4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
1HD5A 1OA9A 3SULA 1WHPA 2AE0X 2PJJA 2PICA 4L48A 2BH0A 2PI8A 5GLXA 5H4UA 2PNWA 4FFTA 3X2MA 1WHOA 3X2GA 4JJOA 1BMWA 4JP7A 3FT1A 3X2IA 4JS7A 1WC2A 3SUMA 3ENGA 4FG2A 3X2KA 4FG4A 4ZM7A 3SUJA 5GM9A 4FERA 2KQAA 3CZBA 3X2JA 2VXQA 2G6GA 2G5DA 3M3GA 3SUKA 3X2NA 3D30A 1BW4A 1OA7A 4JCWA 3X2HA 4AVRA 1N10A 1BW3A 4JP6A 3X2PA 2GAEA 3X2OA 3FT9A 2JNZA 5GLYA 2HCZX 4ENGA 3X2LA 1L8FA 2ENGA
chains in the Genus database with same CATH superfamily
1QLEH 5D71H 4FYRA 3C5JA 4FFZL 4NO5A 2QMJA 1EMTL 1KTLA 4ISVB 5E8PA 1S2EA 4WW2A 4LOUD 1SRDA 4KK6C 1IKOP 4GSRA 5T5NF 3PWPA 2X4PA 3KNBA 2EYTB 1JMXA 3DTXB 4U1HA 3WFDH 2BOCA 3H2PA 4NWTH 3LS5H 2X70A 2DQUL 4HETA 1SDAB 5EIIB 2JELL 4LLAA 1E2WA 2ZKMX 3TVMD 4OZHE 3PAYA 3CX2A 1D5ZB 3NIFF 4JPIB 4LOVA 2YBRA 1ETB1 1KPUA 2CR6A 2ODHA 1U36A 2Y7LA 2CDGA 3UYPA 4HIXL 5T33L 5FXCH 4UB0L 2FX7L 5BNXD 4MRCA 5FYJE 5T1LD 4X5RA 2NY0D 4KO6A 4XMKL 5C0EA 3C75A 4YMPA 1AE6H 3EH4B 1I31A 4PRHD 1QQDB 4OIFA 3GC3A 4KZEH 4PB0L 4Y19D 2QADC 4XP4L 5ACZA 4X6BA 4RVBA 5GS2H 2N56A 4HV8A 5BRPA 2FJGA 4X0KA 3HCVB 4FNRA 5KS9F 2PJJA 1FNFA 3A23A 1IRAY 5F0JB 3QR0A 4HH9B 4X8CA 1YEDA 1QMUA 3UO1L 1FZJB 1UUSA 2R0WL 4G8IB 4KXZH 3CN3A 4LEEA 3LPWA 4R2GD 5D93C 1WFMA 4P23A 1O75A 1S3KL 4JLRA 4OJAA 1Q9LB 1XGTA 2CO6B 4RBPH 4Z78A 2BNQB 1CT8A 4W9LC 5HDOA 3N9GL 5I1CL 2OR8A 1J8HD 1L6XA 1W9XA 4N2LA 4NZJA 4ZZFA 2E5EA 1JI2A 3SGJC 1WCBB 2OTPA 4PUBL 3ARFC 3RIKA 4RIRA 4D9LH 2K6ZA 4JGMA 4BFBD 2WLLA 2X28A 3TT3H 2HT2D 5IBUB 3GO1H 3BAKA 1C5BH 4RDQF 3EO0B 5DZLA 3FOMA 4HJUA 4AEHL 1FBIH 5IVXF 4Z76B 3D69B 1NOLA 1J1XH 2Y5TB 4PRAB 5K9KA 1I1YB 3KVDD 2N1KA 4MQTB 4FJ6A 4IU2A 3PQYA 2G60L 1LO5A 2OR7A 3CFEA 5AOJA 5EU3A 4UTBA 3PWJB 4KXAA 3A67L 3MRIA 2EIDA 3CG8A 2ADYA 1OM3H 5IM7B 3OR7B 5IB3B 4E68A 4N5UA 1H8LA 3WLBB 3FU6A 3ZUCA 1DVSA 4FGMA 3GBNL 1XD0A 2MCG1 1QFUH 3PWNA 5AVVB 4APQA 5HSFA 1Y6KR 3MRFA 2DIJA 5E4EB 2I7SA 1BF8A 5GRUH 5DVOA 1MFDL 5B1BB 4U33A 1KGUA 1TLMA 3DSNA 3K0YA 4FKEA 3QCTH 5L4FA 3SJVD 1J1OH 2Z9TA 3MLUL 5FO8B 4CL7A 1CGYA 2BDNH 1KZYA 5IHZA 2NY1B 2VUKA 1K5WA 3VXTB 4NKOB 5EN3A 5E7BA 1J48A 4KJWD 2EDTA 3ZE1F 2ZTBA 4MCYB 3H9YA 4ZK8A 2RD0A 1CGXA 1AZRA 2WLIB 2X42A 3QZBA 1IMHC 5HD8C 1OALA 1K4CA 4JR9H 4PWKA 2L7JA 4EQ2A 1EEUA 2ZCHL 4X6CB 1IE4A 3VRLF 4MD4A 4NFDA 2ZPKH 4HS3B 3OKLA 3WIHH 5D7IB 1E61A 3VI3F 5I1AB 4BFIB 1FHGA 3ARBD 5E2VL 3JWOL 1J0YA 3CHXA 1MJ7H 5KSAD 3RY5A 1E5CA 4UUJB 1MH5A 2DLFH 1Q0XL 4FX5A 5DQJA 3FO1B 5CXPA 5H2BB 1J9SA 1KLGA 1IX2A 3UJTL 4LAQH 1BW4A 2WKGA 1E32A 1CFQA 2YJLA 1P7KB 3V10A 1JPFB 3TN0B 1QR1A 2VWEC 1OY3B 4PRPE 1X5JA 4K7FB 4P23C 3BE1H 1UYWL 3L4TA 3C5ZC 4FEIA 3EFDL 4UU9B 3L5XL 1XIWB 3P4MA 2XQYG 1MCRA 3RWCA 4EEEA 3ZYJA 3ROOB 1PLBA 4B0MM 5F9AC 2J5LB 4S1DC 5C0DA 3OKKA 3S37H 3Q06A 5SWSA 2DYPB 4LHUG 1BVOA 2ADFL 4JFDB 1SUJA 3NCWA 4U6HA 5AL8A 1PDKA 3QNYA 1CFMA 4I3SL 4BDVA 3BP5B 2FBOJ 2IWKA 2NZ9D 3PGCA 2R1YB 2VDNL 3SDYL 4XC1L 3GD1C 3L16A 4YIQA 1F4YL 2L8AA 5GS3A 3WTVA 3RZWA 4FA7B 4ODBD 4LSTH 4YQXH 4LIQE 3TFBA 1U8IA 4FFTA 2BNQD 3T0BA 1A3QA 2VXTL 3NCJH 3QPXL 5E99H 5ACLA 4ZXBB 1XIWA 5AYUH 3ZK0A 2I26N 5K59F 5D7IE 3HKZA 1M57B 1TT6A 4J3XA 5E00A 1Z9OA 2ZYRA 5D1ZI 2K9FB 4W6YB 2UY7B 5I6KA 5HJBA 4E9WA 5LHDA 3F84A 4DKFH 1PQZA 1T21B 4Z3JA 3EADA 3PYCA 3O6KL 2APWA 3BP5A 4L3CB 1F3JA 4OD2A 4Z7NF 4L8CA 2C5DC 3O4OC 2IFFL 4I3SH 4HFUL 1XF3B 3KLKA 1RUPH 3GBML 2OJZH 4HWEH 1CBJA 3X2GA 1QSFB 5DDHB 4BFGA 5I5RA 5EN2B 2XN0A 2V33A 4YC2C 2E46A 4IQHA 1PZDA 2LLGA 2P52A 4LLVA 2YGOA 4CSSA 3M7FB 4PCYA 4ZFGL 4ZXBA 3D30A 1BXVA 3CFCH 4PV9A 4XP9H 1EJOH 1A4JA 1EFQA 3IXTA 4PLKD 4BRVA 3ZTEA 1ET7A 4LZKA 1A6TB 3C5SB 3TC9A 5ES4B 4MA8L 4RRPA 5TQ2H 4DWHA 3H7BB 3KWWB 1JFHA 4TRPH 2FEEI 4HU2A 3GBEA 3G5XB 3M46A 4RLDA 3NCJL 1HI6A 4DP4X 2YXVA 4I9WD 4Z7IA 2VZTA 25C8H 1KB9K 1RPUA 2OXHB 1CGSL 2UXGA 1UT2A 3CH1A 2A38A 3FBQA 5IVXA 1SHWA 1RK1A 4O2CB 1FZMA 2VDRH 3GHPA 5L9DL 4MA3B 4JN1L 3QI9D 4Y4HC 3DRTA 1BVKA 1E6OL 2QHRH 2ZUWA 2DI9A 1DQIA 1SYVA 5E1HB 2EXWD 2W65A 3NAAH 2C3WA 2VDLL 4BYHA 5I15L 1Q1PA 2YRPA 3D09A 4UAHA 3QAQA 2X9YA 4TUOA 2X7LA 3TVMA 1NCUA 4IHBA 5AVRB 4E42B 3GBLA 1GZHA 5E1AB 4G11A 1E4WL 3AGWA 3HLAA 1IFRA 2I69A 1IT9H 1TOXA 2E7MA 3LEVL 1AFVL 1N4XH 2W9EH 4IBYA 3PGFL 1HXKA 4GW4A 3MNWB 3DV6A 4BE6A 4IKLA 3KH3A 1BM3L 4ZAKC 3JWNH 1AR1C 2C1OA 2C7UB 1KQGA 4IBZA 4FD0A 3MRLA 2TRYA 3OGOE 3CPLB 