4FXOA 2H7CA 1QZTA 1IATA 1KC8Q 3ELYA 5IN4A 3WHLA 2YHIB 1W76A 1MH9A 2CNBA 2Z98A 3EASA 3A1TA 5DM60 4ALKA 3IMCA 1BU8A 4JJ8A 3H17A 3K15A 3EFEA 1IZ0A 1RQRA 5K05A 1C4KA 1S2GA 2BHRA 3NV9A 3AP2A 3VSBA 4UNQA 5EXEA 1PNRA 3LUFA 1XRJA 4BNKA 4CDRA 3KQYA 1M74A 1ACMA 1TCVA 4HAIA 4KIJA 1GXSB 4X61A 2B7CA 3OUTA 3RK3C 4OHWA 3T9DA 3ZJ4A 5JDIA 4BVBA 4MGYR 3WGHA 4D97A 3IP8A 5ALMA 3RJTA 4IMJB 4X6LA 1Z56A 3KZKA 4UZSA 5GTIH 3WK5A 1X2BA 3FA2A 2EIXA 2JNYA 2RJ3A 5K6TA 3D4OA 1JWHC 1YRWA 5DHRA 2V7GA 3BH7A 2WILA 2XQIA 2Y2UA 3OEED 1PTJA 3MBIA 2P78A 2JKVA 2W58A 4DRYA 4EHLA 1DEKA 3VU9B 4M98A 4IGKA 3QNMA 4LRQA 3BMXA 1ZCAA 1MOQA 4Z8XA 1EU1A 3RFUA 1SQXE 1UFOA 4EG1A 5G0VA 4YHBA 2ZPAA 3TCNA 1L7MA 4MKXA 2OCAA 2QPLA 1UJCA 4OSOA 5P8WA 4YJ3F 2HWWA 4KE8A 1IUKA 5DXAA 3RE1A 2AEJA 1SUFA 4PU0A 1KH3A 5A5EA 4V38A 4GYKA 1NJ1A 1TWFI 4L08A 1LI4A 5CM2Z 5LSAA 3EG9A 3EIOA 2OYIA 4A2PA 3I39X 4G56A 1SO8A 5JBQA 1NU8A 2ERCA 4MPPA 1IAQA 4H18A 4OIMA 4RM3A 4BAGA 1GL7A 2H8PD 2GXUA 1KZUB 1QC5B 4WOBA 3UHAA 3TI9A 1JHOA 2ZRFA 3QEMB 2H2IA 2J3DA 4GI2A 3OHPA 4RL4A 1T1EA 3L8CA 3M4OI 1ES9A 4OHBA 1JPJA 1NMXA 1X86B 4OGQC 4XWGA 3K2EA 5APUA 4XJTA 1Q2NA 4B71A 1Q7Y2 1IBLB 4BFXA 3GZNA 1RACA 1L5NA 4NB8A 1V6SA 3S2ZA 4R2KA 4M1KA 2OEPA 4NOKA 5EIWA 4PO3X 3L70E 1OBVA 4PCLA 2Q29A 1S4XA 4GE0A 4GVXA 3G9ZA 3VVCA 4DLBA 2O7VA 2RBGA 2IYRA 2DAPA 2QX9A 5DLEA 3JYLA 5FLYA 4KYVA 4K1LA 4KPYA 4R9VA 4I55A 3L8MA 2O7QA 2C8VA 4FMBB 5KNCA 4WBNB 3DYBA 1JG1A 1DXYA 4U6QA 1SQXD 2CLDX 2P3SA 3CW8X 3LSTA 5H2FH 2E6KA 2WTUA 4ZAVA 2ZE5A 4TVBA 5CX1B 5DK6A 5HJ7A 4HVTA 1PL7A 4BXOA 4A91A 2YCBA 2ETXA 1K1EA 1XFDA 3ED1A 3RT9A 3GYGA 5DHTA 2FK7A 5L7TA 1R9GA 4H0LD 3ADPA 4NG5A 3Q8MA 2Y0PA 3MUDC 3ABQB 1PJ2A 4JLOA 4QPCA 3QU9A 2P30A 2EX1A 4ZQEA 2Q9CA 1SVUA 1NI3A 2FJUA 3A9SA 2ZYDA 3PVZA 4RK7A 3AEKA 3HYTA 3D64A 2SKCA 4WK4B 1E64A 1Z74A 2IRWA 1M2JA 5C7IO 2Z58A 5AM3A 3MA0A 1KI4A 4NSNA 1VA4A 3QH4A 2QP3A 5J5VA 1GO2A 4NBBA 1UR5A 3S1NI 4K81B 4EAAA 2QTBA 4WA8A 2GILA 3BULA 3O73A 3ECAA 3FCUB 4HNTA 2Q7OE 1BDHA 2DE0X 1KZGB 3FFBA 1KJWA 4J4HA 5EXDA 2Y1EA 3NTVA 2J08A 1RPJA 5JEDA 3SCZA 3GA7A 1VB5A 1L4AA 1DCTA 1MZ9A 2H5JA 4ARZB 4DZRA 1BX0A 3OE4A 5FYQA 1QDUA 1E69A 2VRBA 2BEVB 1OVGA 3DWGA 2C5FA 3WIVA 5CXQA 1FMJA 3COVA 3E1IA 3KBBA 4FC6A 1DO0A 4TNUA 4E03A 4XUDA 5AVTB 1X3SA 2IY9A 3DDZX 4LQDA 3AEXA 3BL5A 4NNOA 1PAUA 1E1RA 5AUPB 1VQO1 3QYJA 3D6MA 3QWOC 2Y0SA 4C2TA 4TWBA 4LWPA 3GCDA 1KD12 2VJOA 3PL1A 4XWYA 5AOVA 3R5TA 1DARA 4P35A 2RHWA 5AVRA 4JC8A 4DLTA 1VPLA 4WESB 1R0XA 4K86A 2I4RA 4HF7A 4QYIA 1PS8A 1YMVA 2PSSA 5FBKA 4FFTA 1HA3A 2OM6A 2KI8A 2YIUB 5JOQA 1X38A 4QFBA 4XM2A 4XQEA 1VKZA 2ZXEB 4WAUA 2DOKA 1GM5A 2AW5A 4IQ0A 2G28A 3WAGA 3C98A 3K20A 5H3CA 1FDUA 1JE1A 3JVDA 3ZUPA 2EP5A 4FYIA 4O25A 3VH1A 3HCOA 3UIAA 4YJ2B 5EY5B 4W5OA 1MDBA 4UASA 4JI6B 5CGQB 1TWGI 4BATA 2BUCA 4L78A 1U5AA 3R6LA 3L9XA 4WQMA 1XWWA 2OZLB 2JLXA 1Q861 2ZWIA 2DKOA 1JKIA 2VXCA 2JBAA 5C1IA 1NYLA 3SQMA 3TR0A 4LQLA 5CCGD 1CW5A 5CMZA 4HEQA 1O03A 5L51A 2I71A 3DDWA 2QMEA 4I08A 4DQYB 1SHZA 2AZ4A 2C3MA 2B7LA 4N7MA 2MSEB 2XZTA 2BI8A 1PQYA 3HKZA 1L4EA 2VDRB 4HMQA 2IYTA 3TW4A 2WPVB 3U59A 3KOXA 5JJLA 3DV2A 5T7BA 4FLEA 1CEQA 1IQ0A 2QE7H 3OX3A 1KO4A 3BS4A 1W1UA 3RU3A 5CCHC 3MSXA 2HQOA 4DVGA 2IKQA 1YWGO 4RSHA 3I8XA 1NVDA 1H0HA 4IXNA 4E21A 3WMEA 4I50F 1TU3F 4YJFB 1A8HA 2YFQA 4MEBA 1NKZB 1ETUA 1DQNA 3VO2A 3MTEA 1N2FA 3SC2B 3TB4A 2ACEA 1KYQA 2ZR9A 1ZVKA 5CCBA 3BQNB 3LUCA 2QJPB 1YQDA 3UV7A 2AFHB 3KFLA 3A6HA 1PT5A 2W00A 3UB2A 1T3GA 3CBGA 2ST1A 4ARIA 