4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
4FG2A 3CZBA 4JP6A 3X2LA 1BW3A 1WHPA 3ENGA 3SUKA 2AE0X 3SUMA 2JNZA 3FT1A 2PI8A 3X2KA 3D30A 4FG4A 3FT9A 3X2OA 1BMWA 2HCZX 1L8FA 1BW4A 5GM9A 3X2IA 1OA9A 2PICA 5GLYA 4FFTA 2GAEA 4FERA 5GLXA 4JCWA 2BH0A 4L48A 3SUJA 4AVRA 2KQAA 4JS7A 3SULA 2G5DA 4ENGA 3M3GA 1HD5A 3X2GA 3X2MA 2PJJA 4JJOA 4ZM7A 3X2JA 3X2HA 3X2NA 2PNWA 2ENGA 1WC2A 3X2PA 2G6GA 5H4UA 1WHOA 2VXQA 1N10A 1OA7A 4JP7A
chains in the Genus database with same CATH superfamily
1U8OA 4HIJA 1BEYL 1Q94B 5DYIA 3VRIA 3GWJA 3LHAA 1MFMA 2NUPA 2R92A 4GQ9L 2E7HA 4XPFL 4EUPG 3MC0A 4PWIA 4X9IA 5C9KA 4I7ZC 5I6XC 4KZEH 2N1TE 3QQ9D 2IDFA 5F7EL 5HBBA 5DMIL 1F13A 3KJ6L 1GSMA 5GRYA 4JY6B 3CFJA 4YHZH 2YD8A 3CZFA 3U83A 1K4DB 3EYOA 4YHMH 1PFCA 1VFAA 4AQEB 4YHKH 5F89A 2VC2H 5HHOB 1AOZA 5IMMA 3V6ZB 1MRDH 2B1HH 4K71C 1S7WB 3S5ZA 4UT6H 1CDYA 4U6HB 4MXVE 5C0IB 2YD4A 1HIML 2A1WL 2FQFA 3IN0A 4LEOA 1P1VA 3NCJH 1WZMA 4I3RL 5D2LF 4ZUSB 3M86A 3AG2B 2MRYA 2QDVA 1HZLA 2VUKA 4L1SA 1EZLA 2OM5A 3MXWH 1I3RB 3CQFA 2QGEA 3U9PL 4AV4A 5FYLE 4YS4A 5D1ZD 1W72L 1VEMA 1JMZA 2LU5A 5B6CA 3FSZA 5GSVA 4JG1H 4WHDA 4U1GC 1G87A 4PJHF 1K6QH 4QKTA 3L1EA 1UTDA 4KVNH 2QLVB 1PLAA 3MRBA 1T6WA 3UPCA 4XHJD 5FYJH 2DQHL 1E27B 3LRGA 1YNTA 4OSUL 2ED8A 4HMCA 1DUYB 2VYRE 4TSAH 3L7EB 4N1CA 5C0AE 4YHPA 3IGKA 2YPKA 3B83A 4PCYA 5DJZA 4C58B 4HEPG 3CVIH 1MHHB 1MUJA 1I7UA 1E4XI 3WL9A 5FB8A 2B08A 2UZYB 2WY3B 1MPAH 3IDYB 1FH5L 1CG9A 5IBUG 3UPAA 1MCEA 3W56A 4Y1AE 3UGUA 1TZGH 3ASWA 5EIIG 4ZI8A 3GUTB 1L7IH 4XCCL 3MBWA 5CN2A 2Z7WA 4WO4B 5AFAA 5G4NA 3UTTB 3UZQB 1IC0A 2UZIL 5FO8A 3I3DA 4WHYG 5DO2C 3CSFA 3K7UA 3O3AB 4Y9FA 4FQPA 5GGVY 4WKZA 1EHKB 1GGBL 1DEDA 2LFGA 2HX9A 1LO0H 3ATDA 3ENEA 3AITA 3CH1B 2M26A 1U8MB 3OLIA 1BXVA 2ARWA 4HWUA 1M71B 5FOBB 2EDYA 5BV7B 1GA2A 5DTFB 1I31A 5I1EH 4ALAL 1AZVA 5I26A 3ARFC 3CMGA 4DKTA 4FERA 2VDQB 3CVDA 3MROA 1OM9A 1U33A 1A1NA 4JDEB 1DJZA 5LJYH 3FQNA 5IWLA 2N7SA 1YDPA 3EH5B 3MLXL 3JYBA 2YAQA 4P9ML 2AV7A 2JTYA 3PPEA 4HFUL 4PGJA 3ZRSA 3N0PB 1GL4B 5ELIA 5FYLH 1AO7E 1DN0B 3O6LL 2E6JA 2VUYA 1D6VL 3WIFA 3IVKB 5L9DH 2QADD 1PX8A 1XH1A 2G9KA 4GRMB 4U1MA 2KBGA 4AGMA 4NO5B 1E43A 5E1IA 1KCVL 3A24A 4XE0A 4Z3FA 2VDLL 2Z35A 1UATA 1CBVH 5EDSA 3RNQB 3REVB 4DOHE 5BQ7B 5CR1A 1UYWH 1NIBA 2FX8L 1AIFA 1MJJB 2NVXA 1K8IB 3WIHA 2EE3A 4WNQA 4RWYL 1G9EA 5CN1A 2BFVL 5TD4A 3UEQA 3TIDB 4KGLA 2IDTA 4GXVH 4XVJL 1GSKA 2EEBA 4TULH 5F93C 5MP6L 5DHVH 3ULVE 3LZQA 4IIQB 1H0DB 3P11L 4K9EC 3L3JB 5AEAA 2VRKA 2YSSA 4NRZA 2DWEA 3FU5A 4XNZB 2HRHA 4R4BB 5A3ID 1AGCB 3MBEB 1WIUA 3IDGA 5D7LB 1FZKB 1L7TH 3QJHB 1SOKA 3G9VA 4HC1L 1OCZB 3OKMA 4HPHA 1CFTB 1R7RA 2MH4A 3WXWL 2XA8L 1J0HA 4I0PA 4ZXBA 1V7MH 3NSJA 3MA9L 4RZKA 3DRQA 3KPNB 3KS0H 1IBGL 1EAPA 5ABZA 2DYRB 2R4SL 2L7EA 2VTFA 2NYAA 1ETZB 1LQBC 5B3NA 4I89A 4X7FC 2D9QB 1U21A 1WTLA 3HC4L 4JY4A 4NQDA 3RDTA 1PU0A 3SE4A 2AJYL 3A6BH 5C0CE 3GBDA 1UXWA 1DQTA 3DTUB 2NQ3A 1OP4A 1WZAA 3H3BC 1EXUB 4WFGD 1MG2C 2AEWA 2J1WA 5BMFL 1AC0A 3FCBA 5KJRH 5HJGA 1CQYA 4QY8B 2B5IB 3EYFA 3FCSB 2IBZY 4U7KA 3VUAA 2PO6A 2EILB 4RESB 4PBDA 5M94B 5EPMB 1OP9A 3BPLB 3IXAB 3MRGA 1F58L 2GT9A 2YIHA 3CDFA 4ZUWA 4R3SA 1WAEA 2AMUA 2VR7A 2YD7A 1B4RA 3D09A 5I5JA 3WAKA 1VC3B 4QXGL 1EGJL 4IRSA 5KWYC 2X38A 3NJLA 1FNSL 4DGUA 3TIEA 5CIPB 1XZ0A 2BS8A 4GW4B 5DJDA 4A1RA 3KPQB 4Q97A 4BFJA 2ZG1A 1F3RB 4Z7OE 4M3HA 5D7IE 4I2XB 4QRSB 3GSWA 4JO1L 2UWEE 4R97B 1ORSA 2WZAA 1RY7B 4HHGA 5DZVA 3ULVH 3VFUB 2ZX6A 1P7QA 4NYLB 4TNVF 4UT6A 5CZXD 3FL7A 4PTUA 4NWUH 2P5EA 3WTSA 1FQ9C 5E1QA 4M7JL 3VRJA 5ADOH 5I0WA 4R90L 2VDRL 4P2QE 4FQ2H 1E60A 1R5WB 3FB5B 5IGXH 4ZPTB 4U1SB 2Q7YA 2P5WA 3O45B 3V10A 3PWLA 5D7HA 3HZVA 3QQXA 4RGNC 4WGVB 5JXEC 2FUQA 4OAWB 5C0EB 4LL1A 4YXLL 5EEYA 1A1MB 2GK2A 3FQWA 4PJ7E 3QRGH 3FJTA 2BIMA 3PABA 3V0VB 4FADA 3PWJB 2X6VA 4ZM7A 1E8WA 3FTWA 2Q10A 2OMWB 2DM7A 3NZ8B 1CFNA 3X14A 4HAKA 5EU5B 4IEFA 2DM4A 3P9MA 1DDTA 3GEWB 3MUY1 4LKXA 4UDTB 1BLNA 1BM7A 4LRNL 3M1CA 2Q3AA 5DK2A 2J55A 4Y88A 4RAUB 4I5BA 3SOBH 1K8DB 1T4KB 4KKAC 2EEDA 1ZVSA 2Q0ZX 3LEXB 1GPOH 5DD0L 5I5RA 3D39B 5JHAA 1ASPA 3QZNA 5J9PB 1MCOH 3BAIA 2IMMA 3PDOA 4PUBL 1A6VL 3K91A 2A6ED 1DVFA 4KKPA 3VWJC 1KN2H 2R29L 2Q2LA 1W80A 2FEDD 2JSFA 4IOSA 3BP6B 4YSTA 2P3YA 2VXUL 3PDGA 3ZK0A 3KPRD 3LX9A 5C3TA 2GCYB 1KXVC 1WK0A 1NDGA 4PJGE 1BW3A 1DMRA 5DC0A 5AKVA 3ULUH 4BFOA 4DZBB 1YJDC 1YUKB 3FK3A 1CZ4A 3KR3H 3RU8L 1KTLB 1FBIL 3QULA 4XVSH 1HCVA 3FAXA 4UMSA 2YQGA 1HX0A 4JMXA 4HLEA 1LNUB 4CUCA 1SOXA 5C0FB 3HZMA 4MMXA 1G6VK 2DIAA 4ZOEA 2ICEC 3US9A 4FD0A 1X3DA 5D6DC 3BQUD 3P3YA 1GXEA 4L05A 2Y3NA 1DCLA 4NQSA 2Q7YB 5CFHA 4Z8FL 3HHRB 2Y1ZA 5T5FH 3TASA 2QSCL 4HUWB 3N06B 2VLMD 3V7AG 3K72A 2ZD0A 3HN3A 3BE1L 4K2UH 2DQUL 1RP8A 3TT3L 3S48A 5GS0L 1XXDC 2YO3A 3RVVD 3LV3A 2A83B 4OIIH 4Y4KB 1NM4A 3ETBF 4OY9A 1ZTMA 3CBJB 2KDYA 1M2OA 1SEBA 2ADFH 4X99B 5FO7B 4AQ1A 4P05A 2ZOKB 4NI6A 2BSSB 2EAEA 2FWUA 2XN9E 1M3IA 3BIKB 3DO3A 1Y6MR 5LBVA 4AL8L 4E0RB 3Q13A 5DWPA 2UXTA 2X4PA 4X6CB 1WA1X 5DHVA 1EVUA 1FDIA 4PCTA 5E2VL 5C0AA 1JZ2A 2I9TB 2IANB 2VABB 5HHVH 