1S7VB 5B8CA 4QMEA 4J4PD 3ESNA 3AXIA 3B2UC 4Y9CA 3UL4A 1MLCA 5EOCJ 1FYTD 5HHMD 4ADIA 4C83A 5L2JB 4FXGA 2XWTB 2N4IA 4X4ME 5IFJB 3RJQB 1NBZB 2NY4D 3QO0A 4LLMA 4XXCC 4PJBA 4FNSA 3QZWA 4LLDB 3WNPA 1YEKH 3WAKA 1NGXA 4LPUA 3UPCA 4M1GL 5BO1L 2FJHB 3NOIA 3BVWA 1EIBA 3D85D 4M3JA 4X5XA 2EDQA 5CGMA 4V1DD 1T1YA 4PGDB 4N0FB 1BXUA 1FH5H 1RI8A 2I9LB 1M1XB 4G9FB 4QF1B 1RPQA 2EIZA 4FS0A 2ZUYA 2PWFA 5JO5A 3K2UL 5DUPL 2EUZA 4AIZA 3LEYL 5IROC 5JPMC 1OPGH 4MNGE 4NP9A 4CNIB 2QKIB 3TBVB 5IF0A 4XMPH 4L23A 3S3SA 1JXFA 3B43A 3D9AH 3Q8CA 3BP7B 1R5WA 3I9PA 5E6ZA 3S7GA 2EE9A 1EVUA 1QFWI 1IM9B 3TYFA 3NP4A 3TZVA 4K5PA 1HEHC 2WCGA 3TH4T 3LKRA 3QPKA 3EGDB 4HEME 4MD5A 2VKWA 1NCDL 1WHOA 4WEBL 2X3BA 4QHMA 4FQCL 5HYQB 3SGDH 3S5YA 2GJZA 2VZSA 4UT6A 5DFVC 5ADPH 2B1OA 1YLEA 3GSNL 1W0VA 5GS0D 3EJRA 5JO5B 1BVNP 1OGSA 2W59A 3ARVA 3GUTA 1QUPA 3TASA 1JHKH 5ADOL 4ODHH 3MODH 1JCVA 1OSPH 5H35A 4C58B 5F9OL 5AB2A 1NC4A 1HIMH 4HXBH 5A2AA 1IC5L 3HBPA 4H88H 2DTML 1EHLH 3ULSB 4WHCA 2OTUB 3UP6A 1IM9A 2PICA 1BZOA 4URTB 3F5WB 2Z65C 3SKOA 4TNVK 3GTJA 1ECZA 2WSDA 1JZJA 3APFA 4GQZA 1JBJA 1JVLA 1FN4B 3V79C 5D2NC 3D18A 4X6DE 1BP3B 3V4VL 1MRCL 4N0YH 1KIRB 1S7SB 4ZUTB 3VXPB 4DUVA 3VGAC 3GMNA 3MV8A 1OO2A 3CUPA 2F74A 1T20B 4PS8A 1QFHA 3RZCD 1FFPB 4Y1SA 3OMAB 3VWKD 4QYOA 1UYWH 1V05A 2H1XA 3ABZA 3ESVF 1W6WA 3LHAA 1RZFL 3ZZLA 2ZNWA 3QJFA 4U1SA 2FT8A 5HI4D 2IH1A 3UC2A 4DN4H 4IEFB 4F2FA 4PIBA 4UOW0 3VJ6B 1C16B 4B7IA 2WIIB 3BGFB 2QFPA 4P5TD 4ZS6C 5KSAA 3FQXB 3PV6A 3UBHA 4HXBL 4DP8X 2CLZA 1BMGA 2AHIA 3C5ZD 3VFGH 2H9GA 2F54A 1JVOA 3ZE2E 3PP3K 4YHLL 5DYOB 2JWYA 4OFYA 2ILLA 4WKZB 3RWDA 4PGZA 3EDFA 5KTEH 4M6AA 1TWGA 4NQDE 1DVXA 3QEUB 2VIRA 1UWXH 3CHPA 1QSFE 5EZPA 5JXAL 3L7FA 1JF6A 4XNXL 4D0DA 4FCAA 1OGYA 1I7RB 2WTRB 2FH8A 1DJZA 3O2VL 5E6ID 3V4VH 3ZDZE 3VXQA 1CVSC 5D9SA 5B4MC 2Z93A 4YN3A 1YDPB 3LKPA 4NKMB 3P9MB 1NICA 4IKNA 3FOLB 3ZGHA 2DLTA 4S1QH 1IGML 2Q86A 5IVNA 4G8FA 4MS8D 2IADB 3CIAA 1CL7L 1J8HE 1LO3H 1H3TA 3WFZA 5AW7B 3FH8A 4AKOA 5LN4A 5FGCB 1NGYA 2LE9A 5DEJA 3TT1L 2ARWA 2ZCKL 4UT7L 4DTGH 1MEXL 2AEQL 1KJMA 1OZUA 2JB6A 5AAWA 3QDMB 1TVHA 3L4VA 1M2OA 4UMGA 3QS2A 1DQJB 3S9DB 2ISDA 1B3IA 1VENA 2XA8H 4HT1H 1H0HA 4M1CD 4PTUA 1LO4H 4J8RB 5DGQA 2YQBA 4Z7WF 1ASOA 2Z93B 1F56A 2NTSP 1SQMA 4JQVA 1G6RB 4XC1H 5BUAA 3TA3D 3MFGB 5KANI 2R0LH 1TZHB 3V4UH 1DQLL 4DK5A 5F9JA 1BQHA 2FEDD 5HGDB 4JO3H 4NRYA 4N6QA 4WKXA 4WWKD 1JZDC 4UTBL 3L1OH 1GL4B 4Y5YA 4K3EL 3QIBA 3VGBA 4HVBA 1KJMB 4N0RA 3SOTA 2IG2L 2EEBA 5DJ6A 1MHPL 5G4NA 1QA9A 1JERA 2JFCA 2YWZA 3NG5A 4PTTB 3BN9D 2A83B 3TBTA 5HHOE 5IQMA 4L8DA 3S35H 3L3IA 3O8XC 1J0JA 4YBLB 3O2WL 5C0RH 2ZYHA 1AIFA 3BZDA 2CBPA 2PW1A 4XVTL 3V52H 3U30C 1AO7B 3G6JF 3X2IA 1N64L 4KC3B 3HAEG 1IAOA 1RIUL 3ZIYA 1SOQA 1B6UA 2WHVA 5D7KD 4HMCA 3VCLA 2ZSVA 5DVNA 3GMNB 3MV8B 5FKAB 1JTOA 3B6SA 3DV4B 3VMNA 3F7VA 3Q2LA 1J9TA 2YD1A 2AEPL 4HWZB 4PJ7E 1ZHNA 4WI7A 4XXDA 5FKPB 1TITA 3K8LA 5JOPD 1KBBA 1XF4B 3DO3A 1HVXA 3D5OF 4PRDB 5HGAA 2PABA 1AXTL 3ULUL 3O4LD 4Z3TA 4KXBA 3THML 2V9RA 3X2MA 3ALXA 1L0PA 4EPSA 4PM1A 1IGJA 3BMWA 2DRUA 5D1XB 3D34A 4M48H 5F88A 3PFUA 4POZD 4DKAA 2YK1L 1EFXB 2X9ZA 2DTSA 3ARFB 3FT3A 3NIGB 3WFBL 15C8L 2PCXA 1AG0A 2BWQA 1TUPA 1Q94B 1F6AA 2VXUL 3VD3A 1Q72L 1CFSA 1WAEA 4GG8A 4H8VA 2JCCB 5KYNA 4DERA 3MA9L 3DJTA 2DEWX 1CU4L 3ROLB 1DFBL 1QVOB 3R06A 5DC9B 3VMOA 4FFVD 5JDJA 5A3IC 2O6FA 2XV6B 1EZUA 1TEFA 1TPXB 3BD4A 1KJ2H 2YFNA 5DF0A 5MENE 4LCWD 2BOCB 4JPKH 4U1IB 2YZ8A 5IOPA 5F7LB 5LXGH 4M7LT 5DO2D 3GTPA 1CLCA 5EO9A 3I75A 4LGPB 2JKRM 1ORSA 4L3ED 4JRXB 1IGFL 1IAIL 5DJXB 4UINH 4YX2L 1YQ2A 4MX7A 1NFIA 2GTQA 1EJFA 1UKTA 1PY9A 2ZUQB 3OAYH 4JO5A 3NSYA 4FLRA 1AY1L 3RDTB 1FRGL 5E6IB 1BLNA 4YFDB 5DEGB 4NJAL 5HI3C 5CZVL 3SD5A 1QLRB 1NBVH 2A6JB 2CKBB 4F37F 1A9EA 2A6KB 5F1IA 2JKTM 3NCYS 1ZMYA 3FUKA 5TPWH 4M6ML 5AOZA 3EYSL 1JGUH 5IW1B 1U2CA 1G9MC 3WEOA 1CDBA 5D2NA 4HKBB 5FA3B 5B7EA 4MCYA 5AYTA 1AACA 1I3GH 3MRRA 4HUMB 3HG5A 1A7PL 2R2BA 4QAWA 2MPAH 3QDMD 4AE0A 4FL4B 4FABL 3BN9C 3M1BA 4LL4A 4AQEA 4UV7H 3NPSB 4N2MA 4IK6A 2EDLA 4MQXC 2G4GA 1IAKA 2XN2A 5DVMA 4KK8D 4TVPD 2CM5A 2GITB 4IRZL 3O41A 1QFWH 1WZ1H 3OKLB 3OZ9L 4RCAA 5EU5B 4HK3J 3UIYA 1YPZF 2Z31D 1P69B 4Z3EA 3HFML 4Z7QF 1Z9MA 5KW9L 4GSUA 2IANA 3BWUF 3O3BA 5C0BA 3O3EB 4KZ0A 1KCBA 1MI5D 2V2XA 2ZD0A 4EUPH 5A2KH 4QT5B 2O93L 1BGXL 3DUHA 3G7TA 5C0AE 1KG0B 4HS6B 2NW2A 