3FN4A 1DTEA 1VRWA 1T2EA 6REQB 5CNIA 4JOBA 1RW4A 2XUJA 2CNWA 1PEYA 1R6XA 3SZUA 1G98A 4D5EA 1AQIA 4GUAA 3E48A 4JT9A 5BQ3A 4OX9B 1SQBJ 2DVMA 2H1WA 3ZDEA 1GR0A 3KXIA 3PEWA 4QQNA 3HO8A 4NAHA 3FJYA 3BRVB 2AQ8A 2QM3A 5CM8B 4M9RA 4LUCA 1IK9A 2O2JA 3LIDA 3GGGA 3WISA 1W93A 2BI7A 2X5NA 3S1AB 3FKQA 1PS0A 4MVJG 2JFHA 1WHSB 1QF8A 3RADC 3MN1A 2JZOA 2VCEA 1JI0A 2XB8A 4KT0J 2PQ2A 4QG7A 5HJ2A 1OQAA 4DA6A 4QZVA 1FSGA 2RAPA 5BW6B 4NK4A 5LL6f 4ZZ0A 1YFLA 1XV5A 4U00A 3TZKA 3DVRX 3O9ZA 4HRXA 3HUSA 3ANLA 3JAMA 2HTEA 5M5BA 3CX7A 3LC0A 2JA1A 2WC1A 4YP1A 5TQ0B 1WCIA 4ZYLA 1WULS 1I5OA 2H31A 4RV0A 2FYUG 2A0KA 2IY8A 3N07A 5IABA 4EPTA 1S4MA 2V4MA 4E7OA 3B5NB 2NAPA 3H4MA 3UANA 1MQ8B 4DQVA 3MP7B 4Z0NA 3ZHZA 4IS2A 4Y9SA 5IPFA 3M89A 1WEKA 4HTFA 4ZPXA 1GUBA 2AFIA 1JW9B 4HNAA 2YQ4A 5JZBA 1G5TA 2N1TD 4ESOA 3CI9A 1Z2NX 1PQPA 3A9CA 4EFMA 1DBIA 4PPGA 4M37A 3ESRA 1C8LA 4C4AA 1W5TA 5ILQA 5IASA 3SYMA 1PGOA 3H1BA 3NP9A 1E77A 2NO5A 3JAWA 3CWQA 2VF2A 1CDOA 2N9YB 3FHJA 3FF1A 1XU9A 2B4KA 4WFIA 1RHMA 3QLTA 3V2IA 5IJXA 1SKYE 3O4VA 1YFZA 4WKBA 1OTXA 3FDJA 1OX4A 4WXMA 1QL1A 2B61A 2FSVC 3L7DA 3I01M 1D4AA 2PX5A 3VV3A 1GRNA 1JS1X 3VR4D 4JBNA 2IDMA 3KYDB 4HL6A 2QX6A 4PXYA 3ZKWB 3PFGA 4ZT2A 4R1PA 1Y6JA 1K89A 2RGWA 3JD0A 2O48X 2GU2A 4YR9A 2DLDA 1J49A 1GDTA 3DLIA 1K98A 5KYYA 4RFSA 2A3RA 3D8NA 3PGJA 2GCIA 5H4UA 4LRXA 5TQJA 2G72A 3AE5C 1ZI8A 4TYWA 3FFAA 3ZZMA 1LT9B 1KI8A 5BW4A 3EEIA 2PJRA 3EGDA 4EEKA 1UXGA 1C3OB 3DNPA 1JDTA 5IVDA 4JR2A 2XGOA 4C0KA 2RGUA 3UHJA 1Q90D 1DO2A 2W4MA 2VUTA 2XE7A 1M2WA 5FBLB 1TWCA 4GKAA 4RY9A 2IYOA 1MJNA 3E9QA 5JNSA 3PI6A 4U4AA 1YGPA 3I5XA 5KWIA 4AMGA 4RPIA 3EERA 1S01A 2BFDB 1C7RA 4QU0A 2BE9A 1CJCA 4EX7A 4PBTA 1XDDA 1TZCA 3PLNA 1NU1E 3I55P 2EL7A 4J2TA 4G86A 2UYOA 4RMIA 1QGZA 2HIMA 4B82A 1GZUA 1OROA 1U3WA 3VPSA 3EE6A 3LQYA 3IOYA 3BUSA 1YBFA 3LHKA 3U5ZB 5HE9A 1E2QA 1TTHA 2I4TA 3U4DA 4TT3A 1J23A 5HF6A 2VS1A 1VHTA 4UCFA 4MD8A 1JSRA 1UK8A 1Q811 2IHUA 3U1CA 4I9UA 1OIXA 1PDVA 3H8JA 5CLLA 2GA1A 4LAFA 1HQKA 4F2HA 2DWOA 4C88A 3BL6A 4CHGA 1HE4A 3H8WA 2OKCA 3SI7A 3HVIA 3JQGB 2IGBA 4CCAA 5JG7A 3QIVA 3VMAA 2Y0DA 3B1KA 4ZOQI 1NN0A 3WFIA 1UOQA 3G0OA 2R7ZI 1IM8A 4PS1A 3TNJA 4OB8A 5EFZA 2IEBA 2B89A 3HVHA 3OFVA 1Z12A 1NG9A 4FKBA 2C9CA 4NZOA 4NFSA 4RM2A 2C99A 1Q7BA 1EUDB 1U0FA 5EC8A 1AA0A 2Z9BA 5DM1A 4GPEA 2Y27A 4JJKA 1XX6A 4RF2A 3EVTA 4TTSA 3MAJA 1L7EA 5E6RB 2WW8A 1UXKA 3P9QA 1YB4A 3A3YA 2NVXA 2EF1A 1TDJA 5FBWB 4L74A 3AC0A 4F06A 4WWHA 4Z8YA 1CQPA 5TX7A 1X19A 3A1CA 4G0MA 3MXTA 1PYUB 1I2CA 4D26A 3C16C 3NALA 2R66A 1PQHA 4ZU1X 3TLGB 2ZI9A 1GRCA 3CSDA 1B3BA 1NU1D 1AN9A 5IF3A 4KJZA 4JKYA 4YXWA 1JNYA 1RQGA 3CMCO 1G8GA 1LBTA 3D7RA 3O7WA 4D4GA 1GGJA 1FJXA 4L3WA 2UYGA 3ZDFA 1OB2A 4D79A 2W22A 2JIBA 5E4YA 1VCNA 4UD6A 2VHJA 4YUWA 4I6EA 4ZOLF 3DVLA 3AUSA 2NV0A 1OAKA 4DM4A 5T3YA 1OXUA 4A36A 2CVHA 4HUQB 3DVAA 1KPHA 2XAUA 1BX3A 2Z04A 1M1NA 1ODTC 1WIWA 1KVSA 4KZPA 5EQDA 1R15A 4L7VA 3C8UA 4EO4A 1BMFD 3GN2A 3KSUA 4OQNA 4M86A 4MMYB 3MBKA 4LF5B 1RJGA 3WC4A 1GG5A 2O01H 1AKVA 4Z9AA 4N47A 2MHCA 4HJRA 1CRQA 3ICWA 3KUDA 4MUHA 1C9NA 4AULA 4LCJA 5LLTA 1FZFA 3MHTA 1VE1A 3OQVA 5FUWA 3FNBA 5JWOA 3QXSA 2HBQA 2KBFA 3RL0D 3U1TA 1KARA 3L7CA 2KLUA 2PKYX 4LRTB 4EELA 2H6EA 2UZAA 2ACKA 1MNAA 2BEKA 4P93A 4MVWA 3LUBA 3CNLA 3I83A 1GYPA 3C3WA 3GOQA 4QO7A 3AIIA 2E2IA 1USPB 2JCSA 1THMA 3LKBA 3QSGA 4DC9A 3H5TA 5AI6A 2EEPA 3CKMA 1E9BA 1CZ4A 4XSHA 3CKKA 5GJVC 1WCWA 3KDPB 4C05A 2ZUWA 2JGAA 1Z2OX 4IXTA 3UH0A 3E0XA 4NVRA 1QV9A 4HKTA 4RQTA 3ZVRA 