4LFHG 4H5SB 1KB5L 3SGDH 4TNGA 3FYIB 1PL3A 2GQHA 1JGLH 1P5UA 4HW6A 5BOZG 4KO9A 4F58L 1XIWA 5AWNL 1TU2A 4N2MA 4FKHA 1GZPB 1RPQA 1M53A 4OFVA 1WIOA 4WUUE 4Y1AA 3VD5A 2V45A 1HS6A 2OYLA 3HFFA 3TWCH 2MQCA 2IVFC 4U3SA 4UQ9A 3L3DA 5HGHA 2F1AA 1G7QB 3QUGA 4LL9A 5AW0B 3KPOA 4OF5A 1J8HA 1P0SE 1P5VB 3BD4A 3LS4L 1S7QB 3THML 4UI2A 1B2YA 4MQ7A 3S5LG 1W72B 3P3UA 4AUYA 3PGDB 5DJAB 4PJFF 3S36H 4G5ZL 5B4MD 4GUPB 2PR9A 1HXYB 4LDOB 3WS3B 4BM7A 1EVTC 3AY2A 3QQNA 3H7BA 3OKKA 4KXDA 3UYRL 1N9PA 2ZJSH 2KI6A 2XFXB 4LSTH 5KANI 4IOIB 1EEYA 1U2YA 1UD5A 4NQVA 2X4SA 4J4PD 4PTTB 1P6FA 4JVUA 1F86A 5INDA 2AS5M 5H4UA 2FGWH 2DQJL 1T22A 4OGXH 2IBGA 1AR1B 3IJHB 3G5XA 3VG9B 3IDUA 4GKSB 1WYJA 3MJ7A 3JWNG 3O3EB 4BDVB 4N2LA 2NX5D 2NLJA 4F27A 4HZLA 3WKYA 1ZV9A 1NJ9A 1MVFA 2XKUA 4PRPB 2BY2A 1AO7A 5TGBB 4TUOA 2VQ1A 4JM2A 4KU1A 4HBCL 5GS1C 4JFPA 4P4KC 4JFFB 1PT1A 4JFDE 1AR2A 2EEFA 4JFHE 3RY6A 1IGFH 3K3QA 4XPGH 1U91B 2D7MA 3K5SA 4X6EB 1ZC1A 1HDMA 3AVEA 4YHIB 3T8VA 4EAEA 3CFKA 1CL7H 2R9HD 1UH2A 3G5ZB 3UPRA 1ACZA 4JPIA 1JFHA 1CT8B 5B8CB 4YHLH 3O11B 3P40A 3ECUA 2AABL 1IU1A 3NSXA 2DQDL 4O02A 5TE6L 3WD5L 2AQPA 3QRFM 2R8SH 4KNQA 1NLBH 5CZKA 1RIVH 4GXUN 4ANWA 4BQCA 3AMLA 3FO1B 4NQCB 1CGVA 2EDNA 5DHEA 1FGNH 1IQWL 4NBYB 3M8OH 3PXHA 4QHUB 4UDUA 3WHE0 5J12B 3TVMA 2R2EB 5IJKA 3A23A 3SE6A 3SDCA 2OMVA 2G75B 2WLIA 2FRGP 1AXSA 2UYLB 3DOIA 1X5HA 5L2KD 1SN5A 2ESVB 1CGXA 2VN6A 5C6PB 3A4EA 5FM8A 2WOBA 4MWFB 1X5XA 2HFFA 2YPVL 2TSAA 5B38B 2CDEB 3WFDH 1EHLH 4NO2A 1KBVA 3QUYD 4JO3H 1DQIA 5DZJA 5EC2A 1AHWA 4KROB 5JOFB 4B96A 3GUFA 3ZGHA 2VDLB 2F1BA 3VXQB 5J13C 3FFCD 5CINH 1RZQA 2EYSB 5I15H 1IGIH 1IAII 4MJJA 1GMEA 4Y5XB 4YDVB 1QO3A 2V8LA 1I3GL 3P3SA 5C0CA 4NSKB 1MCWW 3KBFA 5E08L 1TO5A 2XWTB 1NANI 3FF8A 1E2ZA 4GAYA 3BAYA 3EYSL 5KBMA 3VWKD 5TH2B 2BOLA 4N2NA 1UWGL 5IT2H 1IGML 4HGWA 1Z5YD 4U6VL 1RIHH 1C08B 1UC6A 3CHOA 5E2UL 3NJIA 4CA4A 3X2OA 1ZE3C 4KK6D 1U93A 4OM0L 2FYYB 3PE9A 1E5BA 2P45B 2B2XH 2XU9A 4I0PC 2V7HB 1Y1WA 4JHWL 4ZXBC 3QI9B 2PW1A 1W6LA 2FDBP 3ZSSA 2VLLA 4EN3A 4GFXA 3SULA 4ELMF 3ECVA 4YVNA 2DMRA 2WTRA 4HP5A 1DANU 5TK4A 5I16B 2GK0A 1T2JA 3RPIA 2YAHA 1KPUA 5I1DA 1QFHA 2EDFA 4U6XA 1FDLL 5EBGA 5FUOH 4LP8A 1VERA 2Y2YA 4YAQA 1N5AB 1U8KA 4XBEL 3L3KA 5D7IA 1QMUA 3C6SA 4KGJA 1RZGB 3RDTC 3SE4C 3KYKH 3BFWA 2UWEA 1BW8A 2CRIA 3QG6B 3QQ3A 4XTRD 3NVQA 3RI5K 4NNYA 1CDBA 3W2DL 5IHZB 4CN4A 3NJMA 1LO2H 3OLEA 4WW2B 1IC1A 2QPFA 3CLFH 2P7TA 2PO6C 5DVNA 3I50L 4FYRA 3RZWA 4U3HA 1E42A 1AI1L 4U1LB 3MLZH 4B7IA 5HVWA 4P2QA 1YQVL 1DLHA 1JTTA 2Y7OA 3WFHA 1A6WH 4AQAA 3TH2T 2M8XA 2Y06L 5T5FA 1OAKH 1NPJA 2WVSA 1JPTL 5EU7E 3SDDA 3IAQA 4FLHA 4K94H 2H1XA 4L9DA 1AGDA 1QABA 2WXNA 3FAWA 4IKKA 4IRSC 4OLWL 4WJ5B 3PHAA 1UD6A 3BKMH 2ZCHL 4JFXB 3O9WC 1JRHL 2R59A 4PJ7A 2AQNA 3EJUA 2K8MA 1UVQB 4WHTA 3UABA 5AVZB 3QH3A 1JNLL 3J27A 1RZJH 4FQCH 4EEEA 4EDWH 4F9PA 3ZT5A 4KKNA 3DX7B 2WNGA 4OD3H 5SV4A 4ZS7H 4D94A 3II2A 1R4XA 2IGLA 4UOZA 4JM4L 2Q8AH 2NT0A 2X9ZA 3NJVA 1A7BA 3SGEI 2YXFA 4UOW0 1BM3L 4OKVB 2BY3A 1LK3L 1MNUH 2CALA 5F6IB 2O5NA 1SEQL 4UQ2B 3GJEA 4N0UB 2YJLA 4XNMB 3QJQB 2W07A 1A64A 2H26B 3M1BB 4QAWA 3MKKA 1SLXA 2GUYA 4AIZB 4P5TD 4U0RB 3JUYA 3HZKA 4BZYA 2CPUA 3GHPA 3AG1B 3GIVB 4JDTL 2FJGA 4HK0B 2NUTA 3T3PE 4OJFL 1RJLA 2MTAA 2CIIA 2VO8A 3BQVA 3KDPB 4OZIF 4LSQH 5GLXA 3F83A 4FLRA 1IT9L 4RWHA 1P7HL 1HWGB 1XR9A 4PJGA 4OD1H 5L4FA 5GGVH 3WIIH 1E67A 1I8AA 2C9PA 3RAJH 5T1MA 1SXZA 4CILA 3OAYH 1O9WA 4PRBA 2WVVA 4WI3A 3W0WB 1SNRA 4G7QB 3PWNA 4PLKD 1AANA 3VXUD 5E7BA 2YUZA 4UTBL 4OT1H 4WEUD 2V37A 2P48B 3LH8A 4G7SB 3O4LE 1UA6H 2J73A 3HPLA 2R0ZH 2JA6A 3IM1A 3ZW3A 4FA7B 5K1NA 3CSTA 2NY4B 5DS2A 4DAGH 2JIXA 3F7RA 5LAPA 2XQYK 1CFMA 3LSOB 1DVFC 4XAWL 4HPYH 3MXVH 2WLZA 3O2VH 1NMBH 1H9VA 3LB6C 2LE9A 5I18H 5D1XB 1YC8A 2BS71 1RVFH 5GGSY 4IRZH 5H35B 4N8VB 1JPSH 4OZGE 1TTGA 4JW3A 3V5DB 1TIUA 3MUHL 3D30A 4UM8A 1A4JB 5IHBA 3WFCL 4J3OG 4BWUA 2HFEA 3FUMA 3VD3A 1XB3A 4I77H 4XPTL 3AS1A 4OB5L 2QQKL 5K9QI 1RK1A 5DZPA 4MMXC 2P9RA 2XN9A 4FZEL 5DVLA 1E4KC 5KVFE 3I85A 3LQZB 1T0MA 2DQIH 4X6BA 3VYPA 5F1NB 2CG9X 2QEJA 4LDCA 3S88L 2Y1AA 4TQ8A 1TTAA 4EZKA 5KYXB 1P4BH 1LMKA 5LUMA 1PQHA 3JZ7A 3ZDXF 2WLLA 2AGJH 5DZAA 4RX4A 3U1SL 2FQGA 2EH8L 4Z3JA 5KYUA 4KKQA 4XWGH 4FMFA 5I76A 5J56B 3V9FA 5GGRB 5HJDA 1UKQA 1GYCA 4WUUA 4FFYH 4XMKH 1AGEA 1Q90A 1XGZA 1MHEB 4L9LC 2BSED 1FVEB 2DLFL 3O0RH 1LWHA 3MV9D 1JN6A 5IQ9A 2YAEA 3OAZH 1XGRB 3VXNB 1MFEL 3IJYB 2AXJA 3QUXC 4X5PA 5CSGA 4AQ1C 3FRUA 4ZPVA 3N1QC 4JRYD 1TEFA 4F8NA 4OCSL 5EIQA 1MCDA 3L4ZA 3DUSA 5E5RB 5HD8C 4Y4FA 3AC0A 1IAMA 3OGCA 1ND0A 4A2FA 3QDJD 1C5BL 4G8FA 3EJZD 4TVPE 2G3NA 3HA0A 3S0PA 2BP0B 3L3OA 2ZKYA 3FULA 2CLVA 1P5UC 5ESQB 4ZQKA 3ZL2A 3P69A 3ARED 1I82A 4HWEH 3K1DA 3QO1A 4GSUA 4M61B 2ZUVA 4G1MA 1QVOA 1RHHB 1IAOB 1KB5B 1N59A 1E30A 3AACA 3S37X 4PREA 1R5VB 2HT4C 5F3HA 5ID1B 4KHTL 1JI1A 4U3XA 6PCYA 4YSAA 1TWCA 2YN5A 1BFTA 4I48B 2R51A 1T04A 4M6NH 1JD9A 2ZNWA 2ZSVB 4AVKA 2R56H 3CZJA 4JFDA 4KO8A 1HCYA 2DQFA 5TTRA 3ESOA 4MJ5B 3REWB 5FM5M 3MMEB 4P07A 5IBLD 3VH8G 2VW7A 1EXHA 4LSVL 3AROA 