1XF3A 2ZXGA 1DO5A 1MFEH 5ENWA 3KPQB 3K46A 5L2KD 1FI8C 4G43A 3SKNB 5EDXA 2OYKA 1X5IA 3K71A 3ESPA 5F2FA 2EVJA 1DO6A 4OCRH 4PJCE 2IPUK 3NDYE 1NFKA 2CA3A 4LOFA 1Q0YL 5DJ2A 2GJJA 3ZO0A 4HWZA 2QQKH 4GMSH 5DJ8B 4LASL 3HHSA 1VZHA 3WEBA 2HMIC 4MMYA 3IDNA 5ALCL 3W1ZA 5HHOA 3OGCB 4P59H 4P4RB 1SOSA 4N20A 2KC0A 2C4FU 2XWBA 4LK4A 2QVFB 4NQVB 4GXUM 3AG1B 3VE0B 1FVDB 3WFHB 1JPFA 2ZX6A 3ARGC 3MV8D 2DYSB 3TN0A 2HT3C 5EDSA 1AIZA 2CK0L 2PI8A 4O2CA 4XGZB 2GTWB 1OV8A 3V4VB 1BPVA 1OP5H 3IFOA 4M7ZB 4M02A 1DSFL 2EYRA 4WGKA 5AYQA 4UCFA 5PAZA 4HLZG 4CC4C 2PYFB 4ENEC 2B3RA 3FTSA 2XOTA 1U8KA 2BIQA 5SX4H 4PJEE 2LV4A 1F58L 3VSUA 4H8QA 3PLYA 4ZW5A 5ABDE 3IE4A 1E27B 4PB9H 3RVTC 2KLRA 1AHWA 1ZANL 5F1SA 2ZAHA 1U3HD 3C5ZA 2F54D 2YU9A 1ILUA 1R3LB 3WJJA 1X5XA 4LQFH 4HH8A 4X6BB 3FB5A 4EN3B 4N0UE 4QTHA 4TOYH 2ORBL 2Q76A 4FTVB 2NX5E 1PKOA 4BJLA 3N43B 2R15A 2VDRL 2APSA 3DOIA 3ZHFA 5M7QA 1AP2A 3UCQA 1I82A 3RJOA 3ZKNC 2CK0H 4LCIH 4FP8H 3OLGA 2Y72A 5KYUA 3FHAA 2IDUA 3DROB 1IBHA 3PGDB 1ASPA 3AREB 3E0GA 5CWSA 2V3EA 1GJIA 1PIFA 5J9PA 1KTKE 1N59B 1MLCB 1UOVA 1VACA 3BLPX 1VIWA 3KH4A 1A9EB 2XQYA 3FZUC 3PNRB 4HJSA 4UTAH 1E27A 1FGVH 1SNRA 3EW3B 1ZRUA 3JTTA 2ZXQA 4FYQA 4L3EB 3MJ7A 4M4RA 5GJSL 3G04B 4D3CL 4EOWL 4WF7A 5ESVA 2VAAB 1DJSA 4HEPA 4GRMB 2ITDB 5JXED 2AJSH 3PE9A 3FU9A 4JN2A 2OX5B 1CFTB 1MJ7L 5DZJA 3MLYL 3DUSB 2YS4A 3D87B 2IGTA 4HMDA 4AQEB 1MNUL 2A6IB 2FX7H 4X8JB 4LLQA 4ZJ9A 3VFPB 2AZUA 3C09C 2NY6B 5CEZD 5EOCL 1UZ8A 4K5NA 3IM1A 5C09A 2HAZA 5F7KC 1MJ8L 2D0FA 2YLHA 3WTWA 2BOLA 2ICWI 4N24A 4X6DA 4TNWF 3EJQA 5I8KH 3OKKB 1NCCH 2G9HA 3TA3A 3HI5H 4BZYA 1CS6A 2CJ3A 1LWHA 1BAFH 5EIVA 4ZFQA 4KHXH 3OSKA 2DL9A 2F53E 3HZVA 3UZQA 1A7OL 2O5YH 4G6JH 4JHVA 3D4CA 4PJBF 4CC0A 1MUJB 2D7OA 1EDQA 3Q1SH 1FZMB 4KKNA 5L4JA 3MRNB 5ENWB 1YUHA 4L37A 3MGTA 1WD9A 3C60A 4Q0XL 2MHAA 4EUPA 5EH1A 1C08B 2H32H 1QWUA 4JFWA 3LB6C 2R8SL 2ICWB 4MAYB 4GBXA 4OD1L 4BK4A 1I9IH 4HPOH 1V3LA 3HB3C 4W9IC 2ZKHH 5BZDB 2O5ZH 2HVJB 5C0CD 5AD0B 4AG4H 3FU8A 4BFKA 4XVUD 4YHNB 1I8UA 5KSBB 1F4WL 5EG6C 3UTQB 3QH3A 4L8BA 4TQPA 3VFTA 2BW5A 2FIKB 2F7QA 2G2RA 2QKIC 3AU0A 3RPBA 1NUGA 1N6QL 1JK8A 1WZMA 4IW4C 2VR5A 1T89C 2ZP9A 2GBVA 2MFNA 2MOQA 2XZCH 5H8DA 4FMFA 3P69A 3QFJB 1TZIA 2GK0A 4PWJA 5L6YH 3MRQA 2P7TA 4RZCB 3MVSA 5F3HA 4WWID 1JYWA 1TEGA 1L4IA 4Q6KA 4Z7UF 4TL4A 2WINA 1M7DB 3TEWA 3AW5A 2RFXA 1IEBB 3FFCB 4JPVH 5A2LH 1EAPA 4C2MA 4G5AA 4UANA 1N6VA 4UIMB 5I1EL 3SE3C 1OEZW 5FA4A 2ZKHL 1OCRB 4HDIA 1VEMA 4R96B 2GTZB 1URIA 2KPNA 2M1KA 4XNYH 4X83A 2Q8AL 3IVKB 1X4ZA 2PP8A 3HJEA 1DBAH 4HCRH 1NGWA 1A47A 1ZDQA 3GB7A 4XNMB 3S8FB 4ABQA 4DGUA 5E2TL 4JKKA 3U0PB 1ZE3H 4NDMB 2BINA 3KJ6L 1OCZB 4GRWH 3UO1H 1RFDH 3AU1B 4R7DB 4A7QA 1SMYD 4GMTH 4BKSC 4H26A 1KC5L 1K8DB 4Q6IB 5T1KB 3E80A 4P2OC 4Z7WE 4LNVA 3GUTB 2HLAB 1YO4A 3BPLB 1MW0A 3E6HA 1FCGA 2DIEA 3WD5H 2YD6A 1OF2A 4N2AA 4MZRA 2UV3A 4OV6F 1FL6B 4Q74A 4PJ5D 4JY4A 4NI3A 1QEWA 2BHYA 4WWNA 3BYYA 3P0VH 3HMXA 3VNZA 3ZRSA 3VFUA 1BF5A 1A7QH 4G5ZL 3IKCB 4ZYKB 4KKQA 2PCFA 3W37A 3IJSB 4JFXA 1G4MA 4YO0B 2C4XA 4MDIA 1KNOA 1YC8A 2PO6C 3LH2L 4XODA 3O5AA 5H4YA 3QDMA 5E94A 2UXTA 5I5IA 1EBPA 2X4OA 2XV3A 4FJZA 3PGFH 1KBVA 3S37X 1WQVT 1HDMB 1N3NA 3Q05A 4TF4A 3GBDA 3SJVB 4GKZB 3HBZA 4X7SH 5D7EA 1CXLA 3U9PH 4U3SB 1A1OA 2XWJB 1MRFH 4LDLB 5BUGA 2AXFB 4IOFC 2MNJB 2M83A 3VTAA 3QQ8A 4WY7H 1C16A 5LG1A 4X5LA 4ONHB 4EKXA 1OTTD 4RAUB 3MJGX 2RACA 4YE0A 3VYOA 4D7PA 1U6AH 2G75A 3MCKB 2NCEA 5FYKE 5C0RL 2DF3A 3DPDA 1G9NH 4F93B 1VAHA 5I0XA 1PGRB 3CK0L 1CGTA 2P3YA 5F3FA 2QKIA 5IF0B 3TBVA 1R27A 1FNHA 4PRIE 5L2KA 2LTQB 1RIUH 3S97C 3B9KB 2WWOA 4I13B 4OJFL 1UVQB 1IGTA 3DPBB 1MDTA 3QNXB 5C0BE 2HVKA 1F42A 1DTUA 1BLIA 4N5ED 3IDIA 1XBRA 5IHUL 3ATAA 3H3PL 4WI4A 3NSJA 3PV6B 4E9QA 4MD5B 2VR8A 1R34A 3QJUB 2AQ3A 2QPUA 4GEJA 5D7LB 1LE9A 2B08A 2UYLA 2XBTA 4B9YA 1DQML 4PJEF 5DRNB 2JV6A 3NCCB 1F3DH 2YGQA 1I8KB 2DH2A 4P46D 2HWZH 3IR6A 4AM0A 5CILL 4HIEA 4G3YH 3TN0D 3WOVA 3RI5F 1T0MA 4IS6B 1KTLB 2Y5TA 4ISVA 4PRAA 4UTBH 1XR8B 1XCWA 3AB0C 3O6ML 3NQIA 3SCMD 1QSED 1DQJA 1M3IA 3IVKA 2LTQC 1EERB 4YGVA 4U3XA 1FZOB 2R9HD 4DEWA 2CIKA 2IH8A 4KKPA 5CR8A 2MQ3A 4LB8A 5C08D 3TJPA 3RBGA 4L4VE 4NQEA 1E42A 5IB3A 2DYPD 4IGBC 1T04B 4RA3A 4I3RL 3N1PC 5GS1B 3ULVD 1ZTXL 3QQ9D 1WFUA 3NCBB 4I48A 3WG7B 2ZUXA 2UX6A 2V8MA 3M86A 1IBGH 2V8LA 3F7YA 1UHVA 1G5GA 4IMKA 2ZWZA 4K8RL 5D1XE 4LSPL 