3WGQA 2XUIA 4KMSA 2MDTA 2BASA 3ETCA 3K9BA 1RZUA 2AG0A 3TRDA 4BX8A 2Q9AA 1MC5A 4HWSA 4P5EA 4PRYA 3CGGA 4OQZA 4Q66C 1SBCA 2JA2A 4P38A 2YOGA 3CB2A 3UK7A 3KUXA 4XFDA 3C15C 3MINB 3ZY6A 5JTUA 3KQGA 3GD5A 3KJNA 4L8YA 4ND1A 2CXTA 3CCCA 3STUA 1BFUA 3JQFA 4XCQA 2P6MA 1GPJA 5PNTA 1YIDA 4FFDA 1Y8RB 4R8LA 5SZHB 3VKHA 1AIPA 4DL9A 5GONB 3ID6C 4KRGA 3OE7D 3AYXB 1P6QA 3K6SA 4NBNA 2QRNA 3RIEA 3DCNA 4LDPA 2OWDA 1ARZA 4DGLA 4GWLA 1U04A 4B8ZA 3WS7A 3VP8A 3M1YA 2YH2A 1KJQA 3PFIA 4A16A 1T3ZA 2Y3IA 3ZI0A 3LQQA 3H86A 4PQEA 3W4JA 5ILGA 4FYKA 1ZIXA 5EPOA 4ZALA 1BW9B 2H63A 1EE1A 1RE3C 4AU1A 5AJZA 2HG5D 2RGEA 3R75A 1Z75A 1PWZA 1NV9A 1W2BO 3LUAA 3R0VA 4K7JA 1FDSA 2P7IA 4NPCA 3L0PA 4HWOA 3JSAA 2FFBA 5REQB 2BVNA 4BBJA 4DWOA 3SHWA 2G1UA 2OBLA 2JKZA 1KR5A 2IV2X 1ONSA 4CNBA 4AY2A 1HE5A 1I6KA 4MCIA 1JLLB 4CM9D 1NTMJ 3HNOA 4UAJA 1RZ3A 1YJ9P 3ROQA 1Z83A 4GX0A 1LI5A 5KQRA 4OKSA 4PZZA 1HXHA 3ESXA 3IUNA 4CL2A 2QQEA 2WG0A 3OHMA 4PICA 3DO6A 3LYHA 2JLVA 3ND7A 3U44B 4YRIA 3ROGA 2HRCA 2JI9A 5BUQA 5AJXA 2FMFA 4F8YA 3WXBA 1VQMZ 4JR1A 2GVNA 5BUZA 2YIDA 1PR5A 1OH7A 3NVKI 5JO9A 5AKHA 1RWQA 1LLFA 2W42A 1N7LA 1E2FA 5K8UA 3SVZA 3IQWA 3L74G 4JQSA 9MHTA 3G2IA 1GU1A 2BLNA 3RC9A 3VMXA 5B1IA 1NXQA 4BVGA 5JYCA 3CUEF 1CUFA 3OLXA 2BCCE 2P79A 4LYAA 4HWRA 4B6EA 5EJ2A 3EEYA 1Y47A 3MUEA 5DBHX 5K3AA 3GAAA 5J4VA 1PQUA 3DQZA 3MD9A 3ZY2A 4H1UA 4CIAA 3PIRA 2HJ9A 1ICEA 5JAOA 1MR3F 5FA8A 3LBAA 1KEVA 4JODA 4B2LA 4CI9A 4KN8A 1FUYB 2HYIC 2BFBB 1WXGA 4BX3A 1NJ8A 3W8EA 2P5YA 1M2VA 3W7BA 1T2KD 4QVKA 4ZVSA 3WICA 2PR2A 3G0DA 4F84A 1C7IA 3O3MB 2G9ZA 5HS6A 2SKEA 4ZVTA 2NU7B 4Y67A 4OY3A 1ZBQA 5CUQA 1SUIA 3R7WA 2Q9BA 2Y1XA 3SMVA 2FJPA 2PYZA 4UNSA 4XB6B 1FE8A 1U8TA 1P3JA 2LCQA 2VZ0A 1JAIA 1AS3A 4HWGA 4HPJB 1AFOA 3ZHXA 2J67A 4YRDA 1PKEA 5KYXB 2RE8A 3V6MA 3GQBA 1JFLA 5CYPA 1E3SA 3K8YA 3E9YA 1GCGA 4NBAA 2AOUA 4BYGA 2R5WA 1VQ51 1XVTA 1MABB 2O1EA 5G0SA 4L6IA 1USGA 2C29D 4R05A 5ALGA 3PKJA 3E05A 2YY5A 1QG4A 3GYBA 3OECA 5J23A 2G5DA 1Q812 4FB5A 2VHVA 4WNAB 5A1JA 4FYMA 4GIFA 4PR0A 1FOSE 5GPBA 1KK2A 2VZ8A 3KTOA 4YCJA 4FFVA 5JPIA 2WOJA 1AG9A 4LGCA 2K7FA 3HFJA 3NPMA 5AW2A 1EXDA 1YZKA 2IOHA 1PWEA 4AF7A 2BCCD 4JGGA 3DH0A 3QQ8A 4RDHA 3L4BC 4QYTA 3KWJA 3LP6A 5ICEA 4BE4A 4YV1A 2W8BA 5B36A 4J1QA 3A37A 4OI1A 4A8PA 1FFCA 2BFAA 1XEXA 3MXOA 2GZDA 2J59A 3E9EA 4NY1A 3CC7P 3AY0A 1FZBA 1FFXB 2YWJA 3DSRA 3CCE1 4JQYA 3QX8A 1TFRA 1RF1A 4CUZA 2Z6VA 4L27A 2C3PA 1VBFA 3M9HA 1JE0A 1FP6A 2JFBA 3G8YA 2PGDA 4CG3A 1I1HA 3VDXA 2PS3A 4AN1A 1JBEA 4FFOA 3SF8B 1VSUA 2OYRA 2KPIA 3E3NA 1CCWA 4KFRA 4IDQA 2D7JA 2X9QA 5K8JB 4YO8A 5EGSA 4ZV4A 1QF6A 3HD7C 3DT6A 1USIA 4UD2A 3DPIA 3QEOA 1Y1PA 1ZGAA 4NAUA 1ZFNA 3N53A 2YKOA 1LBIA 4XKJA 1T3HA 4MX8A 4QMAA 3PFHA 1KQFB 2A5LA 1ZISA 2I03A 3ESDA 1JTHB 1K75A 1CZLA 4JB3A 1IXKA 1K9MQ 1YJCA 2V6IA 2ZJ0A 4UHFA 4MH4A 2J07A 3VPGA 3KAPA 4N65A 3WQQA 4X6AI 2EBUA 4YDHB 1YIJZ 1CDEA 1OFUX 1XA4A 1EDEA 4WGGA 2OECA 4N76A 4TV8A 4D99A 4KDEA 4N78E 3ZI7A 2QN6A 5JQGF 4IX1A 4N01A 4XUCA 1IZ9A 3P2MA 4QD3A 4HD8A 5IJ0A 1MJGM 3HKDA 5F2EA 3F4BA 2HMYB 3D6FA 4D8WA 4WCDA 3KYIB 4ID3A 4B2PA 5KMGB 1M2EA 2PFGA 3KWFA 1ZWKA 4JC0A 4KE6A 3IN6A 1O9BA 5LYJB 2B3TA 1Y1VS 4RA9A 2AWOA 3IQDB 2O50A 3I2KA 4LPSA 3HOYI 4O2AB 1WDLA 4JKIA 3HE4B 4QRHA 1X14A 1MJ5A 2GJKA 3I62A 3M9QA 1O6ZA 1N2IA 1OB5A 3HJUA 2GCOA 1R4NB 2IWRA 2QU8A 5EZQA 4PHGA 1M1UA 3THYA 3X2FA 1VJRA 3DP9A 4PLVA 1B15A 4EY7A 2FDXA 2HPVA 3Q41A 4CUJA 1NUAA 2FPUA 1U3UA 3BA6A 3E4CA 3BG1B 4MHOA 2O8BB 3DHYA 4R0NA 2FYNB 1UQTA 2JCXA 