1HH9B 2OW6A 2KHAA 3GBEA 3X11B 4OLZL 1H8NA 5KVFH 5IJVA 2V2WB 4QRRE 3MBXH 1IC4H 1MHPL 5IQOA 4CADA 2VE6B 4JGMA 2RACA 3RIAK 3PQYB 2O5XL 3R0NA 1NUFA 2G2RB 2H2PC 4GKZB 4YHYC 4KOBA 3KCPB 3VCLA 3BX7C 1DUZB 1N19A 3D0LB 3QFJE 1XH2A 1WBZB 4MJHA 1RZKL 2B1OA 4PJFB 2OZ4A 3NFNB 3ZE2F 4M48H 1VACA 4L3CB 3LNDA 4QTIH 4JM2C 1T1WB 4L3ED 3QORD 1SJHB 3RY6C 3ES6A 2WTOA 4MHHI 3SKMA 3U6RA 3BXNA 3LD8B 4FG0A 4OQTL 2X6AA 4KNUA 5AKRA 1ES0B 3T04D 1HNYA 2C9RA 3BP4B 2H0PA 3IDMB 1QHOA 3ULVC 3S3CB 1FG9C 5AVSB 2EXWD 1D9KC 4LLUA 1EDYA 3C8KA 1KNOB 1Q9OA 2KH2B 4PS4L 5BXFB 3CN0A 5K9OB 1ZVHA 3KL0A 1TKWB 2WO4A 1KEGH 8FABA 4Z0XB 5LXVA 1QRNE 4LU5H 3TO4C 2HB0A 2HP4A 3MRLA 2FLRT 4JR9H 4NCDA 2BRRL 2Y07H 1IB5A 3G5VB 5B1CA 3TVMC 1HXMA 2ZOLB 4P46B 5FLUA 4KAQH 1TYJA 2X4NA 4DNLA 3SDCC 4UV4H 4NENB 1C5DA 2X4RA 4P3CH 1G7PA 5DEJA 3V0WL 1T5WA 3OPZH 3NCWA 3LN4A 2HLFD 4HV8B 3DIFA 3V0DA 4JFQA 4JREC 1AHWC 5TDOB 2N7BA 4HJJH 1KENH 4JFTA 2RFXA 4MCZA 3RZCA 1IZJA 2XG5B 4ADGA 4DP9X 2V3DA 5I1CH 4FHKA 4W6YB 3T8MA 3ZIMA 2Y7MA 1CF8L 4KDLA 5FV1L 4MZ3A 2YD1A 1JZ4A 2D03L 3EJRA 3NDZE 5F88B 4XB3A 1U3HB 2MPAL 4QCIA 2KLTA 2V7NA 4LPXA 5BZWA 1EHAA 2NW3B 3BAEH 2AQ1A 4BGDA 1FFPB 5DRNA 3EHBD 5EZLA 3M17B 4EN3C 1H6EA 2XKNA 5C9JB 3EF4A 3RWEB 2BC4A 1GJIA 1BV8A 2NYYC 4JQVA 2HVJA 5FCUH 4Q9RL 2L8AA 4KI1A 3B9KB 5CJQL 1F4YH 1I9IL 4P5MA 5JW4N 1V3JA 2DYSB 2MQ0A 3AY4A 1IQDA 1V7NH 2CO4A 4HMDA 2NY6B 1HHIA 2MHAB 2IWGA 3PGCA 4OLXL 1D5MB 1W2KT 3ZLQC 3OJDA 5DEZA 5HVHB 1FYHB 3WEMA 4XMZA 4ELMB 2W88A 3QUZB 3QB7C 4P5KB 4BQ9A 4QXVA 3SDDC 3QP3A 4K8RC 4AM0A 4OJDH 5FHAL 4HS3B 1SRDA 3FQRA 1AVAA 2AQRA 1CI3M 5J1AB 4FFYA 5HHOD 2ED7A 1RUQL 2P8PB 5DGQA 5H2BB 4R8WL 3NH7H 5AZEL 4HDIB 3RUGE 1O6TA 3WOVA 5GJSH 3UC2A 3PRZA 2F53B 5KSUA 4F9PC 3TBTA 4M1CD 1DSYA 4H8WH 2F74B 3PP3H 1FZMB 4G7VH 4JB9H 4PJIE 3BWZA 2AJXL 4JLRB 2WBJA 5HGDA 4GG6B 2DQTL 1H5BB 2ODHA 5BS0B 2NCEA 4LLVA 3L7FA 4TLKA 1EPFA 3V6BR 5DCCA 4CBPA 4HKJA 1KQFA 3PHOB 3O4LA 1F1DA 3ZKQD 4KKCD 1WFOA 5CLTA 5D1QB 3T0EE 4UM9A 2GYSA 1GGIH 2OPCA 3WDJA 5JA8B 4QRTA 3OHXC 3T2PA 4GIAA 4DPAX 5GZOD 1NOFA 4DPCX 2JKXA 3FQTB 4AMKL 2BMKB 5JNYB 3HR5B 1KIRA 2M2DA 3OC8A 3UP6A 1B90A 4TUKH 1JZFA 2CE6A 2EIZB 5DZNA 4HWZB 5DHDA 4YHNA 4Y19E 4GIPD 4PJAE 3UTQB 2C4FT 1M6UA 4Z1PA 4OZGA 3CZNA 4Q6IC 4RMRA 4BINA 4NKIL 3JWOC 4WENB 3AG3B 3US1A 3O2WH 4X5RA 1QBMH 4M5YL 1CXLA 1EEUA 3K74B 5I30L 4WI9A 1BZDA 4OZIB 2IG2L 1LO4L 3EYQD 1MCLA 1UD3A 1WGVA 3PGFL 1UM6H 2GY5A 3WN6A 1W9XA 1SPDA 2HAZA 3ARVA 4LNRB 1XD0A 4C2MA 3BPNB 1ESOA 3GJFK 1N5YL 4QHKI 2EACA 1WA0X 3MRIA 5TQ2L 4FFWD 5IQMA 1MZYA 3P4NA 4JFEB 3ARRA 5I8EB 4ONHA 4UIMA 4XX1E 3CV5A 4UIKH 4XCFH 4NJAH 1TNNA 3NN8A 2YQ2A 4Q0XH 3WS6C 2Z0BA 2WXLA 1OAZL 3IPFA 3LEYL 4CN1A 2QELA 1R24B 2VLKD 2VDOH 3PWPB 1H6TA 1MELA 4P9HH 1U2CA 1URZA 1UT2A 1RSFA 4L48A 3QDMD 1EFQA 1NGZB 1J9RA 1WA2X 1XR8A 4L4TB 2G5BB 2H32H 5G4OA 1QD0A 1JV2A 2XZZA 1ZLSH 4WJKB 3X2NA 2G0LA 4KRMB 1OP3K 5DRZB 1MCPH 2DBLL 2Z93B 4W9FC 1A9BB 5T5MD 5DQJB 2XWJB 2OFQA 5MEOB 4YSDA 5F7HA 4YPGB 4AE1A 1MLCB 5HPOA 2CO6A 2VOTA 3UYPA 5EO9B 4X50A 3FO0H 2A9CA 4FLQA 3OKNA 2P8LA 4BA0A 2E7LC 3DVIA 3LN9A 4UQ3B 5K1JA 1CXFA 4MNGE 1A1OB 5CILL 3S35L 5TFSL 3DX9B 2FL5A 3LXUX 2OMYB 4YDMA 1FNHA 2QJDA 4XXWA 1NMAL 3ARDB 4K9EL 3VVVA 1CK0L 3QEQB 4ZMZA 2B7DT 2Z3FA 2QPUA 1DBKH 5EU4B 3RVWD 4I8DA 4AKPA 3MSPA 5HVFB 1CE6B 3DXAB 2GJZA 2QHRL 2I9LB 5CZVH 5D7KD 4Y4FC 4KX9A 3PIQB 2XLLA 1LE9B 2WYIA 5F7UA 3MBED 3BPCB 5D7LD 1EIBA 4H26B 3EFOA 4PJEF 2BVTA 4LPCA 1BD2B 1J0ZA 3L3OC 4LLYA 3IFPB 5KSBE 3U4EB 3TXAA 4PB0L 3QZWB 2JELH 2A5UA 4MS8D 1NDMA 1KCKA 2AZAA 2FH6A 5I75B 4QF1A 4X8GA 1UUNA 3QFJA 1KIPB 3HBZA 7PAZA 4J8RA 2ZP8A 4QNPE 4A6YL 4HJSA 3NABH 2JKJA 5I73C 1HSAA 1R3JB 2W9DH 3QAZC 1HFUA 1PGRB 1BFVH 4KH9A 3OR6A 4QTHA 3GBNL 5K1VA 1A6AA 3HFMH 3A6CH 4S1QL 3L3HB 1ROWA 3RKDC 4FL4C 3N5AA 5DURB 3MJ9L 3EOTL 3P4OA 1FIGH 2E2HA 3KW7A 1GAFH 3CHXA 1A5FH 1BJ1H 3W11C 1NWOA 4FRWA 3MRKB 3O6MH 1S7TB 3LIZH 3KWWA 1PSKL 4F57H 2VQUA 1HWWA 4AJVA 2ISDA 3VNZA 1NH6A 4JPQA 4ONFL 4HS8H 5B1JA 3IMRA 3N85H 35C8L 1FN4B 3IETB 1KXQE 3T3MF 4JG5A 4KJWC 4PMEA 3AQDA 3U2SA 1U4FA 5KVGL 3J07A 1QSVA 4OJYA 1NCGA 2CCLA 3HMWH 4GI8A 4EIUA 1VZIA 1U95A 1TFPA 3FPXA 1TQCC 2C3GA 2K6WA 2XQYA 4FCHA 1RD6A 1BF8A 5C6WH 2N7AA 4KITB 1CVSC 4CW1A 3D2TA 1HH6B 1RZJC 2CKBL 4JO8A 2CBOA 1Q4NX 3H6AA 2X1WL 3FQXA 1YY8A 1VF5C 4HCGA 1TVBB 5DO8A 5I8CB 2X41A 2DYPB 5DQDL 2QVFB 2A73A 5IMOB 1GIGH 4OZFB 1BSIA 4F7CB 3CSYA 1SJVA 1UJ3B 2QT6A 1A9EB 1RIUH 3KL5A 4KXZI 3ZE2B 1N0XL 4Z7WE 1C16A 3ZDYF 4TL4A 4MLIA 1TETL 3F5WB 4U2ZA 3IT8D 1VAHA 1VB9A 2J1XA 3ASOB 1QPPA 4XBMA 4F5CE 4JKKA 3IAGC 5GIRB 1TZAA 1I1FB 4P2CG 4YZFE 2FNWA 1XX9C 4JHAH 2E74C 3N40P 1E7VA 4IM8A 5AOLA 5JO5B 4AONB 5HGAA 1EJ6A 5E8PB 4XOBA 4XP1H 3GM8A 4AENA 3MJ8B 4UILL 4ABQA 5F1SA 1TVDA 5F44A 5C8JA 3RZCC 3L1OH 4HK3J 3ZR6A 3F7YA 1DBAH 2X89A 5IM7A 3GZKA 4I4WA 1KPRB 3GHEL 1OPOA 2HWZH 4YFDB 1CZ5A 4IBUA 3CXHK 4KC3B 5HHNB 3V4PL 3F12A 3QZPA 5GGUB 1T1XB 5EULV 4DW2H 2NXZB 2V5TA 1TZIA 4S1RH 4B95C 5F9AC 1AMXA 1XCTB 5EU7C 1P9MA 2XV6B 3BEWB 4KFMA 5AOIA 