3O6FA 4KKRA 3TIEB 1LGVA 1IKNA 2AKRA 4JW3A 5EU6E 3K4ZA 3P0YL 3T09A 1NBZA 3QO0B 1LE5A 1IC7L 1FFPA 5EA0L 4FA6A 4B3EA 2JQMA 3BKMH 2H47C 1T1WB 4NZFA 5A2JH 3QJTB 2Q6WB 3GGWA 1XR9B 1VFAA 4EDWL 4UDUA 1RVFL 2BVQA 3WJMB 1DVTA 2CRYA 4Y7OC 5GJTL 3ZZSA 4CBZA 1RZ8B 3DBXA 3LXCA 3QDGD 5FB8B 5I8EB 1H6FA 3HZKA 1SJHB 4HUVB 4H2AA 1CPUA 3ABLB 1BPLB 2O6DA 2R4RH 4MQXD 1G5AA 1HFUA 5C3IA 1TWFA 4ZYKA 1OQXA 4OBSA 5CN2A 3F7YB 4CS0A 4B41A 1MG2C 4RFOH 2XWEA 5IQLA 4H0IA 4BIKA 1KPRA 2Q3XA 4ELMF 4G59C 1ET5A 1TQTA 2QGBA 3L2LA 3H9ZA 1B0WA 5KTEL 2YPVA 3VD7A 1IV8A 1XGZA 4NO5B 4WK0B 3SCMC 3VW3H 1U42A 1A7OH 3MRBA 4DN4L 3ULUD 4U7KA 3TBYA 1IBGL 3ESUF 1B0IA 4WFGE 2DY2A 3N6YA 1VFAB 1E50A 4GKZA 1SVCP 3JBG7 1CO1A 1QO3A 4PVMA 2WOYA 3ARRA 1GAFL 1H15B 4Q56A 2XJKA 1C12A 2VDQB 5EEWA 4PJFE 1GVIA 2EKSA 1T3FB 1NUFA 2GJRA 3QJSB 2IGFL 3TL5A 4AKQA 4TN9A 4G8FB 4BZ2A 3MACH 3JWOH 2EH8H 2WK2A 5DFAA 2ADGA 5ISZE 5FUOH 1IKFL 4ZFOL 1OF0A 2Q7NA 4Y2OA 3O6MH 3KMDA 2VERN 5AKSA 3FN0L 3FTGB 1PLCA 1OE2A 2B4CH 3TH2T 3NZHH 3PQYB 1R0AH 1OM9A 3QI9B 5KJRH 4ZFFB 3ZOAA 2QELA 3T0XA 2K4AA 2GEQA 1FORL 3HUJB 4OTXH 2DOCA 2QTEA 2J4WH 4MMXC 3UTPD 3D08A 1CL7H 2VXSL 4UBDC 3I3DA 4GBXD 1J10A 1L9TA 1AQMA 5C0CA 4HX1A 3MKGA 1E4WH 2K8MA 3TBCA 3WU1A 2X1WL 4PJDF 2DMBA 2X6VA 3V4UL 2R9HC 2NXYC 1CZ5A 2FNWA 2Q5BA 4AV5A 4B60A 1SF3A 3P11L 3U6RB 3SQOH 2XCMC 5DRXB 2ZUQC 1DN2A 3JV4A 3NFSH 1S3SA 1E60A 4NQCD 1KUMA 3VFSA 3BSZA 5CJXC 1I9JH 5A7BA 1WC2A 2EINB 3MACL 4NC1C 5GJTH 3R4RA 1LEKB 1SEBB 2CO4A 3DVIA 4JFHE 3D33A 4N2OA 5F1IB 4P4RA 3WN5A 2VOTA 4WEBH 3SDCB 4XMVA 3GMMB 1DBMH 4K9EL 5HHMB 3L3KB 5DC4B 2Q0ZX 5J0BA 1TTAA 2KZWA 2AQQA 2IAMA 4AI7A 4CRPA 3AUWB 4LVHC 5HTSA 1BM3H 3MNVA 4UQAA 3WNOA 1U2YA 4P3DB 1GJWA 4ETQB 4JJ5A 3EZ8A 4PRBA 4W4OC 5DHDA 32C2A 1P7BA 3UBFA 4MSWB 3RIAF 5C08B 3L54A 3X14A 1S7WB 3HE7C 5AZ2H 3QO1A 3T0EC 2MCMA 2NLJA 3VDBA 3MREA 4NUMA 3DX7A 2HTLC 1P7QD 4G5ZH 2Q7AA 2OSLA 1YEKL 1SDYA 4N87A 4XBGA 2BERA 3OG4B 2IANB 4R6UA 3WN5B 1FNSL 1C8QA 3U9UB 2B5IB 2Q8AH 1P4BH 1C5CL 1TQSA 43C9A 5IR1B 2BP0B 4UTAL 2QVTA 2R4SL 1S6NA 5D4IA 4DGIH 1WC7B 2CHWA 5I1IL 4ELKB 3FSOA 4QRTA 3ARFA 3F05A 3GLDA 4B9GA 3BHBA 2H7WA 4UNVA 3FKIA 3LPPA 2O4EA 4XXWA 4OJCA 3SGDI 3SKNA 1KGXA 4E41E 3V2AR 3S88L 4FFYH 5AWNL 1W91A 3QDGB 4FQHA 3R7RA 2CLRB 4NHCH 4F3FA 4TOYL 3ELAT 3QXWA 5CP3H 2ZWLT 1JNNH 1P6WA 4LKXA 3OGCA 2Q2LA 2XWRA 3QG6B 5DRWA 4TQEH 4XCYB 5D6DA 3TJHD 2I9TB 3L4XA 5TE4H 3U9UA 5C2BL 2V2TA 4AYFB 3WHXB 2FGZA 4Z3GA 1XZ0A 4PJEB 4KPHL 1JYXA 2K3HA 2VDOL 1OZTG 4AOKB 1VCBC 3A4FA 1BBJA 2N7SA 3NCMA 1EO8L 3IAGC 1UZ8B 5CINH 4KH2A 1CXIA 4DO6A 3G08A 5CHNB 3GHEH 5SWZB 4YHZL 1SXZA 5HBBA 2D31B 3CX5K 3V0GA 1A3RH 1ZVNA 2A83A 1Z9PA 3D2UD 4JHWL 5DVPA 3QA3A 3EIFA 2XWTA 4LSQH 5F7NC 3MMEA 1TQBB 4FNLL 4OZIB 1OB0A 4J3VA 1M3JA 3HMWL 2YMTA 4QCIB 2MCPL 4ZT1A 1ZA3A 3HS0C 4ZAKD 1CE6B 1ZHKB 2BVOA 3U1SH 3VWKB 3TOPA 2ZCKH 5EN2A 1F90L 2Y23A 4YWGL 3WE1A 4Z7WB 2YXWA 2NSXA 2R29A 4GFTB 4PIRF 3MTRA 4E41A 3T0AA 3CF2A 2XBDA 3ULVF 4JQXC 1AP2B 1MFDH 4KJYB 5D71L 3BO8A 5DS8B 4QHKI 5E08L 1QBML 1TSRA 3MLXH 3ZDYF 3V6OE 1GGBH 4LIQL 4KHTH 3VGEA 4F5CA 3PIQB 2NY6C 3TCLA 3FF7A 1G87A 5GZOC 3DOSA 5IJCC 3ASOB 5KSBA 1PQFA 5DK0B 4P46A 4KI5D 4NT6A 5MEQB 5JYMA 2ESVA 1RD6A 1ZXQA 4S10A 1ZT4B 5IB5B 4E5XA 1I8LC 4JY6A 3GRWH 3PWNB 4PJHE 5BRZD 1WZ1L 4K8RH 3GI8L 4D0BA 4RMBA 1QUNB 3HC3H 4BWWA 4XHJC 12E8H 1DBBL 32C2B 4OFPA 5HHVL 1KT2B 2WKOA 4JO8A 5EBMA 5IBLC 4IIQB 4FABH 2F61A 1CFNA 4FRWA 5GGTA 4B96A 3RG1C 3TNNA 1LTXA 4I0PD 4F58L 4JFOB 1UEMA 2C4FT 2E27H 4Y9EA 1PS3A 3PWUB 5KVEL 3OF6D 1U8CB 3US9A 3VD2A 3VI4E 3ZL4L 3CVHH 2A4EA 5FTMA 5BUPA 5IKCB 3MUGA 3H3BC 4RX4A 1T0OA 5KYXA 5FM5M 2IV9A 3QUZA 5B3SB 4QRUB 4RISH 3R7QA 2D3VA 3WGUB 1MFMA 3C8DA 3MKKA 3ZL2A 3HFFA 3KG5A 4GAAA 2XT1B 2RQEA 3AJ7A 5T1DL 4U6TA 1MVUA 3C9NA 3EYVB 2Y7OA 2VM3A 1WS7A 2HLEB 3AY4A 4AUUA 4HFWB 4I18B 2VB5A 5DQJB 3N1FC 1XEUA 1GYVA 2HRPH 5E0QA 3O11A 2BFVH 1MELA 3FN0H 4OUUB 2FWOB 3HC0A 4AK2A 1XH3A 5JW4R 5EUOA 1HHIB 5T1LA 3W39A 1ZLDA 4M7KL 1K8IA 2VQ1B 4RGND 5FF6B 2L7UA 1ZT7A 1QNZH 1BQ5A 3E3QE 4O9HL 3RQ3A 4JFTA 2H3XC 1T1XB 1ZANH 2X40A 5D1ZB 4U6YA 1T7WA 1BWMA 4RMRA 2E47A 3N42B 5JQHC 3CCHA 3CHOA 3ZKSD 3L4WA 3IDJB 4P2CG 3FQ1A 3GDCA 1RJLA 4R26L 4Z95L 5DSCB 3II1A 3OJDA 1XCTA 1JL8A 5MP6L 3ZVVA 1EPFA 3ZQXA 2DQTH 3VFTB 2YD0A 1XD1A 3J27A 2V0AA 1E5ZA 2QEJA 2HKHL 1S7TA 4H5SB 2BSED 4KQ4H 