5A2GA 3IA2A 1VQ91 1E9AA 3M2TA 1DKRA 3LHFA 5BNTA 2Z2KA 3GFOA 3JSVC 4XSVA 2Y4OA 1ENOA 3I45A 2OZVA 4HH2A 2IXAA 4HRVA 1ZLXA 1Y37A 2P77A 3A5TA 3DMFA 1CE8B 5DBGA 4LY9A 3C1LA 2ZWAA 1HFEL 1EUYA 4HDKA 3MWKA 2B25A 1CQWA 2Y1GA 1MF7A 1K9SA 1E1NA 3I9NA 1M8JA 2AJDA 2CCKA 4QU8A 4NBTA 4NMHA 2QA4P 2W6JH 4N78D 3HTKA 3MZKB 3D9QX 1CZHA 3GCGA 1DBVO 3NHAA 3WV4A 1FNMA 5E9WA 1I4TD 4MDHA 4UEKA 1QRRA 2IZ3A 1SCDA 4XIIA 1WQ4A 2O0KA 1RE0A 4C07A 1X1TA 2IZ0A 4PQRA 4UBMA 3VGPA 1JDBC 3VVBA 4EB0A 3PHGA 2E4YA 1FYVA 5AJHA 3VR3A 4KW7A 4N9WA 1Z2PX 5KLIB 3HKEA 4MQFA 4PONA 1X7WA 3AKCA 2F8LA 3ZGVA 1SXJB 1K8RA 4B48A 3LVQE 1BMTA 1EVQA 1EM6A 3DTTA 4CIWA 2P68A 1JEKA 4MAFA 1XZAA 2ZVPX 1JU9A 2O6HA 2QXUA 2FXPA 3P5JB 2A5JA 2PZ8A 3KUKA 3O03A 1P1RA 4TKMA 1G8MA 3C1OA 4RHFA 1A4XA 3TZCA 3EGXB 4BHTA 1KILA 1L0NK 4PAWA 1Z0FA 5JZSA 4FDMA 2JA7A 3JAMb 2GBLA 3LUDA 1I14A 4M55A 3PLXB 3TX6A 4RZUA 4DEVA 4DDVA 2Q1SA 3W67A 3CW2A 3WJ2A 4LZWA 4RELA 1QR2A 2Q1YA 4BB5A 3AY3A 1W85B 3DZIA 4F72A 1CD5A 2FRDC 3CZ9A 1E2NA 5ISMA 2J45A 1QHHB 3PWKA 2IP4A 3RUAA 5CR9A 1EJBA 2O2IA 3P94A 3AETA 4BNZA 3AI7A 3URKA 3OD1A 3FOAA 3TDHB 1EZ1A 4FI3C 2YHAA 3TNDA 2GERA 3DE2X 5JSUA 4BEJA 2WHPB 3L1VA 4QL3A 2J7PD 2Q4RA 1RIIA 2QT1A 3SJUA 5GAJA 1W59A 4FERA 2ZYVX 1QFZA 2QUAA 1ND6A 2LUOA 4WADA 2VDJA 2E5YA 2PH5A 3AG6A 4CMHA 5ITWA 1MGOA 3PXAA 5KNCD 3N28A 3ZXXA 2HHAA 1T8TA 3RHZA 4EX6A 4DA8A 2IDBA 3NIDB 4J16A 1KBZA 4D3FA 1U8CB 4HBGA 1KI9A 5CIYA 1Q1BA 4YRPA 3RNLA 4FOLA 2BJVA 2H07A 4HQNA 3DLTA 2QUZA 1IBRA 4P36A 4YYEA 1WPXA 2KS1B 5E7JA 4FGJA 2FHPA 1HOXA 1GAWA 4G4SP 1LDYA 3ICQB 5NULA 3SSOA 4Q19A 5BNWA 1RLYA 4Z0HO 3QX3A 3T3DA 2IZ6A 1QQBA 3O8BA 3H1GA 3DKIA 4DOJA 3ZXIA 1QDNA 4GVPA 4ETIA 2V1XA 3UAXA 2M6RA 3NKVA 4AZ3A 4RKQA 1KJIA 3UO8B 1DP4A 2DEUA 1KJ9A 4AICA 1HT3A 1L4AD 3CUKA 3QBTA 3W68A 4KOAA 2FH5B 1O94D 1HT1E 4DJJA 4IVQA 4ZZIA 3BGOS 4ND8A 1OBFO 2BM8A 4EGSA 5G0WA 5K0BA 3TL6A 1ORTA 2XCQA 1K6EA 4F1JA 1R2QA 3ZVKA 4UUBA 1LU9A 4FW8A 1P0MA 2ECQA 4C4RA 1GKYA 2VJPA 3HY3A 1K04A 1DQYA 4ALIA 1AU9A 2OVBA 4IHJB 4PD4E 5F9FA 1E1RD 4MTLA 4L5AA 3QUTA 1O97D 4TLCA 2NNWB 4EW6A 1EFRA 4NS1A 4DYDA 4NH4A 1F12A 1QYXA 1IDN1 2NV2B 2R5FA 1E3TA 3LPDA 4JYZA 4HSEA 2A45H 4BP1A 4Q4HB 4R9RA 1GQSA 4RJLA 2R2GA 4TYPA 2JLAA 9LDTA 1SA0A 3KOYA 4MS4A 2WAXA 4FFNA 2R68A 4X45A 1YRHA 2YUTA 4MRIA 2QN2A 3FOFC 1X42A 4JCWA 1NFFA 121PA 1VQ8Z 1R4ZA 2WI8A 4LC1A 2QY9A 5AN9F 4GP7A 1EVIA 4RF3A 3R4CA 1PT8A 3N8GA 2IF2A 4OM8A 1KH1A 4N9QA 1V7ZA 1P18A 1X15A 2IBSA 4H1WA 3R44A 5D3KA 3KTAB 2NU8A 2YOHA 2A5GA 1NXOA 1JQEA 5C3EI 2GFIA 1HZZC 3H84A 4FC7A 4WERA 3FH0A 3UBTA 3GTPA 4ZVKA 1BDIA 1DDGA 1DPFA 4CL1A 1V9LA 1IN7A 1INLA 3JALA 3UN1A 3ENWA 2GBFA 2G88A 3LC1O 4H77A 2A94A 1I3QI 1B74A 2R1TA 1V6CA 1U2TA 3FPHA 5FOUA 4GX1A 1R4MB 2C2WA 5K3FA 4G4JA 4X1KB 2H43A 3X2KA 4C7MA 5LA6A 5EWLA 3PC8A 3RSLA 2AUNA 2Q62A 4DNFA 1K88A 3TE7A 1ZEJA 2R8EA 4UOQA 2QK4A 3E7FA 4DIKA 1DHRA 2Q4DA 2W2NA 1AKQA 4A3FI 3W3ZB 1NYRA 4PD4D 5DN6A 2RJOA 3FMFA 3CWBG 3GLFA 1GP2A 3TXXA 2GA9A 2WHRA 4P33A 5HZMA 2ZJ5A 5FNVB 2E5WA 4BLRA 1OHHA 1W4LA 2XOXA 5CB8A 1J70A 2JH8A 3KKPA 1E1LA 3O8OA 3AVQA 1V1RB 3ANXA 1C9DB 2AFIE 1Q11A 4UB8E 5JLJA 1Y4AE 1LVHA 1U2ZA 2YZNA 1GLGA 1YC2A 3CUTA 3MYRA 4BRYB 4ZCMA 3KKZA 1K5PA 5DTMA 2CNWD 3S2YA 4HGOA 1I2MA 1NP3A 3EIWA 3QBDA 3MMSA 1ZI9A 4DRZA 3VYTB 2CF5A 3EAFA 1P2TA 5BMOA 3ADBA 1E0KA 3R3WA 3RI3A 1QNLA 4D9CA 4QRDA 5B55A 4GI5A 1JMVA 3WK6A 3R0QA 3CMEZ 2V7XA 2GLUA 1Z6ZA 2CYCA 4ER6A 3OY2A 4FINA 2XJ4A 1CDZA 4FG2A 3WKBA 2VK2A 2NT3A 3MWFA 