3SO3C 3OX8B 3ATFA 4GLRH 1BGXL 2JV6A 1KY7A 4NPKA 4FGMA 2A6HD 5EDXA 2ITDA 4R7DA 1JWMB 3QPXH 4ZDHA 3TN0B 3I84A 4NO3A 4MD5A 3RUGA 1Y1DA 3LTVA 3OF6A 4LKCB 3BRFA 2JH2A 3MNZA 3AY4C 3AAZB 5TDNA 4DKAA 1INDH 3KXFE 4N3TA 5K39A 5ITFA 2FIKA 2BW5A 2C7UA 3Q8FA 3L45A 4LCCA 1JGVL 2VXSH 3QIWC 4R26L 1NL0H 1SQMA 1RJYA 1UXSA 4PJIA 1WLFA 1BBJA 4JKMA 4H0LC 1AQDB 1DQQA 4O9HL 1Q0EA 2BCMA 3M45A 1DMSA 2UY7B 4OF7A 2KQNA 3CPLA 3BH9A 5FGCB 3BCDA 3T0EA 3FBKA 1FNFA 1GW6A 3KWTA 2C3WA 3E8UL 4LAJH 2FX7H 3FF7A 5I6XB 5AB1A 4OIFA 1AGBB 4KK5D 4TOYL 3U46B 1VADA 4Y4KD 1RU9L 2UXGA 1O6VA 3P73B 1UENA 4L8SC 2EDDA 2L3BA 3Q5TA 1IEHA 2EXYD 3F58H 1QTSA 4Y19A 4PJAA 4PD4J 3ROOA 1N12A 5CEZE 5DD1L 3P30L 1IKNA 2ID5A 2C1OB 5EN2A 4K71B 2VERA 2IAND 4YGVA 2BOCB 1FGVH 3MCLL 4ZX5A 5GS2D 2N0KA 2B16A 1YNTF 3EYVA 2EO1A 3BVNB 4RISL 1OEZW 4PW4A 1BXUA 1XF4B 5HGGS 3FZUC 1DHKA 1A6ZB 2AXFA 2HVKA 5GRXG 1HHKB 1P4LB 2UZXA 4AJYV 3BP7A 2D31B 3D69B 4XPAL 5GQBA 1BVKB 2XXCB 5EBMA 3AG4B 4FI8A 1MREL 4Y7OC 4JKWA 3QUKB 2ZXDA 3WN5A 2VL4A 4LOUD 4U1GB 3VXSE 1IE5A 4R5VA 2VLJB 2EEOB 2JJTC 4QRPB 3BESR 5IG7A 5EO1B 4U1NB 5JHLH 4TQPA 3TM7B 4LHQB 4Z7NE 1UD2A 4ICWA 5EBLA 4AI7A 2XTJE 4QXUH 1T0NB 2ZOTA 1XGPA 4BH7A 1DYZA 4NQXB 5TF0A 1U3ZA 3WJJA 4JM0A 2Z34A 3NSCA 4I9WD 2XFGB 3WTVA 4PGDB 2FO1A 1ZS8B 4X0NA 1A02N 1JNNL 1A14L 1KCUL 5FR3A 1AR1D 1TITA 1U3NA 3L6FB 3LIZA 1II4E 1Q72L 5E56A 2W1NA 5BZDA 2RMNA 5HHME 1HNFA 1G0DA 2V33A 2FZ3A 4WFEE 1XCQB 2VSMB 3C5SA 2APVA 2R0WL 1JFQH 1RUAH 4PRPD 4XCYB 1H15B 1EAOA 5BOJA 4N9GA 1C5CH 2MCPH 5HJ3B 3X2HA 4O2FB 5F6HI 3MACL 4JFFD 2WYZA 1H6UA 3QJSB 1SFHA 5I0DA 3MLRH 1P1ZB 1W0VB 4NOBA 4QRQB 1N10A 5KN5A 5CUSL 1JHTA 4WSGA 4XOCA 4MNGA 2A77L 1ZTXE 5JW4M 4G7YH 4RGMB 2FVNA 3UZEA 5CEZH 3MHZA 4YDKH 4BFIA 1CXEA 3KLHD 3MLYH 5EZIH 5D72L 3L2NA 4ZS6D 1FZOA 4QDGA 1W0WB 2WXHA 4BFRA 1FC2D 1Y5IA 4HD5A 2MNWA 1Y0LA 4FQJH 5AW4B 3ARFB 2DQGH 3BEVB 3MNVB 3VFPB 3WUZA 4ZX6A 4IKLA 1TQBC 3DSNB 1G1KA 4AYGA 1YMME 4NQCD 5JW4R 5IF0B 4G42B 3CFNA 3B34A 2AV1A 1E28B 1DQJA 1X5KA 2FLMA 3C6LA 3GDCA 4F8PA 5I1HH 3SDAA 3LRSB 1B6UA 2ENJA 1SXSA 4M7ZC 3VMOA 3K2IA 3H54A 5E00B 3WIHL 2ESVD 2Y6SD 5JXAH 5I2IB 2BLFA 3N04A 4ONGH 3Q5OA 1E3FA 1E4JA 1XMWA 4GAGH 1S9YB 2ZUXA 1H8OA 4KDVA 4XXWC 4NUQA 3HG1B 1ACXA 4MB3A 5PAZA 3C8HA 5I82A 4JE0A 4CVXA 3JWDC 2WD0A 5HDLA 1KGWA 2HT3C 1QKZL 3FTXA 2A6KA 3DDFA 4I3SH 1YECH 1XGQA 2AEQH 2DF3A 2CMRH 4FXTA 1FFQA 3L9BA 4DKFH 2NZ9C 4IMKA 1AMYA 2YRPA 1IILE 2W65A 3GZQA 4GMTH 4GY4A 4PJBE 4U1HA 4UINH 5GZND 3VQ2C 1L6XA 4XHQA 1CGSH 1C12B 3RLSA 2GITA 2WQVA 5HI5D 4OH2A 1I8IB 2WMPB 3GMNA 3MRQB 4FTVB 4X0KB 5JORA 2BSRA 3ZMRA 4RGOL 4LRIC 3QI9D 3WCYA 2DJ4A 1KLGA 3E6FB 5BVJA 3PG2A 4FZ8H 3TU6A 1KXQA 2PPCA 4ODWB 4LLWA 4JPVH 1D5IL 3VD7A 2WQUA 1KFGA 2R2CA 3DO7B 5I1AB 4IOFC 3UO1H 2XICA 1NCOA 3ISYA 4N1EA 2IPKB 4L5FL 3S4SA 1MFCH 3CMOL 4KPHH 3VFWB 5KG9B 4ZTPL 5AVYB 4N26A 3V4VH 2X4UA 3UJIL 1KC5L 1X7SA 2HX8A 4MSWA 2VN7A 3U48A 2FT8A 1N2RA 2GIYA 4G9FE 4OZHE 1BZ9A 1FO0A 4XI5C 3SJVA 2FX9L 1ZHBA 4PVMA 2EYRA 5A16A 3E7JA 4QD2E 5JTWA 2YHGA 2YPLB 5GGRY 3ZRCC 5FUZL 3WY4A 1UOKA 5ISZB 4LCUA 3FC8A 1S2EA 4Z7WA 2GB2A 2CO7B 5B1JC 3DYPA 1TJIH 3GYRA 7FABL 3LQAH 1XF5B 2W9LA 2E4TA 5E8DH 4F5CA 3SQOL 4HIIB 3Q6FB 1CPUA 1LP9E 3KPSD 2OCFD 4YHKL 1YRKA 1IBHA 2IQAA 3HAEB 3IGUA 2XV3A 5DQ9B 3L5JA 4PY8J 4TSBL 1IGTB 4PVLA 5B22A 5J1TC 1DVYA 5F1IB 4BKSC 1BVNT 3D39E 3RE0A 4TSCH 4CRPA 3VGFA 4AVJA 4GS7C 2WWOA 1J1PH 4H8WC 4MD0B 4MKTA 3X1FA 2OLDA 5EUOE 3T3MB 5CP7B 5DT1H 3SUKA 5DVOA 2KS0A 2HRGA 5AYQA 3MXWL 1I7RA 4YX2H 1PZ3A 4NJ9H 1DJSA 3EG9B 1YLEA 4D9LL 1P4UA 5F7MC 2VZUA 4XP9H 5LNEA 4D9RE 4B27A 4HJ0C 2Z7YA 3VXRB 1OAXL 4JG1L 4GKOA 4O2EA 4RGNB 3LNIA 3DGGB 1K6QL 1Q8MA 1X5MA 3X12B 4LARL 5AOKA 5T1LB 5HYSB 5FYJL 3CGTA 4UV7L 4XNYH 4XP6L 3D06A 2CIKA 4NQQA 4OF8A 1BZ7A 1LK2B 1NCJA 5T1KA 3MNWA 1RFDL 1HT6A 5AL0A 3CHSA 1I3VA 3SD5A 1GKEA 3EXLA 5JHLA 3W0WD 4ZYKB 3T9WA 2JMRA 1NUDA 3ZDYB 5IB1B 4IRJA 4HQQH 3SGKA 3HNTH 1CD1A 1JS4A 4EMZA 4FFZA 3KXFA 2IDSA 4BZ2H 3CDYA 3EOBA 2DD8L 1R3LB 3DOSA 1IL1B 3MRFB 3MREB 1ODUA 4E5XB 2JIRA 5I71C 3EUDA 1CIDA 1PKQE 3FRPB 3VWJB 1OALA 5D1XD 1F8TH 3BVXA 1FFNB 1YEKL 4MXVF 3V4PB 1BVLB 1THAA 2OR9L 2NTFA 3C2AH 1AP2B 3F85A 4LHUA 5F2FA 1P9MC 1UEMA 4GJTB 3NTCH 4NN7C 1R0AH 3P4MA 3WKPA 3DTXA 3HS9A 3II1A 5IEKB 4X6CE 5DJ0B 1ED3A 1OSZA 4DVRL 1NSNL 3D6GA 3AXLB 4ZQTA 3N6YA 4N3UA 3FT4B 4K3JL 5IB5B 4L0ZA 1L9NA 4KVCH 1XSKA 4G8AC 2Z7UA 4XO3A 3GKWH 4YUEH 3TCLB 3WUWG 4FQQB 1HL5A 4ABVA 3LMJH 4LCCC 4R7LA 1JVOA 2FR4B 3UBXA 4NQEE 1U8OB 4HIJB 4NFBA 1JF1B 4YSPA 4E9LA 1ZEAL 5FYLL 3WFEH 3VRIB 2EC9T 3MGOA 2NUPB 5D96C 3HBQA 2O5YL 3T0EC 3OZLA 4JRXE 1NMCC 4OGAD 5L9DL 1MCBA 4MB1A 2HUEA 2LW3A 5AAMA 4I9XA 5DYGA 2HPOA 5AVVB 3VB8A 5IVNA 2F6AA 1UB6A 2RCSL 1WE5A 3Q7JA 3V9EA 1CB4A 3CFJB 3VXSA 3CZFB 3ZKMD 4NN5C 5GS0D 3EYOB 1BAGA 5KW9H 1VFAB 4DKDC 1YNKH 5F89B 1U3JA 5KBLA 3U0WH 1O75A 4PIBA 4FA6A 3L95A 5IMMB 4RFOH 4W4OA 1IKNC 3S9DB 1ZDQA 2HTKC 4IK6A 4E2OA 4H4NA 4TUJA 3F62A 4FQ1H 1JHLH 2AXGA 4UTAA 1Z9OA 3N55A 1TTBA 2JI1A 5ERWA 3DHMA 4LEOB 1JGDA 4GQ9H 3Q2CA 