3OXRB 4FLHA 4TS6A 4MMXA 4NOFA 5M95B 3FCGA 2V7HB 4DZBA 4NBYB 3GHBL 3N40P 2YQGA 1RY7B 4HHWA 4ZMAT 3TFKD 3AWFA 3B3BA 2Z1PA 4QY8A 3NCEB 5ISZB 1JHTB 5IB1B 4DKTA 4DP1X 1JE6A 5ID1A 2ATKB 3X12A 1NLDL 3CCHB 4L05A 5CEZL 3WIFA 5CD3A 3VG9C 1EH9A 2VN6A 4MZ3A 4PVLA 3WFBH 4EVNB 4OFQA 4C47A 3P73A 3BWUC 1DBML 1A7PH 4K15A 4K9EH 4KVNL 4ACTA 4N4YB 2X0VA 4NQVA 1NKGA 1FDLL 3BUBA 3M1CA 4IOSD 1WIPA 5A2IH 2B0SH 3LIZH 4CN4A 1AKJB 2AERT 2RJMA 4A2FA 4AJYV 4ZUUB 1MWAL 3SPVA 3QGVA 1NLBH 3IJ7A 4N8CL 3FYIB 1KXQA 3OAWA 3T6WA 3CLFL 4QIRA 3LKQA 2XKNB 5GGUA 5T1DH 3VFGL 3K0WA 2FX8H 3HAEB 2KI8A 1TENA 3FPXA 3IB4A 5KW9H 2GBUA 3U48A 5JIQA 4KZEL 1UZGA 1ASQA 2C9VA 1AMXA 1YEJL 2WXFA 3HTLX 3MRGB 3UZEA 5HDBF 1GS7A 3WIFB 4QKTA 2NUPA 5EOCH 2R4SH 4XNQA 3LEVH 4NN5C 3RWEB 1KCWA 3NPZB 4AYDC 3DIVA 2P80A 4APQD 4KKZA 1FNLA 2EC8A 4N0CC 2EH7H 3RDTD 1MY5A 3KPOA 1L0QA 4V11A 1AQ8A 1E4XH 1LD9B 4JPKL 2R8SH 1NBYB 3WNIA 2EEDA 3I9IA 3I6LE 3SJVA 1BZQK 3WIIH 4TNEA 4WIQA 1FVEA 4R90H 4HIHA 4GW1A 1NJ9B 3OB0H 5IMOA 3A3YB 1D5BA 4WSGA 1YN7A 4I0PB 5AKVA 4ZW8A 1P2CB 1VZIA 4X4MA 3ZDWA 3DRTB 3GS4A 5GXBB 1F00I 3HPJA 2V9TA 3EFOA 2H9GB 1AO7A 4LRNL 4CVWA 3FH5A 5GGVH 4ONHA 3O3AB 2VERA 2Z7ZA 1BDYA 3BISA 1LEGA 1TR7A 3MRHB 4HK0A 1SUHA 2GI7A 1CWVA 3UTZB 4QXUH 3OR6B 4L4VB 2XUWA 4WENB 5GGTH 1G8KA 4JFQB 3IU4H 1J1OL 3L7FB 3U6XS 5BRZE 1MFNA 3PDGA 5F9DC 4NYLA 1HE8A 4Z7NE 1I9EA 1ZLWK 4AVRA 1E0OB 3QHZL 3Q8EA 2HRHA 1XH3B 1HK6A 2EQDA 1HHGB 1S9YA 3BQUC 1HHIA 1T0NB 3AWGA 1E4JA 5LAXB 4MB3A 1U9KA 2K78A 2GJZB 5AAMC 2CG9X 1E28B 1R3JB 4WFGD 5GRYA 2B2XL 2BO0A 4HK3N 2LU4A 1CR5A 2CXGA 4M5ZH 2AEOA 2D03L 1R5IB 3VUAA 3KR3L 4HPYH 5DHEA 1E67A 2J55A 5C6TH 2EEXA 3UMTA 3TWYA 1ZEAL 3STZB 3PHOB 1X7SA 1XGRA 5KG9A 3WFDL 4DP5X 5C0EB 3VM7A 3UC0L 4UNUA 1FPTL 1M56B 4C57C 3X2OA 3RNKA 2GIXA 1PZ2A 2PYEB 2XSKA 3CAFA 1MOEA 2W0FB 3OKNB 5AVXB 2X4SB 2JELH 3PP3H 4EJ1C 2VITB 3CFJA 2Y1VA 5GISH 5C7XH 5IEHB 3S5ZA 2XN1A 2R93A 1FN4A 4WZ9A 3UJJL 4BFFA 3ENEA 5SV4A 4EKJA 5E8EA 2ZAGA 2Q1EA 5KVDE 4X99A 2YUXA 4M43L 4PJFA 4X98B 3NH7H 2YPVH 4M5ZL 4P2RD 4JDVA 4R8WH 5A3ID 3BH8A 3QJQB 2OMXA 3T8XB 2WANA 4Y16A 3VFMA 3KPRE 2CO6A 4WNQA 1GW0A 3GRWA 1SN0A 2DTMH 3MRDA 4FZ8L 3N44F 3FZUD 4ZOEA 3B2PA 1MCFA 1YEEL 3T3PB 1W72B 3MA7B 5ISZD 1UKSA 4MHHG 3VA6A 3OM3B 5CZXD 3N41B 1I1RA 3BD5A 4LRNH 5BW7C 4ONGH 3MRCA 4LESA 5TK2A 2F54B 2IOMA 5HYQA 1T7ZA 4GAJL 2JVUA 3KLAA 4UM9D 4YFLI 4YZWA 1CK0L 5J1SC 2WINB 4MJ5A 3E9TA 4AJ0A 1IAKB 3A4EA 1BVLA 3FONB 3LZRA 1UB6A 3CXFA 5JTWA 4UV4L 4IRSA 3BH8B 5DHVB 4G8GD 1XB3A 3RPIB 3VQ2C 3GMOA 2LFGA 5I0ZA 4LVHB 1U91B 4KHTL 4L4TB 3VQLA 5I75B 4LT7A 4KY1L 3L48A 1T66C 4EUPG 5JOEA 2DS4A 4OF7A 3ZE1E 2WYZA 4YNYA 2XPZA 2V2XB 1TNNA 2UXVA 3IDIB 4OGZA 3LKSA 4JZNA 1IEAA 3SKMA 2Z0UA 2G4EA 1G1OA 2O61B 4ENZA 3QYMA 4PJ7B 4MJIB 4WWPA 5HPMB 1U4EA 1V8HA 3S36L 2XVLA 5TH2A 3FRPB 1FVCA 3MBEC 1KWKA 4HFUH 1NANI 4KH9A 4QWWD 3OJ2C 4KDTA 2ZKWA 1H3GA 1A6VL 1KCVH 4HIJB 1RMFH 4NERA 3QUZD 1JV2B 2K3TA 3SSGA 5GZNC 2WVUA 3IXAA 3X13A 1AC6A 5I1JL 3MGAA 2CUHA 5EV7A 4XO3A 3UABA 5D6DC 1SDDA 1QEXA 3MYZA 1X44A 3FTUA 3IRZA 4U1IA 5T3XE 4XAKD 4C56A 4DEPC 1J1XL 3GM0A 2CIKB 3PG2A 2QMKA 3LNHA 2F18A 4JFYA 5CLXA 3OD3A 3K1KC 3QFDB 3MJ8B 4WV1A 2G5UA 2GQHA 4MMZB 2E7LC 3NIDB 3FMGH 2FR4B 3GMLB 4GAGL 4KJPC 2GJ6B 4B9PA 4GA6A 3E8UL 3IRPX 3CTTA 3UTSA 5J57B 4HF5L 5HDBE 3O6FB 3WLWD 3N5AA 5SV3A 3FXIC 2J1WA 2BVPB 2VLRB 2CHDA 3PAVA 2XG4A 2DQDH 3M7OA 4KHXL 2HJKA 1MH5B 5T5FA 4HWBA 4NUJB 2FSEB 4NAJA 5I1JH 1D9KA 4MXVF 2ETWA 1N7ML 3LHPL 4X4KA 2E8YA 1RMFL 3BP4B 3ESMA 2P4AB 4EN3A 4CBPA 2YAOA 1WTLA 4MAYC 1FYTA 1NCOA 2AAVA 5I74C 3SE8L 5LLIC 4K7PL 1BZ9A 1RURH 4Z0BH 3QFDA 2CQVA 3CFKB 4KDVA 4LLWB 4MVBD 4BSWB 2R2EB 3DIFB 4FFYL 4HUXB 3INOA 4ZODA 3LPGA 5AWNH 3WEXB 4PMEA 1M9SA 5JORA 3Q6FB 1DDHA 3Q8FA 4WSJA 2Y3AA 1ZPLA 2VXVH 3VFNB 4P05A 1K6QL 3SQBA 2VMDA 4KY2A 1OGTA 2GJPA 2C1PB 4OIAA 5D1ZC 3WMPA 3ASNB 4OCXL 5F0LB 5FM4A 3MLRH 4P2YA 4TNVF 3ULSA 2RGSA 3GK8H 1F13A 4XP1H 1PDKB 4U4BA 3U7WH 3HU3A 2EYSA 4JUSA 2DQFA 2F53B 2XA3A 1R19A 3MAWA 5CIPA 2DJ4A 2XA8L 2ITDA 1BQUA 2KS0A 4YSQA 1WBXA 1PX8A 1CE6A 1ZHKA 2J7LA 4ZMOA 2WVVA 2SEBB 1UHDA 1A3LL 1BAWA 1XXFC 3L5XH 3D06A 2X05A 2OMYB 1FC1A 5CGTA 3FC8A 4WCYL 4HH9A 4XB8A 5IHLB 2Y7SA 5IBLD 2WVSA 1C1EL 4YHOH 4IOSA 4NRYB 3X2NA 1UXMA 1NCNA 4N8VG 2QDWA 4J3BA 1CDCA 4CJ1A 1J5OH 4NWTL 5C09B 4P5MA 3FTGA 5FHAL 3TZVD 1CF8H 