4I6MC 3MUOA 3QFFA 3TTXA 2CUZA 5K3DA 4TMTA 4ZP1A 3VOAA 4O6VA 3ES9A 1QH8A 1YK0A 3RG8A 3AJAA 2I0FA 1H3EA 4MUAA 1ZKDA 2G3AA 2JRCA 3V4SA 3CLKA 1E96A 2GF9A 2GPWA 3PFWO 1E2IA 3K5HA 1KIAA 2R47A 5M04A 3NRCA 5EVCA 1AB5A 3P2KA 4V0OA 1JSXA 3NONA 1Y1WI 5K4AA 3K2IA 4BJHB 4Q16A 2QB5A 1T9AA 3SOPA 3W4KA 1NL3A 4WI1A 2GYYA 4NRDA 3T7RA 2V7WA 4R41A 3HDHA 3X44A 1RD4A 3EPLA 1P2SA 3Q40A 3BK2A 3BFKA 1YULA 3N0VA 1ZCBA 2AYZA 2G76A 2GMWA 1TTQB 3QI7A 3LY5A 1Z6TA 4FXPA 3NIBA 5AUNB 4LKRA 4R4JA 1F6WA 3K4QA 3OPMA 4NH0A 4EUFA 2JMOA 5I9MA 2H11A 1YQ9A 3I6MA 4MV3A 1G9TA 3W5UA 4P0TA 1SQXK 5DNDA 1P0QA 4FMCF 1V5EA 3EXFB 1OMOA 1UK7A 1ID8A 4PYMA 1N1DA 4HNVA 1MPXA 1H05A 1Y1RA 3H0GA 3UK0A 3CLRD 4ZCPA 1IRXA 2JLBA 1M0TA 1TYAE 4Q1BA 2C77A 3GLVA 2WLTA 1YJXA 1CETA 2P2ZA 4CL8A 3OCJA 3KYCA 2X7HA 3SBEA 1QP7A 2EJWA 4N5MA 5A3JA 1FYDA 2WQ6A 2LXNA 3IVRA 2VPIA 2R6R1 1YA6A 3IUJA 1QIMA 1E99A 2Q7CA 1EFDN 4EOGA 1ODSA 3SR4A 4KI7A 3M4YA 2I3GA 4JP7A 4NEQA 4BO1A 2FR1A 4AYBA 3K0HA 4PFKA 2IUEA 1FTSA 3DDHA 5K8VA 2NYAA 4MB2A 3ETGA 4O4IB 4DJFC 4AY4A 3G5AA 2XH8A 1XAJA 2HT6A 4D2IA 4FYWA 1OLUB 1DH3A 2YIVX 1DJNA 2JHCA 3AUUA 1O95A 3ASZA 1WOYA 5APSA 4ZIRA 1Z62A 2GLTA 1XL0A 3VPHA 4LYEA 3LDHA 4F5ZA 5BN5A 4OCZA 3Q2KA 1JMBA 2QTHA 3H1KE 3OOJA 4LK2A 3BF7A 1NX9A 2FGJA 3TFWA 3IP5A 2Z8ZA 4GPD1 1QIIA 4RY8A 3EQ6A 3VN0A 4L0DA 2ONYA 1R6TA 1ZC1A 1F0NA 2IPXA 3X2GA 1M8KA 1KDVA 1EFPB 3GMSA 3WHPA 4YMGA 4B5KA 3HEAA 1I3CA 4BCDA 1SELA 4M7RA 4IINA 2R48A 3IALA 2BEQD 2XNDA 1JPNA 4GL2A 4H0NA 3W5CA 1PL5A 1I7SB 4A2QA 1EP9A 2Q3CA 2UYYA 2CZQA 1G20A 5B12A 3AP1A 4C46A 1KPIA 5I7VA 1RWXA 1KOJA 1JILA 1N8RQ 1TT7A 1FVFA 5E2IA 3CU5A 1UAYA 5LP6C 4PCUA 4HNHA 4JEHA 3SNKA 1SR8A 2O9JA 2EGTA 4CG1A 1YS9A 3HP4A 3AF3A 1XVVA 5ALYA 3RF7A 2J6AA 4B3MB 4DCKA 3UMYA 4J6EA 2G7ZA 4G1CA 3RNOA 3DL7A 3L70D 3MUDA 2P9FA 4F45A 1GL6A 3AB3A 4PLWA 2DQZA 4JP1A 3IO5A 4UAGA 6ADHA 2VQEB 1GLNA 1LTJA 2D2XA 3QBJA 1U1DA 4HDSA 5DULA 1XNJA 3QE4A 3IP9A 2QIWA 3TTYA 4FKZA 2IBZG 5AP9A 2UV8A 1D2NA 3SG0A 4UVDA 1SXIA 5KLVJ 1I0ZA 4U3FG 4KXVA 3M4NA 4LOJA 5DWQA 1MOPA 2CNOA 1Q82Q 3PC2A 4YLEA 1RMQA 3RIGA 3F3FC 3VO1A 4ANFA 4V0KA 4JELA 4JY7A 5KC8A 1LQUA 1NI4A 3H1KD 4I7ZB 1XJ0A 4WINA 4NV1A 4F91B 1AV6A 2H1OA 2P9HA 2EDCA 4OQLA 4GOJA 4TL7A 1Z45A 1ZRTE 3AESA 3KZNA 1ZSYA 3O93A 1V16A 2AN9A 4YXWD 2AKYA 4PX9A 3PDIB 5I9NA 4Q05A 5BVZA 3ILXA 2M6NA 1U94A 1XRRA 4F2WA 2UWJE 4B45A 3Q88A 1VQOZ 1KYWA 2C7RA 3S1QI 5IF9A 5HCUA 1PEAA 3ETEA 4G97A 1W36B 4WKCA 3WSVA 2QENA 4I4TB 3JRWA 1E0DA 4O4JA 4L16A 1IK6A 1GKLA 2QZ9A 4GWKA 2ZE8A 3X0DA 2XMDA 1VIMA 1CUAA 2ALJA 3IFUA 4S05A 4MWOA 2BM1A 3IAXA 3P45A 4XEUA 2GEUA 4O5AA 2ZK7A 3KWMA 2V98A 1JDSA 1KYZA 2WG2A 4KBGA 5E2AA 1OSNA 3GUYA 4ZAZA 1O89A 2DF8A 4PLTA 4PLZA 2AV6A 4Q3AA 3RVSA 2P10A 1SFOI 1ENZA 2PNFA 5D1OB 3PUXA 4Z1MA 1GU4A 1TYCA 3PEFA 3G2LA 1L3BA 4RVHA 1R5NA 5GIOE 1U9IC 3VTKA 1UOPA 2YJGA 3RS2A 2WD7A 4HXGA 3RD5A 2ZDHA 3QW2A 2ZIXB 3L7BA 1T1JA 2NUAA 4EA9A 3OZFA 2CVZA 1JG2A 1H6AA 5ALHA 1YJ8A 4L76A 4A3KI 3TPFA 2WB4A 1LEHA 4B6QA 1NQ5A 1KI3A 2VYVA 3ONNA 3JATA 3NHPA 2KLVA 3ET5A 3MHVA 5D84A 4C5BA 2C5HA 2AQIA 2ZM6B 1QVWA 3EUEA 3RYIA 3EQ7A 3JVUA 1BKDR 3F1KA 4DY4A 5J4HA 4B73A 2O01N 3ABVC 1ZRTD 4ZEWA 3WGJA 1GFZA 4W1PA 1FMFA 5HM8A 1QZZA 4KQMA 1JQBA 1N0UA 1QYWA 1VG8A 3A4NA 1NMEA 4I8DA 1JJ7A 3BFVA 1T3SA 4E1BA 4A4DA 4JITA 4JB2A 1S2EA 2Q5CA 1C9MA 3KVRA 1EEXB 2W2KB 3MCWA 3Q15C 2X6RA 2R8XA 4I1RA 4EY5A 5B4UA 1U4NA 2VPPA 2ECKA 3DXFA 5FB3A 3WBKA 4BMVA 2K9YA 4B80A 4NENB 1T6AA 4QGHA 4BS9A 5LU9A 1SHUX 3HXQA 