4QLWA 3D85A 1ZGLM 4CC1A 2QR0A 3HJ0A 3CVCA 1V7ML 5F7EH 3CQQA 2Z31A 3KJ6H 1WJ3A 1BQUA 1GH7A 2DEYX 1DJWA 3NQKA 2YXWA 5GSVB 3WN5C 5IJBC 4UANA 1IRAY 1AZNA 3MRBB 4PR5A 5E9DE 1X7QA 4NC2B 1PW3A 5IY5B 5KYWA 1YNTB 2AQSA 2X3CA 3BAJA 1S7VA 3A6BL 5GS2H 2WLKA 3ALPA 4URTB 5CM1A 3V4VA 4QRFA 1PG7W 3N3EA 5DJCA 3F7PC 1HIMH 2BIHA 2IXQA 4NEHB 4JM2F 5CKGA 3WJJC 4XNXH 3EBIA 1MSPA 4G6FB 4YHPB 1G8JA 3SEPA 2YPKB 3VA6A 4I3RH 4MAZA 5DJZB 1DCEA 1CIUA 3CLEL 3LJ3A 3PQYD 1CXKA 5D70H 4RMBA 1MUJB 1I7UB 4ONOA 4FG6D 3WL9B 5FB8B 3O41A 3U9PH 1NIDA 1CG9B 1YMMA 1W72H 1OAYH 1A7OH 1DBJL 3ULVF 2BNQE 5CXPA 3RWIA 3MBWB 3V5KA 5FO8B 1SBBA 2ZXQA 2BNRE 3V95A 2BVYA 1MVUA 2DQHH 1OP5H 3HIZA 1UT1A 5FPIA 4G8EA 2CXKA 4ZO8A 3VGGA 4WKZB 1FDOA 4MQXD 3UZEC 3ZE0E 4WW1A 4NWUL 4O02L 5ADOL 1U8IA 1KFAL 4LGRB 4TQIA 3FCGA 2ZQKA 5DC2A 1JZ6A 3EW3B 4DJMA 3MROB 1FH5H 3TTYA 1A1NB 4BGLA 4F8QA 3FQNB 4IU2A 4KH2A 4PJBA 5G55A 1YDPB 4XCCH 2AV7B 5EZJA 3FOMA 1HI6A 2X1PA 3VRLF 4P46D 2UZIH 1KYOJ 3ZL4L 4XMVA 2GSIA 1JSYA 3SDAC 1QX1A 3U1PA 1XH3A 2ALWA 2OCCB 3C9NA 3WIFB 1K5NA 4JFYA 3GMMA 4U1MB 3AM8A 1GGBH 2VQ4A 1XV8A 1IGYA 2X4OA 1FHGA 4KY2A 2Z35B 4HUVA 4A2LA 4APQD 2OI9C 2VDNL 1OARL 4NAJA 4RAHA 4RSVA 1G0XA 1AIFB 5KSAA 4S0HA 4WNQB 4FEMA 4PJ9A 1D7BA 1WG3A 5FO2A 3CX5K 3EJSA 1IGJA 4FULA 4R83A 2EXWC 5IMKA 4G9FA 3INUL 2QSVA 3ULUF 4NOFA 4R5XA 1MCOL 2VLRE 2YSSB 4NRZB 1BVZA 2DWEB 4BZ2A 3EJJX 4HFUH 2QHLA 3IDGB 4Z7OF 5LNDA 1U3HD 3ATAA 2VAJA 3B9AA 4FFVC 1AQ8A 3B9DA 2GAEA 2UWEF 3O6LH 3OKMB 5CEXA 2XRAL 1D6VH 1UM4H 4I0PB 1UQSA 2CK0H 4ZXBB 2CRZA 4CC0A 2BX5A 2VDLH 3DRQB 2XWEA 1GY2A 2K3HA 1LP9A 2FX8H 4BFBD 5DYFA 4RWYH 4MJ6A 3B9KD 1A3LL 2N56A 4FG2A 1G7MA 1PPIA 2NNXA 5MP6H 3HC2A 2BSBA 3KGSA 4FCAA 2NY6D 4FNUA 5ENWA 2ZOOA 3WIAA 1OKEA 4E41E 4JY4B 5LNGA 1GJUA 4NQDB 2DH3A 1FNAA 2MCAA 3RDTB 5MENE 4PJ7F 3ABMB 1UXWB 2XPGB 3VFGL 5GISH 2QDWA 1E8ZA 1VFOA 4R2GC 1T6VN 3DI3B 3QCUL 5EUOA 5T5FL 3TJEL 4EKXA 2YD2A 5LN8A 3EYFB 4W6XB 4K8RL 3RVUD 2PO6B 3QUZD 4HC1H 2K70A 2J20A 4W9JC 3MRGB 5HYQA 4K2UL 3WXWH 2GT9B 3D1MC 2XA8H 3KLKA 1G7HA 4WI8A 1ZLEA 4R3SB 4ZUWB 2XG4A 3LZRA 3IWVA 4D0CA 2JB6A 5ICZA 4CVZA 2JKNA 1JE6A 1MQ8A 2ADGA 4IRSB 3PFUA 4A2DA 4JCLA 1IBGH 2R23A 3O9WB 2D7PA 3TIEB 2R4SH 2F53D 2WKGA 4G72B 1XZ0B 1LL1A 5DJDB 1NC2A 2NY5H 3MV01 1ECZA 1YEFH 3HC4H 1L6ZA 4KV5E 1TQUA 2ZICA 2VC2B 2AJYH 3GSWB 4OV6F 3I9GL 3SYOA 2X10A 1ZGLA 1ORSB 4N68A 1LVEA 4MFHA 3AT0A 5MHSE 5D7SH 2QQNL 5BS0D 1P7QB 4PJGF 3KNBA 4PCKA 4PTUB 5L88L 4P23A 2P5EB 2CJUL 3GI8L 1CLVA 4NNXA 5D1QD 3S3SA 3VRJB 4BSVA 4D8PA 1YY9D 1F58H 4PW9A 4IU3A 1U8JA 3Q2WA 3TWCL 3DVGA 1QNZL 2P5WB 2BP8A 3G6AA 1CLYL 3GF8A 4N25A 1EGJH 3PWLB 3PHQA 4TQEL 3HZVB 43CAA 4EPSA 3IN2A 2VDKL 1PKQA 5HI4D 3CHRA 1T89A 1FNSH 1OAQH 3FQWB 5D1ZA 4HYTB 1VZGA 3O81A 2FQEA 1FSKC 5KZCB 3JWOL 3GBML 1USQA 4DGIL 1NBQA 3PABB 2QPDB 4Q14A 4LSTL 1CFNB 4NI3A 5F7DA 3GMQA 3X14B 4IEFB 4DO5A 4WK0B 3P9MB 1OT2A 4LKXB 4IRJC 2QZQA 4LEBA 1DP0A 1BLNB 4BFKA 1H0HA 5EF0A 2HCZX 3SGKC 2GBUA 5KUMA 2CCWA 4M7JH 5A2LH 5DK2B 3QIUA 5E2WH 4I5BB 2VDRH 4LQFH 2IDUA 3S2AA 1ZVSB 1HL4A 4N2KA 3Q05A 3MRPA 1NEZA 2LV4A 2K7QA 4XBPA 1MW2A 4NQEA 3HI6L 3S8GB 1EZUA 3PDOB 3RVXC 3O5AA 4JFED 1DVFB 2WJ5A 5KS9E 5FOJA 1OA7A 1QFPA 3IBEA 4MCNA 2EE6A 2Q20A 4JRXA 2VW4A 3N41B 1RAMA 1NDGB 3B5GA 3BJ91 4XPGL 3R0MA 4EOWL 3AT9A 1A7NL 4ODHL 5I6LA 3WNPA 1NEUA 2HTLD 3QULB 4YK4C 5AB0A 3FB6A 2H4EA 3PWPD 5AAWA 4PBVC 2F19H 3OC5A 2D73A 2XIDA 4YHLL 2AZUA 4LRNH 3NIDE 5B1AB 4L4TD 1T2QH 1OTTD 3HZMB 1ZD6A 4MMXB 4LQ1A 4MMYB 3IDYC 2R8SL 2WNXA 1NLBL 1OOAA 1RIVL 3ZQXA 4NQSB 5TF1L 5B39G 3GI9L 2AXWA 4PUBH 4WO4C 4J7RA 3LRHA 1J0KA 1FGNL 2R29H 4Y1SA 3M8OL 3BHBA 3DIVA 2VXUH 4Y89A 3CXDL 3ZU8A 3ARBA 1D3CA 5C1MB 1EJFA 3K72B 5AAMC 3D8MA 3MFFA 5KOMC 3QQDA 2BS9A 4HWNA 1UFGA 1FBIH 2XIBA 4G83A 4F9LA 1EHLL 3LV3B 3SBPA 4M4PA 5FGRA 2ALAA 3KM1A 1SEBB 3QUXB 5E9DA 3ZKND 4AQ1B 4TYUA 3DXAD 3IWUA 4DH2A 2DWYA 4W4OC 5A2KH 4XWOD 5EMYA 4AK2A 2XTJC 3CFEA 5L6YL 1OTUD 4RRPM 2X4PB 4J39A 3O8XA 1RZIA 1JZ7A 5DHVB 1OT1A 4WU7A 2XZCL 6TAAA 4GO6B 5C0AB 4Z8FH 1MWAA 1BD2D 3WHXA 4N6RA 2FO8A 5I5IA 3SYQA 1O0VA 4M62L 2GEEA 1RIHL 2Y36L 3CFQA 2QSCH 3BI9X 2W5PA 1P5UB 1M7UA 4Z3IA 3H53A 2B2XL 5E0FA 3BE1H 1XIWB 2G0KA 1TU2B 2Z31C 2OXHA 3QWRA 4Y1AB 2VDPL 1GGCL 5GS0H 3NCYS 5EOTA 2BNQA 5FYKU 3L3DB 3IR6A 2KQMA 5HGHB 5DHYA 3KPOB 2DQMA 3O6FA 5JOPD 2BNRA 4MQ7B 4JGUA 1JGIA 5DURD 1O7DE 4AL8H 1J5OL 4P2AA 2OR7A 1L5GA 1X5LA 3H7BB 3OKKB 5E2VH 2A4ZA 4RRPG 3QUMA 1ETA1 1LO2L 3B9VA 3CIQA 3KYOA 4LBEA 4Z76A 1EEYB 3P9LA 4AYID 1KB5H 2NTSP 2X4SB 3CLFL 3MLZL 5INDB 1KZQA 5DU7A 1ROCA 1T22B 1A6WL 4F58H 4LIQL 2OZ4L 5AWNH 1OAKL 3MUJA 3N44F 3G5XB 4ES8A 4YHYB 3MJ7B 5H4YA 1GOFA 1WP6A 1MJ7L 3RIFK 5C0JA 2NLJB 2X1XR 4UCFA 4HZLB 3BVUA 4G2AA 3LS4H 5CEYA 1PZ2A 1AO7B 1OWWA 4TUOB 1JVKA 2VQ1B 4JM2B 4KQ4L 2P1YA 4OD3L 1EH9A 3WTWA 1M05A 4HG4J 3U9UA 3UIZA 4JFPB 1UH4A 2FJHA 4TTGA 1UHEA 2FBOJ 1WFUA 4G5ZH 1TXKA 3SKUD 3T6XA 3ZMEA 1HDMB 1GGTA 2DYPD 2F7IA 2JNZA 2X40A 3CFKB 4OUUA 4DOHB 4F2ME 2ADJA 1NGXA 3UPRB 4FLSA 1JZHA 4JPIB 5DA4A 5E5MA 5EC1A 4GG8A 