1EO5A 3STLA 2V3VA 1U91A 3IJ9A 2HFFA 2ALWA 4FNTA 1HHJB 3GJFK 3GSNB 1HQ4B 1WISA 1ROWA 3SE4A 2KLSA 5D7JB 1Y5IA 3QPQC 5KS9B 3QUZC 3UZQB 5D2NB 5AZEL 4TUKL 3QDJB 1Z66A 4E5XB 1A6UH 2OA9A 3VX1A 1F4AA 3CZFA 5JZ7D 2VPXA 2QGCA 4G83A 1XZ0B 2LQRA 4PJFF 1UGKA 3QUXD 2OMYA 4X9FA 5A2BA 2ERJB 2HFEB 3DHJA 2X2IA 3TV3H 5CR1A 1CGWA 1CR9L 1BA9A 4G8EA 5C0CE 1HKLH 4OTXL 3IMSA 3E8VA 1CFNB 4EI6A 2E9WA 1H8OA 4PP2A 3GMPB 2HFFB 1BD2A 3SGJA 1E6JH 3GSNA 3GMQA 5FS5A 4AWJC 1SVZA 4WHDA 1FH5L 3G5XA 3CFEB 1QP1A 1R24A 5MERA 4AE1A 1ETA1 5C6WH 5KZCD 2IQAA 5I18L 1J0KA 3KR3H 2JB5L 5KSBF 3W5NA 1FORH 2IAMB 1RP8A 4RGNE 2XVGA 2LT9A 4LSSH 4Y8DC 1ZHBB 1WCMA 1B90A 4HIIA 5D7SH 5HP5A 4UU9A 3FB7A 1DBKH 3D4YA 3O41B 3NA9L 4G7YH 4JVUA 2C3VA 1Q8MA 1M7XA 1MF2L 3GJFH 5DHYB 4Y5VB 4X7FC 4DZ8B 1DFXA 3X14B 4Z7VA 1X4YA 4P5TA 4QHLA 3QRBA 2I07A 1XH1A 2FWSA 5FGRA 1N6QH 2XTLA 3VXTA 4KKLD 4C54A 3WEAA 3B9DA 3F58H 4HS6A 2B4CC 1ZLSL 5IOPB 4LHUB 1MN4A 3MU3A 1A66A 3BAIA 1MNNA 2IDTA 3KWXA 5B3JF 2Y22A 1JHKL 5LBSA 5ADOH 1L8FA 4WO0A 3TLRA 2OCFD 3IPBA 2GABA 1FZJA 4L9LA 5GGQH 1ZKAA 1GZPB 3VQMA 3AY2A 2Z35A 4Y5YB 5I0VA 5FUCC 5E6IA 1U8KB 3EJSA 1DCEA 2H5UA 3U2JA 4MS6A 2NY2D 1OP3K 3BH9B 4M61B 2R1XB 2WUBL 2DD8L 3V7AE 5K69A 2AW2A 2AQNA 3A6BL 3EJYD 5AW8B 1EEQA 2VXQA 4BQ9A 2P8MA 2J6WA 1E6OH 4HKZB 1A0QL 3QZWB 1UCBH 4LLDA 3VE0A 1U30A 5JR1H 5FA3A 5KJ4A 3FQNB 4NSKA 1ZYRD 1NPJA 5C8JB 1I8MA 2WKLA 1LNUB 1G1KA 1GPOL 2DM3A 4Y2DC 1R3IH 1A3ZA 4RWYL 1WA2X 2JQZA 4ZX5A 5AALA 1CR9H 4DZBB 5DJZB 2ZT9C 3EO0A 2XYBA 1JZ7A 2VE6A 2ED8A 3WSQL 4HOMA 5E03A 3NACH 4JZJB 3RWCB 1RUAL 5EHFA 2GITA 1AR2A 1I3UA 5IEKA 4ODXA 2NW3A 1OT4A 3WL9B 4NM4L 5K9OB 3KLDA 5EWIL 1NWOA 4JFXB 2MQ0A 1K2DB 3GZOA 4F57L 5C3TA 4GYBA 3RVTD 4JR9L 2DJSA 5JPMB 5F0PB 4JFEA 4Y8AA 4DP0X 5BO1H 4GQ9L 1S9VA 2OYMA 3HI1B 1L6ZA 3S4SB 2DKUA 2H6PB 2WP3O 3NFNA 2IPKB 4U7SA 3HRZC 4CSTA 1IAMA 1RSFA 2BX5A 5D5ME 1BREA 15C8H 1J12A 4XNZC 3BX7C 2LU3A 5F6HJ 5BJTB 4GG8B 3FNKA 4JRFA 2NUTB 5LGKA 3B9VA 1OA7A 5CU9A 5EU6D 4JZJC 1FWXA 2NR6C 1M6OA 4GSQA 1ZAGA 4XNQB 4FI8A 4QHNB 4YC2B 4DESA 1PQEA 5LDSA 1MAMH 3QUXB 3MRPA 3DWTA 1JPEA 2JE8A 4ANKA 3BN3B 1CFTA 3NEOA 2QPDB 2ZUTA 3T04D 3CDGA 3W0WE 1BFOA 4KROB 1FVDA 4NO3B 4OAWA 5F6HI 4UQIM 3K2KA 4W70A 5IIEA 4KV5F 5MI0C 3F64A 3OB8A 3SYCA 1M71B 2HG5A 4MMXB 3UBXB 1NCWL 3GI9H 3MO1A 5ITBH 3KEHA 1PKQB 5IBUG 2YUJA 1EGJA 5GZNA 3CPLA 3NIFB 2VDMH 3BAEH 4HWBH 3QXAA 4FFYA 4JMXA 2XIDA 1U95B 2ZKXA 1L7TL 4W9HC 3VRJB 5GGRA 2OI9C 4TULH 1EAOA 4WJG3 1Q9OB 3PWUA 3OR6A 4FN0A 5D70H 1ZV5A 2WNKA 2WBJC 2EXYC 4F7EA 1E5YA 3MUUA 4QXTA 4EZJA 3WY2A 5GGRY 4DGYH 3UG4A 2B77A 1KCRH 1RZ7L 2QSQA 4HD9A 5FYJH 4RFNB 3QUYD 4RSYA 5E6IC 1I1FB 4AQ1A 2V7HA 3MXVL 3FT4A 4PY7A 4NQEB 4BFRA 3U0TB 4Q97A 5MI0B 4Y2NA 4PRHA 1CG9A 5H37G 1S3KH 4NKIL 2F2HA 1RZJL 5FW7A 2X6MA 1SYVB 4O51A 4X8XA 1ERNA 3EGXA 1KGJA 3ZL1A 2FO8A 1ITCA 4CVXB 1HE7A 3UPAA 5DA0B 5HYFA 3D7PA 4K5OA 4YFLF 2F8XC 4QXWA 3QE5A 4MBRA 3V0JA 3CH1B 3QJHB 3V0WH 5EO1B 1UA6L 3BXNA 1ZIBA 2ID5A 2NYAA 3DUSA 4P23D 4F15C 1MFCL 4ALAC 3GTKA 1DCLA 1RZ8A 2AXFA 3DBXB 4WHYG 4FQQB 3LRHA 5CEYB 1KLFA 5T1LB 3BKCL 1X9QA 5HYSG 1D5BB 4ELMA 2O5ZL 4ZMYA 4FLOA 1J8HA 1T5XA 1ZEAH 4LLUB 1W0VB 4M4PA 4DGYL 4AW7A 5SWQA 1SEQL 3HBQA 1A5FH 5IMMA 1LM8V 1O5PA 3JYCA 2BM3A 1EEYA 4JAMB 5KUMA 2ZWYA 3OXSA 4Q6IA 4TM9A 2DMKA 3TIDB 2EP6A 1INDL 2VDMB 5DSCA 3SKUD 3UTZA 4G6FD 4HWEL 4UQEA 2OYPA 4G1EB 4LF3B 4LP8A 4R2GB 2BSBA 2FNBA 4K9EC 1RZPA 5ITBL 4D0BB 3BZFB 4OU3A 1YNLL 1VEPA 3HPJB 3MRCB 2ZG2A 4OZGE 4QOKE 4DEUA 4EXPX 5BJTA 3GTNA 2IAND 4XCEA 5DMJB 2R69H 4OY9A 4YGAB 5E8NB 1CXEA 3CFQA 4KZDH 4OQTL 1J8HB 2H0FA 1CXKA 2AI0H 3V5KB 2I24N 2QVIA 1QDNA 1WITA 2ZOKB 4IS6A 5BZDA 4MDIB 1WBYA 2UY6A 5D6CB 4L4VA 4NQEE 2VSMB 1DUZA 4I9XA 5DRZA 1P7HL 2AV7B 4LEXL 3AT9A 5DWUL 4OLWL 2R23B 1SVBA 4BSVB 2OXHA 1WA0X 3VXRD 3LIUA 4MB1A 5I1HH 3ELQA 2PKDA 2QHLA 3HC4H 4YDNA 3VI4F 2BZCA 1TVBA 4LFHD 1MQKL 3QYNA 3RILA 1NLDH 3GTVA 2Q7YB 3N04A 5TH2B 4GP5B 1V27A 2X2YA 5F1OB 3MBXL 5HHOD 5EC1B 1CD9B 3ZT5A 2GUYA 2FL5A 4AIZB 4PJDB 3ZRCC 1BIHA 2LLNA 1DSFH 1LP9B 1DLFL 4Q9BA 2JIPA 1IEBA 2NY3B 4QLRA 3NEXA 1KY6A 1LE5B 3D3VA 1XGRB 4XCFL 3I9GL 3SBWC 4KDLA 1SM3L 1UA6H 1A6AB 4QXTB 4KNTA 4PY8I 3QZMA 4NAQA 4XPFH 5IW6A 4AV4A 1Z9NA 2PNWA 2QGEA 1JZ6A 1J5DA 4XAWL 2C3GA 5I30L 2ZJSL 3SGKC 3LKPB 2PTUA 3NCXA 3GB7B 4H0HB 3S8WA 3D2UB 2QSTA 3QEHB 1PYWA 1C9SA 3TEXA 