1U7OA 2GUVA 2ZRGA 4BVFA 3WA7A 3QMPA 1HLDA 3WMRA 1PPYA 4BN0A 4I19A 2HJSA 4AQYB 4KPUB 2MINA 2RKWA 1G21E 5FKJA 2UVPA 4DMKA 3SEQA 4ZI7A 2YWCA 4FB4A 1TM1E 2C3YA 3L5KA 1BGXT 1Y9ZA 1OI2A 3E5MA 2YN0A 3AB8A 4GICA 4IFEA 4KQEA 1YI0A 5D3MA 5AQEA 1S3GA 3HV2A 1ZNYA 1U2DA 5AK6A 4EKDA 2ONKA 1I6MA 1KAQA 2H2DA 1ONNA 3HDTA 1PU2A 1FU7A 4YCLA 5EG5A 2KLBA 1J8VA 1OH8A 4GWGA 1UPCA 1V6AA 1C0EA 4IWNA 3RS8A 3UCFA 3GLGA 1DEAA 5HSGA 3AF5A 3T1TA 4UUNA 3RO7A 1T8RA 4O2LA 1P62B 3FYUB 2WSIA 4EA6A 4KXNA 2ZAIA 4AZWA 1IN8A 2VZLA 4BO8A 4PNEA 3OT1A 2C2XA 3TRIA 1IK4A 1IPFA 1OV6A 5ENVA 2OG2A 2G0NA 3GHGB 3FF4A 4MWEA 5FTMA 4BTVA 4C6SA 3C7KA 1KJNA 1C50A 2C9OA 2IHBA 3UEOA 2H2GA 4K6HA 2YYZA 5KYUA 4H44B 5AIAA 3LQKA 3KQQA 3MRSA 4A8JB 3HH8A 5A71A 5CBPB 4JUFA 4GBGA 4RETA 4XGQA 1D6NA 2JAXA 2GHTA 3SIPA 3W2FA 5HQ3B 4P0QB 4HX5A 2NWQA 4JVNA 4O2RA 1SU4A 1QIHA 1X8JA 4UZEA 2ZSHA 4FCWA 3QKSA 1XTKA 5CHEA 4G5RA 3NTXA 3URMA 4I14A 1Q6YA 1RLTA 1BGYG 4JU8A 1IWBB 3EVGA 4KXYA 1S8NA 4A3SA 4KRXA 1DD4A 5FJJA 3VR4H 4FI3F 1DUVG 3JQ8A 3SQXA 3N5CA 1NTKG 5ALRA 5LLSA 1DCMA 3AG5A 3S4YA 1E9DA 4BMSA 2XWQA 2B6HA 5M34A 3CX8A 2QUJA 3U4HA 3DHWC 5AICA 2WPSA 3BMNB 2VXYA 4BFUA 2PT9A 4UU8A 4KBYA 1DIOB 1U9CA 1TVMA 1EHYA 2JCYA 2QLTA 1KFKB 3HDGA 3SICE 2XTNA 2Y68A 2W2XA 4RXMA 2K9JA 4MV5A 3UFXA 5BSRA 2JS7A 2XLCA 5JASA 1COWA 1UDCA 3I0MA 4KSYA 4ZCIA 2BEZF 3CMA1 2ZVDA 3TXAA 1JF8A 1G4UR 2QUBA 4MLPA 4FCCA 2PJHB 3X1YA 4E1VA 3O84A 4AWAA 4UVEA 1RO0A 2WTYA 5DYIA 1JB9A 1U7WA 4XPIB 4KR6A 3EPHA 3SR0A 4QXPA 5BMVB 2XDQA 2O3UA 5H68A 3EHEA 1NU1K 5CJ4A 2P4SA 3MT9A 4IG4A 2G06A 5JCXA 1TJ3A 1PWXA 4F4IA 3FUCA 1T0UA 3NOVA 2OO7A 3CCQ1 4KK3A 2RG7A 1JKXA 1L5QA 1TZMA 3D6JA 2KMLA 2HN9A 1N86A 5LXTB 4BEBA 1C30A 1LFAA 1NDUA 2FSSA 3LFTA 4NABA 1EHCA 5DJ5A 3E03A 2R0QC 2GSWA 2OTJP 3KO8A 2NVOA 2H2AA 2PMEA 3CLSC 4J43A 4CTMA 3QKRA 4B31A 3HJRA 1P0IA 4GFDA 3OY7A 4GPAA 4KU4A 4F3YA 4LEIA 2HNBA 4W8GA 2HJRA 2F3PA 3TIWA 4UU0A 1T35A 1CY7A 4G41A 3AGQA 1DAOA 3HCRA 1T5IA 3AFGA 4PQYA 4KN5A 1GW4A 3HNPA 1ND5A 5H80A 1C3XA 3UGQA 2X5KO 4C5CA 4JXJA 3N2KA 3OWXA 3KKMA 4NYIQ 5LMZA 2AA3A 2HHHB 2VK1A 5CFZA 5F7JA 4TKLA 2CB9A 4IJVA 1T8WA 1ZKMA 4MDEA 5HBGA 5AVYB 2P4UA 4IV8A 1QCYA 1A9ZA 4QRIA 1K8QA 2A9JA 2W37A 4TZ0A 3WSTA 4ZVLA 4IFDK 2YV4A 4E5UA 4WGFA 1JO5A 4A0QA 1T4BA 3F5MA 4PZ0A 3VISA 5WRFA 2AG8A 1RVV1 5AVVB 1VYTA 4DCNA 1JYEA 1ZUNA 1Q862 1WC2A 2UUCB 1YOBA 4UHJA 1VBNA 3SHFA 3M5DA 3V32A 3IPAA 1QVFO 1KI6A 2WMYA 5EIFA 3RREA 1RXSA 2YJ4A 4P4LA 3QX7A 4BB6A 2EGUA 5C9ZA 1OPRA 1QTQA 2BMDA 5HKKD 1IM2A 2VHTA 5LZ2A 4QSHA 4YQYA 3P2YA 2KX7A 4CU2A 2J6IA 2O8DA 4KQWA 1XHEA 4WZAB 4R5HA 3AUXA 4F3TA 3G9QA 2J33A 2W71A 2C4HA 4IIJA 3ABRB 2F7SA 1GDHA 3FPKA 4YONB 3VZBA 2P27A 1SVLA 3SULA 5EAIA 4N0MA 5TMEA 3OLYA 1PJ8A 1IWOA 2PX0A 5AW7B 4GL4A 1Z06A 2B5WA 5I7FA 3R6GA 4N8DA 4Q9DA 1X1DA 2H92A 4DGSA 4U2DA 4WJKB 3ZE9A 3NVDA 2IYLD 2O8FA 3BTVA 4BO5A 1K05A 3BMCA 4H2DA 3LKZA 3QELA 4B34A 5ERXA 4MGKR 2VDNB 2UVDA 1YMQA 3EUFA 5F64A 1I51A 2LV8A 2O20A 1PJQA 3ITDA 3AK4A 5EKDA 4EQZA 1G1IA 3CR3C 1M1XB 3LW8A 4O4LA 4CR6A 1TU0A 1AX9A 1AVOA 1KILE 1ZCFA 1IPEA 3ELBA 4MV4A 2Q3DA 1A88A 3P0HA 1UJ6A 3ER9A 2JP3A 3S1KA 1VSVA 3HB5X 3FCCA 1RBQA 1GTZA 3NBQA 2EZTA 1O8CA 5JRDS 3KUUA 5AOBA 1NATA 1A98A 3PDJA 5TJHA 2OGUA 3CVVA 3LOUA 1MG0A 1OW8A 2D06A 5DOZA 4J7AA 1LV7A 1KJZA 4CVNA 4LI0A 2VP0A 2O0LA 2BFCA 2C7PA 4Z0PA 1M6YA 1EJ6A 3TQTA 4QREA 2IZ1A 1JFVA 3L71E 1CUUA 4DRXB 2IODA 4DCJA 3SU8A 3FDZA 3E3MA 1BE3J 2O5JD 3OM0A 3GJTA 4LXUA 1A4RA 5AQ1A 2IIPA 4C7KA 3CPWO 