2BVEA 2DQJH 4ATTA 2X12A 1ZA6A 1JZJA 4MA8L 4AITA 1MCJA 3P77A 4O02B 1Q9KA 1N0LB 2VLRA 5HI3D 3S3PA 3HU1A 3QJVB 4N2FA 3IF1A 3E0GA 1CDUA 3WMPA 4DP8X 4PLJC 5BO1L 2IPTH 3RVTD 4HBCH 3TVMB 4FA8A 4A04A 4K7PX 4OD1L 1UM5L 1S5HA 5BUPA 4LCWD 3VD4A 2Q3XA 4MMZA 2C26A 3RAJL 4O4YH 2OMVB 3SDCB 2WLIB 3B37A 3Q2NA 1AXSB 2YEVB 4B6ZA 1QA9A 2BSDA 3CZLA 2GAZA 2UVFA 3T1FA 3UXFA 3AU1A 3WG7B 1J1OL 2FH8A 2HFFB 3B7UX 4H1LA 2B1AL 4DMRA 4NO2B 4PJ9C 1J86A 4OT1L 1DLFH 5EC2B 1AHWB 3GHBL 2DKMA 2J4WH 1I1YA 1UA6L 3A4AA 3NCEB 2R0ZL 5FA4A 2VDNB 1CUOA 3ESUF 4E41A 2DQDH 3WD5H 4AZ8A 4AKQA 1GOHA 4LB8A 5MENA 1QO3B 4N1HB 5C0CB 4DAGL 2ZG3A 5EU3A 1HKLL 1Q0XL 3VQLA 3CN1A 4HPYL 5FYKL 3MXVL 1TJHL 4GAYB 3BD5A 3O2VL 4XX5A 5E1GA 3WDIA 1NCBL 3DOHA 4KRLB 3WUWB 2WK2A 1IQWH 1DSFL 5HPMA 4ZD3H 5I18L 4HGWB 3UTZA 3LXCA 1U93B 3VG0H 4JY5L 1JPSL 2OSXA 4HKZA 4BSJA 5A2BA 2PW1B 4JVPA 4YSCA 2VLLB 5FTJA 3BC9A 2VR9A 2BDNL 4EN3B 3KWVA 1XF2A 1X5AA 2WTRB 3QJTB 4HLZH 3TN0D 2GK0B 3RPIB 1N68A 5I0ZA 3CVHH 1KPUB 5I1DB 4U6XB 4ENEC 1T7VA 1F0LA 5E9AA 25C8L 4LSSL 4YAQB 4Z7OB 3ET9F 1U8KB 3L3KB 5D7IB 3C6SB 1U41A 2HLEB 2UWEB 3CSPA 5DJ6A 3TJPA 1DE4A 1MFDL 4NNYB 4EI5A 3FT2A 4OTXH 2AGJL 1UWGH 4JJHA 2P7TB 1IGMH 4S0TD 3WNOA 4U6VH 5E2UH 1E61A 1XAUA 3DA0A 4LCYA 4P2QB 4RBPH 1DLHB 3WFHB 2R29A 2J6EA 4AQAB 2D0HA 1F4WL 4JHWH 1DR9A 4RFEA 3Q8BA 3SDDB 2X6CA 1M2VA 2XKSA 2NNFA 1AGDB 1NFDF 3IRCA 1IO4C 1KTRL 1QAWA 2ITCA 4WHTB 4PJ7B 4W9LC 1FJ1A 2IALA 2DDQL 1HZKA 1FDLH 4PRNA 5BNXD 4PWEA 2F8OA 3V0AC 1KBGL 2DIEA 2V9QA 1FCGA 4FXKA 1EFXA 3P9WB 3WELA 1ZLWH 4PWJA 1T2XA 1MCCA 2EIBA 2ENGA 2E7BA 4WWID 2VRAA 4UOJA 4P23C 3GJEB 4OZGF 3LZOA 2EVIA 3EF7A 4N8UA 1U0QA 3MNDA 5DUPL 4A38A 1AI1H 4M5SA 2W07B 3FN0L 1YQVH 4D9QE 1ZHNA 2LU4A 5J6GA 1WS7A 3HZKB 2CBTA 3BUTA 3WENA 2FJGB 4GAJL 2BHYA 2NUTB 5GRJL 4YXHL 1QFWL 2VLJD 5KS9A 2CIIB 1JRHH 1CXIA 3GKZA 4QRPD 2CWRA 3VXME 5MI0C 1JNLH 4JMNA 2XWBA 1UCTA 3TF7C 3WGVB 1XR9B 3FT0A 2GG1A 4PJGB 2VDKB 2Z92A 3EDEA 2OK0L 4JM4H 4TNWK 5T1MB 1C8QA 3BT0A 4AWJC 1BM3H 2XY1A 5KVFL 4PRBB 2WVVB 2X05A 5J3HC 3MBXL 4K73A 5SX5K 1SEQH 4DWHA 3PWNB 4PWKA 2K78A 3GFUA 4CJ1A 5ACMA 3QIUC 1BYPA 3APMA 2XZAH 4U33A 5C0BE 1ZT7A 4NIYE 3HPLB 1AZRA 1J11A 5T3ZD 3ABLB 4UQIM 4M7KL 2JIXB 4JDTH 4XC3L 3B2VH 5C2UB 4Z7QE 4QTIL 3G9AB 5DO2D 1JP5A 2KPNA 3UTSE 2NX5A 3EAKA 1GY1A 3QEQE 4O51A 1IT9H 4TPRL 3UC0H 4Q56A 4D3CH 3ILEA 2B14A 1MCFA 5CD3A 2XX1A 3LVTA 2OL3L 1U30A 3DX2A 4UM8B 3S36X 3AXHA 5AAWC 3SPHA 2HFEB 4UQEA 2ZX5A 4LF3A 1E5ZA 4UTBH 1RK1B 3HE7A 3KPMA 5C7ZA 4PVBA 3BW9A 1YN7A 3ARFD 3F8UB 3VG9C 1IAIH 2XN9B 3UGXA 2BIOA 4TVPL 1T0MB 4N0CC 4X6BB 3FH7A 3TNMB 2IFFL 3IFLL 4LU5L 1N18A 4FNSA 4UNIA 4XAWH 3UG4A 4U1IA 5HDBE 2Y07L 3AWFA 2WLLB 3H0TA 1KBWA 3ARBC 2ZWNA 4KAQL 3NA9L 5H4ZA 2G4EA 3CJJA 4NERA 5KYUB 2OAAA 3RL2A 5I76B 4OCXH 4UV4L 1S9XA 5AVQB 3VD0A 1NZRA 1QRKA 4WUUB 3KCWA 1AGEB 4AC4A 3JWDL 5EA0H 3B1UA 1JZ8A 3SDYH 2CBQA 2O6CA 3HG1D 4F9LC 1JN6B 3SYCA 5IQ9B 5LHDA 3OMNB 4ATWA 3KM2A 1KENL 2AMGA 2LU7A 4OKDA 4OB5H 2QQKH 4PGEA 3FRUB 3PLYA 4ZPVB 3TBCA 2IV9A 3H9SE 1G7LA 5D4QA 4FZEH 2BJML 5E6IA 1INQA 2J21A 4AY0A 2PP9A 4BBWA 3QJUB 1AG0A 3ARPA 3DUSB 3O8XC 4OCRH 3S88H 1DBBL 4Y4FB 1A66A 2C4XA 4ETQA 3OGCB 4PV9A 1ND0B 4OV5A 2CJSA 3KLDA 4G8FB 1J8RA 4FTVD 5SX4I 3L3OB 2CLVB 3SPIA 4ZQKB 4OFYA 4ECNA 4ZMNA 3QO1B 4K3DL 4G1MB 1H3PH 3LEVL 2A6IA 1QVOB 2R2HA 3DUUA 4JJ5A 1N59B 1HOCB 3C09C 4AGQA 2DLFH 4PREB 5F3HB 4WWOA 4ZMQA 5I73B 1F5WA 1I85A 2DLTA 2V3FA 4KROC 4KRPB 4PM1A 4AUJA 3O6FC 1MFEH 3QAZB 3HRZA 4L37A 3N1MC 4UAHA 2H2SC 2VDPB 4BQ6A 5IQ7L 1T04B 4LEXL 5BRPA 4JFDB 5JHMA 1TTFA 2NDGA 3CVHA 4FL4B 3EH2A 2EJ1A 4A2HA 4CDGC 2YPLD 5CBEA 4F2MA 4POZC 2GC4C 2EH7L 5ISZD 4CMMA 5IJVB 1HILA 4XZUA 4CADB 1FC1A 3CBKB 5D6CA 2I69A 4A39A 4HF5H 5FIEA 5GLFA 1DFXA 3PS6A 3EOAA 3OG4B 3E6HA 1JDDA 2GW5A 4KKZA 3F05A 3U7WH 1XGUA 1MVYA 4HUUA 3UAJA 4KMTL 2BP3A 2HJKA 4J28A 4GRWE 1VACB 4HAFA 3GO1L 5ESAA 1CDIA 3RP1A 4HVBA 3SD2A 1TQCB 4YL9A 1BYOA 3ILQC 1J9TA 2CQVA 2X3BA 4H8WL 4O5LL 2ZX9A 4HU8A 4WF7A 2XTLA 3ES6B 4JP7A 2OX5A 3OM3B 4G7VL 2NY5C 4LSVH 1CLOL 4X2UA 1BA9A 3T6ZA 3SKMB 3ECBA 3U6RB 3BXNB 1RJCA 4OLZH 4WW2C 3RHWF 5IVXF 4KKLC 1RLBA 3DJTA 1MHPH 3QWQB 3BRGC 2A3TA 2CZNA 1SUJA 1Y1UA 3QS2A 1OB0A 4LLUB 4HK3N 3C8KB 1KBPA 3OB8A 1Q9OB 5A2IH 2VPWA 2AQTA 3U4AA 5DS8A 3VXRD 3FUFA 4HCIA 1UACL 8FABB 3CN2A 4RGND 3HR6A 1JTPA 5JXED 1MAJA 5DVKA 4A7QA 2ZNXA 2VZSA 1D7DA 5JIKA 1QATA 4ORZC 4QIWA 1HHGA 3MRLB 1CBJA 5T1LD 3Q6GL 4P59L 4ZFGL 3IMBA 3TFKC 1GYAA 1HXMB 2OYMA 5F9WC 4HZ1A 2KYIA 2X4NB 5E2JA 4YLBA 4MMZC 1HYSC 3SGJA 2EDMA 4WFHE 1XCWA 4AT6A 4OZFH 1C5DB 2X4RB 5DJ8A 5C97A 1G7PB 4GB9A 1MQKL 5F6IC 1T5WB 3V0JA 2JKWA 3LN4B 1QBML 2ICCA 3L08A 5C0DA 2X2UA 3DIFB 3TZVA 4AVRA 4K23L 4YHOH 4AW7A 4JFQB 3SQBA 4WTXA 4Z77A 4MCZB 2RFXB 3RZCB 4KKAD 3FKIA 1KTBA 1S9VA 1ZAGA 4W9EC 1FYTE 3V6OE 1UM6L 3WV0A 2YAOA 2ATAA 3RUGF 2DEXX 3BGFC 5AW7B 5IOKA 3VWJD 2A6DA 4L8CA 2V5MA 3X13A 3E80A 4B5EA 1AS8A 2FLBT 2BRRH 4XCFL 5F7FA 4NJAL 4P8QA 3OKDA 4Q0XL 4QCIB 1L9OA 2GY7B 4GRWH 2V7NB 1IBDA 3HI1A 5BZWB 4YZWA 1ZLVH 1V55B 