1BEYH 1CIUA 4ZSOA 3EYUL 1U3HA 1V54B 1DL7H 2YGNA 3F12A 1UATA 1ZV9A 5EEXA 2OXGA 3D25A 4ATTA 2SODB 5E2VH 1CF1A 2Y7QB 5J6GB 3ALPA 3GNMH 2EDYA 5FYJD 5C0IB 2MMXA 1F90H 1KBPA 4YWGH 3I6KA 4X7SL 3C8HA 3ZDZF 1NINA 2V5SA 1Q72H 3OJDB 3ETSA 4ADJA 2QR0A 4FHBD 1TG8A 8FABB 3O2DH 4RFEA 5KOVC 1RZJC 4CU8A 1JPST 4FNLH 2UWEB 5FPIA 5HD8D 2FSEA 1JUFA 3CZLA 4WO4A 1SM3H 2TRHA 4HS8H 2IH1B 1TQBC 1V3KA 5DC2A 2A2QT 3VFWB 2FLBT 2AJ3B 4K94C 3DGDA 4HOWA 5IQ9B 1Q9WA 1I7TA 2ZG3A 5LB1A 5JPNB 4ADGA 4NENB 1W0WA 4IMKC 5SWSD 5DFWH 4YHKL 2FQFA 4LASH 4XMXA 4HEMA 3GSVA 1KXQE 2R2EA 3DIFA 4HUXA 4ZUTA 3VXPA 2BJMH 5IVZA 1ZVHA 1S78C 3GO1L 2B59A 3CUPB 3TZVC 5FUZH 2D03H 2Y6SC 5GZOA 4WKZA 3DO7B 1LMKA 2DMCA 3LQAL 2JIXA 5E94B 3VD1A 4DMRA 2CCVA 4FAAB 2K7QA 3HC4L 4FQHB 4UYQA 3QJXA 4Z9KB 1MCBA 3TO4B 5F89B 1HEZA 4ES9A 5CLZA 5KSAC 1XIWD 3UYRL 4ODTH 4PJCF 1OAQH 35C8L 4JKNA 4QOKD 3WTUA 4JZOA 1XGYL 5I76A 4OM1H 5IMLB 3VXQB 3S2AA 3VGDA 5DD1H 5AKRA 5GS1A 1EXUA 1H3XA 3OSVA 5JW5B 1XTLA 2NY5L 4XBPB 1G7LB 3DTUB 1CDYA 3ZTDC 4CMHC 3EGSA 3SE8H 1HH9B 2WLKA 3IDMA 1YNND 2F68X 4JFDD 1KXVC 2XC8A 1TQWA 4MJIE 3AITA 1N68A 2YKLH 4IGBB 3GMLA 1NAML 2NY0C 1OB1B 3DHUA 3ATBA 2D8KA 3QJVB 3V9CA 3BSZH 2Z6FA 2XY2A 5IHUH 3L9YA 1RJYB 3LKOA 5D1XC 1YY9D 5A7EA 4BM7A 4F9PC 3VXMB 1E3ZA 3MRBB 1W8NA 4L4TE 4F2EA 3LNEA 2J8HA 3D39B 4HPYL 4TLTA 3SE9L 2HJKB 4ZXBD 5LBSH 4HCRL 1GCFA 3F5WA 4AQ8A 4R97C 4XNMA 4GA5A 2Z7YA 5DMGD 3K4AA 3QORC 2CUAA 4LCWE 5B8CC 1WUNT 3NVQA 1KGYE 3SGEI 3WI9A 5A6MA 1OD7A 5HHXH 1A4CA 3GZPA 5TE7L 5CJOL 3GXNA 4E2OA 5GS0H 2G2NA 5T5ID 2GJ6A 3VYPA 5DUML 3LRKA 2W0PA 3IKKA 3D52A 4XXCA 5GIRB 5JHAA 2J20A 1E43A 1R46A 3ATEA 3AY4C 1QI3A 4K3HA 1KCUH 1N8ZA 2L04A 3GJFA 2BS71 3MZGB 4LKCB 2VLJE 3V6ZB 4F9LA 4EDXA 3NFPA 1IC7H 4QTFA 4RGNB 5EU7C 1S7WA 4JM0A 3X1EA 4GLRI 3MBWA 4M5SA 4BBWA 2VJ8A 2W81C 2F7RA 4MXWL 3ZGIA 3VFOA 4YHYB 5HVFB 2WWNA 3Q5YA 2E6QA 2JJSA 3FYEB 1U8NB 2KMWA 1R24B 5MERB 5C0NC 4H44C 4Z8FH 3HI6H 5GRWA 5BMFH 4Y1AE 1Q9KB 3QNZB 4F2MA 1JWMB 2NY3D 1ANUA 1F4WH 5JYLA 5CEXA 3FO0H 3HFMH 4RMQA 4HX1B 4ELKA 4JQIL 4N8VB 3WEXA 1T7XA 4LSUH 2NY7L 3Q6FA 3VFVB 2EUXA 2WGNB 4Q58C 1BG9A 5D5MA 2XHNA 3DV4A 4I4WB 4CVZB 3M8OH 3R18A 3PU7A 4ZMXA 3BKCH 3ZLQC 3NJHA 3QDJE 5HI4C 3DGGB 1OP5K 4A67A 4DAGH 4QNPE 2AQTA 5GGVY 1OWRM 1J11A 2GFBB 2WUCL 5BO0D 1TWAA 4D94A 4GBXC 4RNRA 2Q76B 1U0QA 3H0TA 5AG9A 5AB1A 5DMIL 4ODUA 3IWVA 1ACCA 3T6QC 2WBJA 1MF2H 2EIBA 5FUOL 2E59A 3ZDXF 1PPIA 4FXGC 1FO0B 1GPOH 5E2TH 3BH4A 3W11D 4PJIB 4WUUE 2JCCA 5ESAA 1PSKL 3FRUA 3QG7H 4KKBC 5J9PB 1JZ4A 4UILH 3B9KA 1SEBA 1R3KA 1WVZA 1NC2B 1WBZB 3LVTA 2A74C 4NC2B 4I1PA 3ARUA 3SBQA 5CCGE 3F01A 3IMBA 3MDJA 3OR7A 3LXBA 3PWLA 5TD4A 5A2FA 5C1MB 5CU5A 5AVUB 2ZOOA 5D1XA 3N50A 1HXMB 3CVIL 1L6PA 1AZNA 1SY6H 5EO9B 2DQHL 2UYLB 3VTTA 1U21A 4FP8L 4J5VA 1RIVL 3FUMA 4S2SA 4BELD 1WC7A 3IFLL 1P0SE 2P1YA 1K8IB 2VQ1A 3PUUA 2HFEA 5HHVH 5IROA 4ELME 3GTLA 3PJNA 2A9NH 2XZAL 1GY2A 4JZJA 1FG2A 3IS1X 3WBDA 2NR6A 2AK4E 3D85B 3QIBB 4FQLL 3BKYH 2OJEA 5IB4A 2PWGA 5KVDL 5IMKB 3VXSE 3MREB 4U1JB 5HYSB 1S7RA 3TCLB 1QRND 4K3JH 5IOKA 4F3FB 1KXTB 1T1ZA 3DOSB 3I2CH 3K80A 4P06A 3S36X 1TZGL 1SLUA 4YSEA 2H0JA 4QRBA 4IGBD 3SPCA 3MUZ1 4HCGA 1QBLH 5IT2L 2ATAA 1DJWA 3RWJB 4JRXA 1SFOA 4I48B 3STBA 4AIEA 4L4VD 3MLVL 4PS3A 2CO1A 1NC4D 1EJOL 3FU7B 1XWVA 4OF0A 3QHZH 1OM3L 2J88H 1XCQB 3IFNL 5HVWA 5JW4M 1NUDA 1TWHA 3CZSA 1CE1L 4GQQA 4I3GA 5I1AA 4X9HA 1IM9D 2YUWA 1YC7A 3V6ZA 1ITBB 3IXTB 3JWOC 5KBDA 1G0XA 1JXGA 2EUWA 2YSSB 1E40A 1TZ8A 4K3DL 1XR9A 4NPKA 1R47A 5AVTB 3BKYL 4JRLA 3FU3A 5C18A 2XTJB 3QA3B 4MRBA 4TVPE 4Z7VE 2A9NL 5KJ7E 4GEIA 2GSGB 5JDSB 3HG2A 1B2WH 2VPWA 5AW6B 2HMID 1B4TA 4G7RB 3RWJA 2ICES 3B2DC 1RULL 1I7ZA 1NMBL 2X6BA 3SCMA 1YNTA 3IGAB 4B3VA 1QSEA 3FB8B 1G6RH 3AAZA 3AC0A 2ZXAA 2VZ3A 3BPCB 2EDEA 3MBXH 2HPTA 3ROOA 3DSNB 3UYPB 5LBVA 1ZOXA 3FH7A 3NJJA 4TUKH 4YSRA 4CN6A 1QBLL 2W65B 5HYEA 2A9CA 4YXKH 3R06B 1ROCA 3X2PA 1JZHA 2W60A 2DEYX 2R0LL 1XCXA 5DJ8A 2W0KA 3GXFA 2NLJB 5DCCA 4NKIH 5A16B 3CDCA 4XPGL 4GRWF 1V7ML 2P5EA 2BNUB 3WTXA 1MCSA 1U8JA 4BZ2H 5CJ8A 3MUHL 4LVNB 2FX8L 3LZNA 1NZRA 5JHLL 4ZPVA 3RGBA 1PQHA 3HG0A 5CD5C 2B1HH 2AZAA 3UOAB 2MRYA 4PLKC 3EAKA 1MEXH 1JAEA 2AEQH 5JORB 3KXFA 1UOWA 4NO0D 3GXTA 3O9WB 5D7IA 3APMA 1AS8A 3IBOA 1P5VA 1QOKA 1CD1A 1E4XL 3HHSB 4HWBL 4L3FA 4EQ3A 4AZ8B 3FJTA 5JXAH 2D0GA 4M6MH 4F37K 4NIYE 3RDTC 1CVRA 