3LBIA 4ZAXA 4EUNA 2V9PA 2Z0MA 2UKDA 2W6ZA 2CB0A 2Z30A 4DAEA 5MFPA 1XDZA 4XDGA 1PPJE 3MAAC 2BZ1A 3STVA 2TRSB 5E8RA 2J3HA 2FZLA 4ZI5A 2F1RA 2UXDB 3W9UA 1W2WB 4O59O 4LSGA 1PZHA 2IYWA 1I24A 1D07A 3CZCA 4J91A 3AJDA 4NQRA 2QUKA 5FWYB 2ZT9C 3BICA 1H2WA 1SK8A 1CQJB 4JDUA 1KIFA 1BG6A 3LWBA 3D6TB 2Y0EA 5JDCC 2HMWA 1KQSZ 3J80f 1ESEA 1FU4A 4A10A 3S2HI 4MWBA 3IOEA 2E2JI 2WFMA 2WLSA 3ETDA 2H3HA 1YZYA 1EFAA 4ZHQF 2OAEA 5CXSA 3IR5A 1IG3A 3E22A 2XEXA 1FS4A 3THOA 1KILD 4EG7A 3VHQA 2W6QA 1MVOA 3MRXA 3P8ZA 3PQEA 4YJ3A 4E11A 4CKCB 3W1WA 4GT1A 5AVZB 1L4NA 3I2GA 5L6LB 4EATA 1JM0A 4TLDA 4HNSA 1RXWA 2W98A 3GZ4A 4C78A 5TV2A 3P71T 1SHLA 4YBRA 1HKUA 1M90Q 1IG0A 4AQ7A 1GHTA 3T95A 3QYAA 5DNWA 1XYYA 2QJKC 1UBFA 1ZL0A 3BCCG 5A5FA 3AF1A 2VPXA 2F43A 1EGMB 5AOCA 3EGWA 4P98A 3NOQA 3E0QA 1EZVI 1XD8A 5AJWA 3PI7A 1H88A 4IOJA 4JLAA 4R2LA 5BW8A 1HF9A 2VPTA 3I5YA 4H0CA 4W63A 1RE3A 3C7TA 1XA3A 2LBPA 3I5AA 3X2MA 1C7QA 3M6LA 4AKHA 3ZWCA 4EG0A 4ARSA 3L71D 3A1VA 4UJ3A 4CIBA 4Y9TA 3QTTA 2J9YB 1JEJA 1DAKA 3NYRA 4W9NA 3S70A 2H2HA 4O3MA 2IE8A 3TJMA 1G6HA 2N75A 3KOZA 4JVSB 5DTJA 3ZZTA 3CCR1 3ZUGA 2FEPA 4B3FX 4KGVA 2WNSA 2ONZA 1P3DA 4UAUA 1TAUA 1KMQA 1G3QA 1PPJD 2X1LA 1J2RA 1IOZA 3KVOA 1T5SA 3EOZA 3HBLA 3KCQA 4HX2A 1ZINA 5FPYA 2QLVB 3OIDA 3MWEB 3WDKA 1QBKC 1HQYE 5JXGA 1HH4A 5EZYF 1F8FA 4K9OA 4HDRA 2XTMA 3EVZA 4C4SA 2CHUA 1HTWA 1OLOA 1OCEA 1DWUA 5FWXA 4B3DA 2QAIA 4YMTA 5AUOB 2VYQA 4RTQA 1U2PA 4JJZA 3CX6A 1QU2A 1XTCC 5A6SA 3IAHA 1MA3A 4CM4A 2X4DA 5B4VA 4RABA 2G40A 1YJAA 3VO9A 1QHYA 3NHUA 2NO1A 4PANA 3HCFA 2GTIA 4FDVA 2EHJA 3V4WA 3DNMA 4L4RA 2FG5A 3OJEA 5I4KA 3HADA 3M6UA 4P83A 2NPIA 4C22A 4YP6A 5D3ZA 5KKZB 1RYZA 1NVEA 1J2TA 3ISTA 2ZWMA 4GI7A 4IIFA 5THQA 3S40A 2G9UA 4QVGA 2HA5A 5BRAA 3EUWA 3BIFA 4QECA 4IAOA 2B99A 5C0OE 1WCYA 1G8YA 1QX4A 3UJPA 3O90A 3DAPA 3RSOA 1LXCA 3GTGI 1XZIA 3QQ7A 1LQTA 1OGYA 4INOA 1L7BA 2X76A 4RE5A 5DO9A 4AMUA 1BXRB 1Z02A 3EWAA 2RHHA 3GFTA 3SXJA 4DCCA 1YITP 1EK0A 5LP6F 3QE0A 4RPLA 1IJFA 3UKJA 2QYTA 2AJBA 4N0DA 5DYWA 2NG1A 1UIMA 2E76B 3O94A 1L7RA 4FJ2A 1MCZA 3RAPR 3GTKA 1W5SA 3GTQA 3QG1A 2G70A 2EBWA 1U28C 1KAMA 2OQ2A 2PQMA 4LG1A 3BJRA 3RQSA 5ESRA 4RHCA 1VQ5Z 4D4LA 2FR8A 1CZNA 2WNHA 3NH5A 3BTSA 3IEPA 5JNVA 5C81A 4C2AA 3VC1A 3OPYB 5L8VA 2HIHA 3C39A 3A0HE 2FFDA 1E60A 1PG5A 4U02A 1TXGA 3UVEA 3LLCA 3JWPA 2H5IA 2VEDA 4JXXA 5HQTA 4BBZA 3K5IA 2D0IA 1TO1E 3ND5A 3C4QA 1I7PA 4UTPA 4LNHA 1ZN7A 3E58A 1EWTA 3TFQA 1TMKA 2A0UA 3L4BA 1ZONA 5MN4A 2DWPA 1V3VA 1FJGB 1ZXXA 3T1NA 1M73E 3OZUA 5AH0A 1SKMA 4B4WA 2X5XA 2JIRA 4D6XA 3OZVA 1KKLA 1AZWA 2NSLA 1T3JA 3IYLW 3VAZA 4KLNA 1QVGZ 1ZR4A 4C4XA 1RP7A 4AURA 2GCGA 3DKPA 2DQKA 3CCEZ 4LW8A 1P60A 4NARA 3X1WA 5K01A 5SY9A 5GTHE 3HB4X 1YCFA 5G2OA 4B6FA 1EE9A 4BAUA 3AHFA 1WDMA 1MFTA 1N8SA 1PI3A 2X7JA 2VDWB 4RVFA 4KDIA 4L0CA 3NRBA 1GCIA 2QOEA 3H1LG 2C61A 5CLFA 1HORA 3PNBA 4TVSA 5LQUA 3IUEA 4AX8A 3WLSA 3HD7A 3ZGNA 1OHHD 4BGDA 1MORA 5I45A 1M1YA 1WCMA 2H4FA 2ZAYA 4PHTA 1ZGBA 1TU3A 1RRPA 1HG0A 4NU8X 2G25A 1K3FA 1S3JA 5JY1A 4JP6A 2IC5A 5KINB 1X77A 2BH9A 2VDPB 1R3UA 1V45E 4E30A 3GPDG 4NBKA 1VMIA 1CUHA 1VPEA 1NM5C 5BY2A 1E3EA 3FW1A 3K9HA 3ZWOA 1VLLA 1QPGA 1C1XA 2IELA 3H0KA 3BGVA 4ZO9A 1WHTA 4GMFA 5ECGC 5HDBB 4OD0A 5JXJA 3DBLA 4K9LA 5CH3A 2ZI5A 2HI0A 4TS1A 3JYQA 3MOIA 4TKUA 5BUSA 5JRJA 5IKEA 2BM9A 4ZKEA 4DBLE 1UMDB 1IVYA 4EMUA 1TVKB 1G6KA 3PUIA 1O2DA 4D3SA 3M3GA 3GELA 1VJCA 2CYAA 3HLKA 4OLFA 2P6OA 1KYIA 1Z16A 5DB4A 1V8ZA 4G89A 3L5OA 4Y6LA 1Y6FA 1DTSA 2HBYA 1PUJA 3JASB 