5DRNB 3BP5A 3D48R 5AOZA 5EZLB 3SO3B 3T4AA 3V0WH 4BQBA 3NGBC 1QNIA 2DB8A 3VI4A 3WFBL 5HXMA 4N0RA 3ILDA 3W9DA 3D34A 2BC4B 3DMMA 2AJVL 3LZLA 2HVJB 1PG7X 2HUHA 4NPYA 1KMGA 2A2QT 4P5MB 1IQDB 2NY4C 4HJIA 3RIAF 3T0BA 4FLOA 5GGQL 1HHIB 5DFTA 2J88L 1UWFA 3NYKA 3PGCB 4EI5C 3R06A 1CF8H 3U0TA 4PJAF 4ZW6A 1DL7H 3OJDB 2MCG1 4JBSA 2V2XA 2D03H 4TKWA 4X9BA 3EBHA 4N2CA 3L81A 1KTJA 1WAAE 1JWSA 32C2A 2OMNA 2YOCA 4PP1C 2MPAH 4QI3A 5DLML 5K9QG 4XH2A 5HHQA 1OANA 4AM0B 4ZX3A 1PZSA 3OHMB 2G2NA 3LZFL 3T3PB 3FQRB 3VXMA 1MF2L 1YQ2A 2NR6A 1KIQA 4L8SB 3ME0A 1ZLUH 5CJQH 2GI0A 1DBKL 1I9IH 4DQOH 3F84A 5KSUB 2YKLH 3TBTB 2F9BT 3R1GH 4QHLA 4FXKC 5AW3B 2BRQA 2O6EA 3QDME 2OTPA 4OLXH 5HGDB 2WBJB 1C7SA 4B9CA 4H88L 4HKBA 1ZS2A 4LLVB 3L7FB 3QWNA 3CLWA 3MFGB 4HKJB 2TAAA 3MRHA 1M7IA 3O4LB 5C0BA 4KI5E 4WTZG 4UM9B 1UHVA 4QRTB 1BX2A 2QV2A 5JDJA 2UV3A 4B50A 3NABL 5FHAH 5CGMA 4IBLT 4HXBH 4FFTA 5J06A 4ZFFA 3MVSA 1KIRB 1BFVL 3UTSA 1RUQH 3BN9C 4R8WH 1X4YA 4YL4A 3HFML 3A6CL 4YHNB 1EEQA 5LGJA 3CN3A 1PZAA 1ZV2A 1MH5A 3EJPA 3QRLA 2AI0H 4FI6A 1DZBA 4OZGB 4W9KC 4XP4L 1OM3L 2A38A 5T33L 1EO7A 2E7DA 4U1JA 3VVWA 4ETYA 1KV7A 5F71A 4DP2X 3LIZL 1GTNA 2DQTH 5KVDE 1GYWA 4XVTL 4H8HA 1QW9A 2H1LM 2JJSA 3EJQA 4XP5H 5F21B 1G9HA 3S6CA 4ZK8A 1TWHA 2ZZUT 1TWAA 5D93C 5TE7L 4F8TA 2X88A 4O2CA 1E18A 2AJUL 3L8QA 2E76C 3ZIYA 3KE0A 4AMKH 4PPTA 4Q6YA 4YXKH 2XX0A 3E2HC 3MRIB 3EBGA 4S2SA 3PNRB 4WZ9A 5CN3A 4HIXH 3P4NB 4ONHB 4P4KD 4UIMB 3CE1A 3QZMA 1LD9A 2EIJB 3CH8A 3NN8B 3AWGA 3QNYA 2E47A 1QUNA 4LPYA 5KSBF 1FIEA 4J5VA 1R5IA 4X8JA 5C2BL 4L3EA 4F24A 4P2RE 1WV7T 3DARA 4PGCA 3QORA 1YEDA 4LLDA 2FJUB 5IMLA 3NAAL 2NPLX 1T7WA 3HE7C 1RIUL 1UWXH 3H9SA 4QNPF 1JZEA 4HH9A 5I30H 2IG2H 3UCRA 1XR8B 1BQ5A 3GC3A 3NIGE 4TLSA 2ZG2A 1JV2B 3PGFH 3LRLA 2M83A 1TQBB 3NCBB 3NOIA 1N5YH 2FYVA 1TTRA 3SUMA 1NCTA 1X6NA 5IUCA 3RTLA 4MHHG 3HEIB 4JHAL 2CO6B 4E9WA 7CGTA 4JCMA 2PF6A 4M7ZB 4XAKE 1IKOP 3UYPB 2E2IA 3TA4D 1AD0A 3OKNB 2P8LB 3WNLA 1NBCA 1OAZH 1WFMA 4B5ZA 2Y4SA 1YPZE 3MKGA 2FL5B 1OSEA 1OB1B 1VGKA 4F92B 3ARQA 3NK3A 4PJDF 1BOYA 4V2BA 2FATH 5E6IC 1O7DC 4HIPA 3LPGA 4E42A 1H6FA 3FOLA 2ZKMX 5JHDD 3DV6A 4M9PA 2GJZB 5LWYH 2GTWA 5KVDH 1U58A 1E5AA 2ICES 4PD4K 3RX5A 4WSKA 2AEPL 2DBLH 1LE5A 4HOXA 1PJ9A 2CA3A 3LPFA 4X8CA 4YWGL 3EFOB 4JPSA 1G6RH 4LLYB 3QEHA 2UX6A 5LCVA 2IADA 3RWJA 4I0PD 1NDMB 1S5IH 4ZXBD 3X1GA 3ZYIA 2OMUA 4QF1B 4LAQH 2CM5A 1AZUA 3C6EA 3QFJB 5KBNC 4J6IA 4J8RB 4RCAA 5CILH 1HXKA 1WO2A 1IBYA 5TFSH 1YZZA 2C45A 2BINA 4C8XA 1I85C 4Z7WF 3KGTA 1HSAB 3HC3L 1ET7A 5F8RC 1NMAH 1FO0L 3HRZC 4K9EH 3DDGA 3BIBX 3FU6A 3OR6B 4QTHB 3ZYOA 1RULL 1A6AB 1INDL 3LHPL 4NQDD 3RDTD 5EZPA 1E7UA 4NT6A 2APSA 2FSEA 4N9OB 1FP5A 1MCNA 3P4OB 4IJ3C 3PL6A 1N3NA 2DJMA 4RIRA 4CRYG 4DGVH 4D7ZB 4F33A 2ENYA 1P6AB 2PO6D 1PD6A 3KWWB 4UYQA 1HESA 1CTOA 2W0KA 2P8MA 2ZAGA 5D4HA 2X2HA 3OWEA 2GJ6E 3IU4L 5DMKA 3UAJC 4IRSD 4A6YH 2HFGL 1PIGA 3U2SB 5LGYA 3E1ZA 3O9WD 4UU9A 2YUWA 3F58L 4M4RA 1U95B 5LQBL 3GBNH 1QLEH 3N9GH 5C09E 4S1QH 3VTMA 1FFRA 3VI3E 1MLBA 4CW1B 1Y18A 1LWJA 3HLAA 3MJ9H 3UAFA 4ZODA 3FQXB 1UXLA 1P7QD 1D5ZA 1IARB 2RQ8A 4GS7B 4NM8L 3AT8A 4Z23A 4LGSB 3D25A 5GS3A 2NOYA 4B97A 1PSKH 1H19A 2A73B 5MEPA 3QJFA 1BWWA 3CSYB 3A5VA 3V6OA 1FYTA 3ILPA 4ONFH 2WBKA 3VX0A 1C16B 4Z7VE 35C8H 2FHFA 3BKYH 4EE2A 5FTLA 5AKTA 4Y9EA 3TTSA 4G8IA 5AUMA 2B9AA 4XN5A 2H3KA 5KZCD 3OVUB 3EO0B 4LLMA 4A63A 4BIKA 4WFFE 3MO1A 1T66C 5JHLL 2FECL 2Z4TA 3NIFE 2AKRA 5E4IA 1SM3H 3SGJC 4RAVA 1QPXA 2YU9A 1S9WA 3FQUA 4UF7C 4WLCA 2CKBH 1QTPA 4TM9A 5FYJD 4DP4X 3U7AA 5HGAB 3B2MA 1U42A 2R1WA 1LDSA 4FFZL 4LOVA 3RX8A 3ZQWA 4AENB 1Y6NR 1P6WA 3TZVC 1LLAA 4JZJA 2H0JA 4XGZA 3BVDB 4TQHA 1AS6A 5C8JB 1PY9A 4AX3A 5HDQL 4AEIL 1AAJA 1JMXA 1L6PA 1N0XH 1ZV5A 2GTZA 3AMKA 3F7YB 5IM7B 4ZAKA 4I4WB 1KT2A 1TETH 4LSUH 3WU1A 4YO0A 4DK3A 4DN3L 2RALA 1DVFD 1JFQL 3F12B 4IOSD 5HI4C 3O6KL 3LB6D 5I71B 1GGYA 1TZIB 2OYKA 1X5ZA 2PTTA 1WAAA 4IBZA 1QSEE 1OL0A 3MLRL 1A4AA 4LXFA 3I3EA 2WZ0A 2WO3B 2YXVA 4ODBD 3CHPA 5EB9A 4J3TA 4KNTA 4NN7B 1W91A 4Y9BA 3T4AC 1DQVA 1Z1WA 3KBEA 4G7YL 5IFAL 4B9GA 1PVHA 4PH8A 5JLZA 5D2LE 2ITDB 4UILH 2WXJA 4R7DB 3DMMC 1S8DA 5EZIL 2X2IA 5GHWH 4ZDHB 1ANUA 5DR5H 4NO3B 4MD5B 3RUGB 3FSAA 3MNZB 3V0FA 5TDNB 1WHPA 2JKIS 4FQJL 1CS6A 2CLRA 2VLKA 5AAPA 2AE0X 2DQGL 5ITFB 5K39B 2WYTA 1R9TA 2C7UB 5IHUL 4WAFA 4ZMXA 3WTYA 4LCCB 3F3HA 1LEKA 3QDMA 4EI6A 4PJIB 1RJYB 1UXSB 2ZUQC 1A0QL 2ICWI 4PJHE 3ZTCC 1OA9A 3A47A 1M7XA 1BBJB 5GGTH 1DQQB 2I25N 4JDEA 3QEUA 4Z7NF 4A67A 3DHUA 4FYSA 2ETWA 3H7LA 5E4EC 4WWNA 2NNCA 1OO2A 3M3GA 3CPLB 3BH9B 5D96B 3T0EB 5FYLD 1NMCB 3RJQB 1SFDA 4U05A 3SKOA 4NB7A 4MDIA 1BGXH 1G5AA 3K81A 1VADB 3OPUA 3QR0A 5TE4L 4MDJA 3GSQA 4K5NA 3DX0A 2F08A 4RMSA 4ANXA 2NR6C 3QUXD 3DX8A 3U30C 4NN5B 2R7EA 4YGAB 3GRWA 1FG2A 2N01B 4Y19B 4PJAB 3ROOB 3MOBH 4UTAL 2UUDH 4F7EA 3WJMA 3C5ZA 5HD8D 2AEQL 5CP3A 5KBKA 2NY2C 1NAKL 2CMRL 5EN2B 5FFOA 4DKFL 5C0AD 3BDYH 4GMTL 4UINL 4YGVB 3IGFA 4K3EH 1W15A 1WS8A 1ZSDA 4O9HH 1CGSL 5IR1A 5EZOL 3EYVB 4Z95H 3W81A 1LILA 1XIWD 4KWUA 3RNKA 1RPKA 4C56E 2AXFB 4HGMA 1G6RA 