3HJGA 2VR1A 4HQOA 3BXFA 1AQUA 1MRSA 4KHPB 3JCZA 1BDCA 1GCOA 2CVPA 1ZESA 1FZCC 3U7HB 1VRVA 1QIEA 1GL2C 3UPUA 4FZ3A 5CTJA 5JZVA 1PJRA 1SC1A 5KAPA 4WN9B 2OK7A 1PSDA 4FOPA 2GAFA 5ES3A 3LYLA 2XUHA 1ISJA 4EJFA 1VQ9Z 2V3CC 5FDFA 2X2EA 2A9FA 1G5RA 4E5KA 3P0JA 1GD1O 3HQ4O 2W6OA 3FNQA 2VTBB 1PW7A 3Q87B 1K5DA 3CCV1 2G5GX 1OMIA 3OW2O 1W9HA 1G7SA 4H4EA 3FSGA 1OIVA 3KSRA 3TG2A 4D80A 4LOIA 3GA5A 4GF5A 3M2PA 4E6EA 2WJJA 2M0BA 3CIFA 5E4TA 2HU5A 4M4SA 1FP4B 1ZMOA 2R8ZA 5GTHH 1EK6A 1SB9A 3RTDA 4FHFA 3PG5A 3L7AA 2VHEA 1J09A 2P3LA 3NGXA 3AE1C 2VYNA 3WGMA 1ORRA 5JWRA 3OLWA 1XXLA 3QXGA 1HJBA 5IDWA 3NWEA 1T4CB 2J09A 1K7SN 1LDEA 2AR9A 2Y1DA 3U4GA 1MTZA 5CEJA 4Q1VA 3WWEA 3ZX4A 2B4YA 2AKAB 2O8EB 1E1YA 4TT8A 4TRMA 1NZDA 1PZQA 3O95A 2E48A 1G20E 1IEQA 5DLDA 3D0OA 4CE6A 1NAHA 2B2CA 3ZNPA 4OFWA 3PFFA 2RBEA 3JC22 5KLVE 4DSTA 4E5NA 1I2BA 3NYQA 2XNCA 5DP1A 4GI1A 4IW3B 1ZW6A 1KRHA 1PWYE 2WVAA 2YXEA 1RYNA 3WLEA 4A3LI 4FS8A 3I1YA 3WJ7A 5HZHA 2W6IA 3RS3A 3RIXA 4YRQA 1W0JA 2JGDB 4TKVB 2MSWA 1V3TA 2A92A 1ZD5A 3I9KA 4RKYA 2BSQA 5JC1A 1OXZA 4QBTA 3PD0A 2V8KA 1X7DA 2P5UA 4PV7A 2ZBFA 4NCXA 4H59A 4HGRA 1UMBA 3R5SA 5LZ4A 1A3CA 2CLCX 1Z01A 2EFJA 3UAYA 1X80A 1Z7BA 1XZJA 5KTOA 2I65A 5T67A 3DE4X 4Y1RB 5IAAA 3DLPX 3LCUA 3MGCA 3CD61 4C06A 1JFRA 2VDUE 4L48A 5KCMA 3TYXA 4ZCTA 5LQRA 1MA0A 2WD9A 1FMCA 3H2SA 2ILTA 3HVJA 2AWNA 3P9SA 3OTOB 2DFKB 1UXOA 4WEOA 2VK4A 5EHIA 1W0KA 5CVDA 1U02A 3GTJA 2XKAA 3TDMA 3BE4A 4X6XA 4XVRA 2WPNA 2XKBA 2AR7A 2GPSA 3TPCA 4EA7A 5KNCH 4RAOA 2FW1A 3NHJA 1W1IA 3VUFA 4PZCA 1Z0SA 1KYOI 1Q19A 2XNDD 4JP2A 1TEXA 1JQDA 2D2FA 1X2EA 4JEUA 4OUDA 1UT6A 4N49A 1OT5A 1HL3A 1GARA 1GTWA 2H29A 4B4KA 4QNRA 4FGSA 4ZU6X 4FTWA 2I7VA 5KLVD 1FZEA 4A0HA 1SFCC 2BGJA 2VJCA 1QYDA 1GQQA 2AJLI 2VUHB 3DUFA 2XE4A 1EX1A 3QEKA 1Z47A 1Y89A 2E1PA 3WFZA 4M3NA 3BE6A 1QRAA 3LI2A 1B0UA 1W5BA 3GD7A 2P0AA 1U8AA 4KMOA 4U3JA 1BKYA 2IIQA 4PVDA 5H82A 3KZMA 1SQBE 5F9HA 3OLQA 2BSXA 4B4OA 1T5DX 4JVOA 1GGVA 1Y8ZA 1ZN9A 2QJPC 1C1DA 4HXYA 4IILA 2IPOA 2MSCB 1ZW0A 3N70A 4OJQA 4PV1B 2GKGA 2QE6A 2AOTB 4ZZ1A 4LQCA 3B6ZA 4N3CA 5G4KB 2JG3A 4QFDA 2XT9A 1ZH2A 4AN0A 5HNKA 4G84A 2YXPX 3KLNA 1F06A 5K0SA 1TX4B 2YNMA 1BCRA 2VDOB 4URWR 3GK3A 2RONA 1NXPA 1HWYA 2WVGA 4JMLA 3MVEA 1SQ5A 2QVLA 1SUAA 3HOXI 5B3LA 1E4OA 2V1UA 2D2CB 1MX9A 2YY7A 4ZCSA 3ST7A 3ZNQA 3C6QA 3CCSP 4MKRA 1GZLA 1N2ZA 2W90A 4WY4B 2R65A 1QHGA 3KT0A 1DI0A 5F76A 3T4EA 2HFKA 2YWBA 3KT3A 4RPJA 1NQWA 5KJ6A 3N7TA 4OHZA 3A9VA 4W5WA 1P61B 3H1PA 4KAAA 3ZLJA 3U17A 3MFYA 1NFRA 1NSTA 2A57A 3V4QA 5LMUB 3ZGZA 3L75J 2XBUA 5AJYA 1J20A 3K05A 1HNNA 4R2JA 4ZOLA 4DV6B 1Y3HA 3QLVC 1DIPA 3IHLA 4S1VA 5JCZA 3WUTA 4L2IA 1ZLYA 4A3II 5DGIA 4LYYA 1EGAA 4WLVA 1TF7A 4E1AA 1PBTA 1VJ0A 2EKDA 3J81k 4HVCA 4Z1MD 2ZIFA 3SIXA 3ZU5A 1SQBD 4FJ0A 2JLSA 1OVRA 2ZSKA 2VT7A 5DXJA 3PHLA 1LZLA 5HOQA 1J5XA 2PL3A 1PKXA 1FLAA 1THTA 1CIVA 5BSUA 2DUUA 1KOLA 3VJMA 2B63A 1R8YA 3D6VA 3L0CA 4B1FA 3GLGE 2GN9A 3FWLA 2NUBA 2QPTA 4LC0A 4OOEA 1G8FA 4FFBB 3Q6MA 3LJKA 3IQIX 1NW9B 4CLDA 2OHFA 5DV9A 5AXBA 4KQJA 2FWNA 4A6XA 1THGA 4OHRA 1WR8A 2DLNA 4UCXA 4PD4H 1CTQA 3M1LA 2JJQA 3A4TA 4CTOA 1ODFA 1R64A 3ZS9A 1NRWA 4ZVUA 1Z4QA 2FE4A 1V8OA 3UT5A 1W8IA 5EL0A 5FJIA 4GSYA 4LJ8A 3LA8A 3KFVA 1W5AA 4QYWA 3HG7A 5AI5A 1XQ1A 1FFYA 2NX2A 4N7BA 4MI6A 1NVVR 3NAQA 3L07A 4YP5A 2Z2YA 4PZAA 1M57D 1M5RA 1TW3A 1JXQA 4BPBA 1SBTA 4NPHA 4UW9A 1GPDG 3H18A 3EPRA 1ISIA 5A9SB 5HFJA 5HUHA 5EWMA 1IHYA 2F4VB 4JB8A 1VI6A 3QF4A 2C5SA 1E5DA 4KDCA 3LF1A 3D4LA 5M2QA 1TEVA