2HVKB 4JHUA 4H40A 2JLPA 1B6DA 4Y1AD 3FO9A 2YUVA 2UZXB 4Z3GA 2BWDA 2BSCA 2HT4D 3GPEA 3BP7B 1ERNA 3EYUL 1IE4A 1RU9H 3OZKA 5EBMB 1HEHC 3ARDC 4KPHL 3WN5B 1FAIL 1X9QA 4KBPA 2R15A 3V4VL 4NZUL 1ZTXL 1OCOB 5F96L 5IG7B 4W9DC 4QTFA 5DD1H 2Y7NA 4R7NA 4EXPX 2XI9A 5EBLB 4FX5A 1Z9MA 3CC1A 1XGPB 4J3VA 4BH7B 4P2RA 2Q87A 3ELQA 2PYFA 3MRCA 4RISH 4BWTA 3TBYA 2O5JD 1UUSA 1ZT1A 5TQ0L 3BDBA 4UQDA 4DGWC 3SGDI 2H2PD 1BQHA 1TJIL 2ROYA 5BZDB 4XPAH 1EAJA 4CSZA 2FZ3B 3C5SB 3LKQA 1GCYA 1MREH 4FQXA 5E94A 1AO7D 4JM2D 2JXMA 1SDDA 3RGHA 2Y7SA 2FAUA 1TLMA 2EZ0C 4PJBF 3GTKA 2MMXA 1JHTB 5JMOC 4TSCL 2YA2A 2K9UA 2P49B 2Y24A 3DVFA 4MNGB 4M03A 1J1PL 1YPZA 2JKTM 3LAFA 2GBAA 4BFIB 1BFOA 2GEQA 4ODXA 3PV6A 3ULVD 4WI0A 3NJXA 4NUGH 4KQ0A 5DMYA 1FZOB 3GK8L 5KVMC 4NJ9L 2EO9A 2H1PL 2AK4E 4K0OA 1OPGH 1Y0LB 4XP9L 4M9OA 4EZMA 2EXSA 1UZ6E 3X1BA 3MV7E 4BXVA 2X09A 4A2GA 4OZHF 1KTCA 3X2QB 4WI6A 3TVMD 3CZKA 4YDIL 2NT1A 2AV1B 3C6LB 1DQJB 3VACA 1HYRC 2PR4H 2YD5A 3QZLA 5DUBA 3SDAB 1CYXA 3EGSA 3SDCD 3ARUA 3QS3A 2FEEL 4J3UA 4PS3A 2VMCA 2CGZA 4UNTA 1L9QA 5BZZA 5GGSB 2WQWA 3H4HA 2OI9B 2CKBA 2OMTA 3HNTL 5D72H 1CL7I 4ODVL 4CVXB 4NXSA 1JDCA 1DSWA 3SE9H 4LLQA 5T3XL 4BZ2L 2DWXA 2RH0A 3PDDA 4W68A 1B4JL 4KNSA 3B5HA 5C0CD 2A6KB 4OVUA 1LP9F 2IJ0C 2X44D 1XGQB 3QVAA 1T4KA 1NFKA 3BUDA 2F61A 5CWSA 1EAQA 2W65B 1NINA 2GPZA 5JW3L 4U1HB 5ALCH 5GSRA 2WYHA 1D5XA 1SUHA 3GPSA 5H37A 3H4FA 2GITB 4G1EA 3GMNB 2F0CA 4JRLA 4X98A 3GXNA 2BSRB 3Q3GA 3VSTA 5JORB 3ARWA 3WTXA 1JPEA 2GJ6A 2J72A 2YMOA 1KLGB 1IFGA 2BVPA 3QYCA 4EN3D 5BVJB 4LLWB 5I74C 1FV1A 1SN2A 1JDAA 1ZA3A 2NYYD 1G94A 3L4CA 3S4SB 4IBYA 4F7PB 3ZZSA 1Y6KR 4KVCL 2P5EE 1TQTA 2KLSA 4F80A 2ATKA 5ILTH 3RKPA 4DFHA 2X4UB 5F7YC 1QKZH 5C09A 3T77A 4DEPC 4MSWB 2V3VA 3LMJL 4HEME 1N2RB 3VI3A 3MX0A 4YIQA 1BZ9B 1FO0B 4AYFA 3QQ7A 2P5WE 2XWCA 1ZHBB 3PL6C 4NO0A 2EYRB 2NXZC 5A16B 3TH4T 2O5ZL 3FT3A 4HUXA 4R2GB 3FFOA 4DEWA 2G5RA 3TWYA 5B38G 5BO0D 4LCUB 4P2QD 3TYGH 2FBJH 2VPZA 5GGTA 4Z7WB 3L4VA 3GTNA 4K15A 4AZUA 3SDDD 1KOAA 4K8RD 4ZUUA 4Z7VA 5HHPA 2DJUA 4G43A 1VKXA 3C60A 4YSRA 4L5FH 4ZW8A 3QR1A 5KW9L 4EIGB 1SHSA 2OKMA 3CMOH 1FA4A 1YNKL 2HJLA 2IQAB 2DLEA 4RFOL 1V8HA 2O1AA 4RLDA 1KC5H 3FU7A 3FQ1A 3F04A 4FQHB 4UBDC 3TCXA 3BPOC 4JDVA 4WGWB 2WWNA 2O72A 1FLTX 2FX9H 4OF3A 2N1KA 4E0RA 4FQ1L 1JHLL 1INEL 3ARTA 3BT2L 4UZUA 5DC9B 2R4RL 3SKJL 3V0IA 1WD9A 5FUZH 4OZ4A 4EVNA 1PBYA 3TESA 4X6CF 1SMDA 2K4WA 2Y1YA 5JUEH 3AS2A 3NFPA 2I60H 3V6OC 1I7RB 2WVUA 3DWTA 4WU5A 3L17A 3S96A 3O3DA 7FABH 3W57A 4XNDA 3KLQA 3VFRA 4XBGA 3SQOH 3RYMA 3VGHA 1QSEA 1VENA 3JV6A 3HU3A 1DTUA 2EDLA 4TSBH 1FSKB 3BAWA 2CIKB 3QPQC 4KK8C 1KYOK 1BZ7B 2C9UA 5T1KB 3MNWB 1GS8A 3L5WA 1SMYD 1MW3A 3NCFB 3WYRA 3TONA 4XNXL 5D2LA 2XXFA 3CFMA 4JZNA 4X9FA 4JZJC 3AQZA 4IRJB 5D70L 1CD1B 2X5PA 1A6PA 3KXFB 3SBQA 4NRYA 3FUHA 3GTQA 3EOBB 4ZAKC 4FABL 1UZ8A 2D7OA 4D9LH 3DOSB 1NBYA 1TF4A 5C0NC 1OAYL 1A7OL 4PJHA 1K2DA 3Q43A 1OAXH 3L5HA 4BDVA 1JXFA 3VDCA 4LARH 2NYZA 4UV7H 3I2CL 3WXVL 1L9TA 3O0LA 4QHNA 2Y0SA 2NTFB 4LHUB 4XN7A 4G80A 3GTTA 1RFDH 3P4MB 2MOVA 4LPWA 4YDZA 1ED3B 1Y7VA 1OSZB 1QYGH 4UTCA 4YK4B 3KD4A 4R9HA 5DVPA 2AP2A 1ZK9A 2XN9D 5JPNC 4WV1A 4Y8DC 4WK4B 3WBDA 2YBGA 2DD8H 3ENGA 1VPOH 3VFOA 2ITFA 5H94A 2J44A 3JYCA 3H55A 3K71A 3UBXB 1JHKL 1TG8A 3MDJA 3HVNA 1XGYL 4W6WB 4IYKA 4PB9L 1J8HE 2AHIA 3MGOB 2F54E 1XFPA 1YEKH 1OHQA 4KI5C 4KJQC 2OR9H 1T80A 4C56A 1UOVA 2EEAA 2KC0A 3B1TA 4FNRA 3X2JA 4KUZH 4WUUD 5D4JA 4W9GC 4DP6X 3X2PA 2R69H 4RGMC 4DVRH 1NSNH 2ZCLH 4YFEA 1UB6B 1YEWA 1M6OA 5BJTA 4BRJA 4K3JH 3RQ3A 1A7QL 4IK7A 3VXSB 5FCSH 1J1XL 1Y4ZA 3L95B 3P3TA 3APNA 4Z7NB 1MWAL 4MA1B 3C5ZC 3STLB 2XTJB 4Y4FD 2EYSA 3DJZA 4I13B 5IREA 3QDGE 4TUJB 4N8VG 2AXGB 1PJWA 3GNMH 1ZEAH 4PHXA 5ERWB 4M56A 1JGDB 4WUKL 2O5YH 3ULSA 3GQFA 4J12A 2GJPA 3ZE0F 3D85B 4MCYA 1GRWA 1UM4L 2QR0B 2CK0L 4HOZA 5CMAA 5E6UB 5HHMB 1RLWA 2Z31B 4TLTA 5DI8A 1G9NC 2RCSH 1Z9SA 1H3TA 3QI9A 4IDJH 3Q9PA 2I5YH 5I1LA 4PVNA 4EUPA 1V27A 4JFDD 4ZSOE 5BUGA 2X9WA 4JFHD 1E2WA 4PR5B 4XMPL 3BUBA 3QUML 1X7QB 5EHFA 3RKDD 3WO3B 5KYWB 1CFVH 3IRPX 4ORGA 2BVQB 4BD4A 4DVBA 5C3IA 1CE1H 3V4VB 1FL3A 2X9XA 5DJCB 5GISL 3W11D 1DQKA 3AU0A 3BSZA 3FPYA 2IXQB 1RXLA 4TNFA 2P28B 2WBWB 1UWEL 1VCAA 3WNKA 4NDMA 4RMUA 5D2NE 1RP9A 2WWMD 5DC4B 4N4YB 2AK4A 5L8KB 4NM4L 3BCFA 2YLKA 4KO6A 3DK0A 4WW2F 5E8EB 3O41B 5DYOA 2H3NA 2ZUUA 4KJWD 5F9OH 1YMMB 4X80H 3CDZA 3MV7A 1OGSA 1SJXA 4R0LA 4FQXC 3RWIB 4HGKC 4B9IA 2EO7A 2O6DA 4NZDA 3V5KB 5IOPA 2QVMA 1DEEA 1IM3D 2NY5L 1OVZA 3V7AE 1MVUB 2X28A 1YEFL 5J57B 3KPSA 4G8EB 1HE8A 5I6OA 4AQZA 3IS0X 2ENQA 2XYCA 5D7SL 1TJXA 2E7MA 1Z32X 1J9SA 4JZOA 4WW1B 4DZ8A 1U8IB 1RI8A 4JAMB 1I1CA 3VQMA 3CLEH 2NZIA 1E4XL 3RA7L 1J48A 3OB0H 3GSNH 5DSCA 2XETA 3RDJA 2A74A 5C92A 5GRZA 4IU2B 2WWKO 2Z6FA 4PJBB 4Z6AT 1DBJH 4JHBA 7TAAA 2F7QA 3EBAA 5EZJB 3FOMB 1OAQL 1HI6B 4FYTA 4HEPA 5H8DA 3JQOB 5I1JH 2YWYA 2GSIB 1PT0A 3OMZA 1XH3B 3H42H 5A7BA 3MRJA 2QV4A 1BQLL 2ZONA 3C9NB 1K5NB 3CTTA 3GMMB 3OV6A 5LVEA 3Q44A 4JUSA 3KMDA 1IGYB 1CO1A 5EIIA 2X4OB 1MFVA 4HUVB 3MLUH 1N8OE 4WI5A 5KSAB