2QQLH 5E2UH 2R69A 4DW2H 3TWCL 2XQYK 4NGHH 4AXWA 5G4MA 3LH9A 3S4SA 3VVWA 5FR3A 3SUJA 5GZOD 1E4HA 1JGEA 1VA9A 2VDPL 4S0TD 1EZVY 1NIBA 4NN6B 3UROR 4OFIA 4NLHA 1A6PA 3C60B 4OCWH 3EO1B 5E9NA 2VDQL 4ZD3H 2WMPB 2XWZA 2DQDL 3QVAA 4Z7QE 3ETTA 2J57A 1E28A 1R3JA 3WO3B 3P0VL 3DX6A 2OJEB 5IB4B 3CFDA 2DQGL 1MCPL 2EO7A 3S36H 1N7MH 2MJWA 3LHPH 5H4UA 1VEOA 1AD0B 2WWMC 4RFOL 4KUCD 1KB5L 1PW3A 4DFIA 4TLUA 2CLVB 5HI5C 5FOBB 1KCLA 2P47B 1A14H 5KBLA 2COQA 2Y07L 3ECBA 4LFHG 4Z0XB 1OAJA 2O5XH 1A7RL 1QACA 5IWLC 2R1YA 4NSKB 1KCSH 4UOW1 2JA7A 4WTXA 3QIBD 3TYFB 4LEOB 1JPSL 2BNQE 2P45B 2CNZA 1NAMB 2XQBL 3UPRA 4I1RA 1PD6A 3QFJA 4K7PY 5KOMC 4N2HA 4JM4H 4P3DA 1TJGH 4GRLA 2WUBH 4H20H 4A6YL 4YDKL 1DQQA 1ZS2A 3Q3GA 1JI1A 1H5NA 5DJAA 5K39B 4QKXB 5DK3A 5IEKB 3V5KA 2OR9L 3D0LA 3DX3A 4UOQA 5LGJA 5EOTB 1D7DA 4BFOA 1EHNA 1AXTH 1H5BC 3TX4A 2NRDA 3CD4A 4CC4A 4DPCX 3ZT7A 4PJXB 4AQ8C 4FE9A 3I02B 3OUGA 4OCWL 2GJ6D 1UA7A 3V95A 3TA3C 1AQDA 1IIKA 3FCUB 3HB3D 2V7NB 4D0CB 4AC2A 4PJ9D 2VLRD 4OJFH 1YNKL 2PXYA 2DPKA 1LDPL 3WKMH 4RISL 4WGVB 3TVMC 3U4EB 1NAMA 3HU2A 5IJVB 1OXYA 1N67A 1YEFH 2YPVL 4NDMA 3C6SB 5KYYB 5CJOH 4XX1G 1U6AL 3P2BA 3QQ4A 5E9AA 4UTCA 2L3BA 4W9KC 1IAIM 2A73A 2C3XA 3HNTH 3CLWA 3MV11 4J2XA 4JFFA 3ZY7A 5AAPA 3KD4A 1VZGA 4NAMA 1J05B 2Q3AA 2HVJA 3Q5OA 5K1VA 4Q2ZA 2OSWA 1XR8A 5I1HL 5I2IA 1F11A 4DKEH 5I6MA 1YEIH 4LEXH 2YKKA 5B1JC 2YEZB 4WVRA 3A5VA 3H9SD 4PJ8C 4AOFA 3AFLA 1G0YR 3SBWA 1PPYA 2D4FA 5EZIH 5I8CB 1F86A 4NNYA 1X3DA 2GK0B 5HGHB 4Y88A 1H0DA 1M9WA 2F53D 2DL2A 4LCWA 4JHZA 3M3GA 3NBNA 3PRZA 2XTSA 3VWJB 2DQTL 1LLAA 2C9PA 3JVFC 3KJ4B 1ZE3C 3RWDB 3ETBF 5BCAA 3SYQA 3WIAA 3FT9A 4Z6AT 2ZICA 1NCWH 4R26H 5AVQB 2WBJD 1SY6A 3ARFD 2WQRA 3NSCA 3EJZD 4YHLH 1FLRL 4QXGH 3RNKB 1JXKA 4C59B 1T5WB 4PJBE 2OJ1A 3HMXH 3LPFA 3D4ZA 1HH6A 2JKWA 3CZEA 3FFCE 4HAKA 4Y16C 3P54A 3IDUA 2HJLA 2YPLB 5IQ9A 5CSZA 5DXWA 3EGDA 5MHSE 3K2IA 2Z92B 2P43B 2K45A 1MAKA 1D5XA 3IDGA 3Q2WA 3L8QA 4H8PA 3V0AC 3ZYZA 5F6IC 3I6GB 2R2CA 1KCRL 1RZ7H 2CKBL 3EFOB 2VDOB 4NXSA 4ZO8A 1WEJH 4DPAX 1BBDL 2OYLA 3UAJD 3O4LE 2MOGA 3RWIB 1BEXA 2UY6B 1SHSA 4C83B 2A74B 3RUGB 4EAEA 3IMVA 5FA4B 4YHPA 3LPOA 4AX3A 2ZX5A 2KPWA 4PCKA 5FLUA 1Q4NX 4X6EA 1LD9A 1I8IB 1VFBB 1MIEH 3CFUA 4PJXF 1KCKA 3X11B 3NFNB 3DURA 5MENA 1YAZA 3VG0L 2WXQA 3FUEA 4D7BA 1G1CA 1KN2H 4NNXA 2QSVA 1FH2A 2VC2H 3ML9A 1RHFA 2J3SA 4QY8B 3V8OA 1QFPA 3WKQA 5DMKB 4JO2H 2X10A 4QJ3B 1KN4L 2DN7A 4Q4IA 2C8NA 5LBGA 4K94H 4KVCL 5HHME 1T20A 4WJ5A 5C0IA 1X5LA 2VXQH 3PABA 4KTDL 4F7PA 4KV5E 4OZHA 1NLBL 4YHPB 2DLGA 4HJTA 5B4MD 3II3A 5EORL 4E41D 4PS7A 4FDWA 4X5QA 4MWFA 4ZMWA 2XN9B 4G72B 1SXNA 5K9QG 4JO4L 2WTPA 5HYJE 2V5TA 1T0PB 1Y0LA 3A22A 1PZ5B 5FYJU 1HSBB 1SHXA 2WJ7A 5TQ0H 1FSKC 3C6SA 3QC5X 5KYYA 4OSUH 2OP4L 1IKFH 4UB0H 3SULA 3BQUD 1MXGA 5F1NA 2FUTA 1MIEL 4KNQA 2IFFH 4HF5H 4LHUD 4YSOA 1ZCRA 2Y36L 1NEZG 4GP4B 2B1AL 4AEEA 2X3CA 3H9HA 4TUOB 4P9HC 1R6VA 1TQCC 2XKUA 3TVMB 3C2AH 1MFUA 3K6IA 5EF0A 5F70A 4KO5A 2ZF8A 4EDXB 5GGQL 1UCTA 1GGCL 1K5NA 4NBZB 1T1WA 4U6XA 3BGAA 2HYMA 4OZFB 1IBBA 1GGBL 3CVDA 3OKNA 3PQYE 4FHKA 5CF3A 1NBYA 3MRDB 2WYTA 2A5UA 4K94L 4C8XA 5D7JA 2W92A 4ZOBA 4AQ1B 1TVBB 2NY0B 1CQYA 3MNWA 1KBGH 1OIOA 3SKOB 3JXAA 2EVGA 2D2CC 4JY5H 4FTDA 3VQ1C 3OTTA 3QXUA 4PI2A 2QSCH 1KCUL 1WAPA 1KENH 2ZYSA 1MXDA 3CXHK 4Q14A 4JUTA 5DMYA 2GEEA 4KOCA 1I50A 5JW4Q 4HBCH 4HIQA 2GHZA 2J8UB 3KYNA 2A3TA 1NM4A 5GRVK 1X7QA 4BZ1L 5T33H 2ZWKA 3GSNH 4M5YL 2UXFA 4N0UB 1ZGLP 3R8QA 2NZ9C 2HLAA 5AZEH 3C6LA 1BFSA 2X53A 5GISL 2D4DA 3R8BB 2VPYA 3T4AC 3BMVA 2CW0D 3DX7B 5FFGA 4NO0A 5C0GB 2QV2A 4PVBA 3T4YB 2PO6A 1H6EA 4RWHA 3VRLE 1KTDA 2FATH 1MCPH 1Z2KA 5BMFL 2JI3A 3RBSA 2JXMB 4KGJA 4ODUB 1PFOA 3PNWA 4PJAA 3DYMA 4H4NA 5EB9A 1IT9L 3Q48A 4KXDA 2VZVA 5ANHA 2VTFA 4B7LA 1CGUA 4MD0B 4JAMA 5AQ0A 1MCOL 1ZJBA 2XNAB 1KBGL 5EORH 2NTFB 1KGWA 2YPLD 3KPSD 3Q01A 2RQ8A 5B3JE 2AF2A 4O00A 4X80H 2IV8A 4AQAA 4PJGB 1K3IA 2RHEA 2WNGA 1PZSA 1E90A 4IRSC 5B7FA 5I1CH 4P57B 4BCZA 5TF0A 1SJMA 2QZ5A 3DUUB 4XE5B 2CSPA 2EYSB 5CIPB 5EU6B 4OZIE 4OGQC 4J6IA 1TJXA 3K5RA 4PLNC 3KYKH 4F58H 2UVFA 1XH2A 2DZEA 5E5LA 5JA9A 3U4AA 3S2CA 3M1BB 2X4TB 1FCCA 1NM9A 2BMKA 2OMVB 3VDCA 1M05A 2R1WB 1D9KC 2J56A 4J6RL 5HDQL 3B5HA 4X99B 1A22B 4M8UA 1UZ6F 2VZUA 2WLHA 1DEDA 2F54E 2R7EA 3NFPB 2WZPD 3BEWA 4P5KB 4APQC 4BK5A 5K9KB 4YHKH 3QWQB 3MBWB 4AEIL 4XXDB 2XACC 4FXKC 2R0ZH 4OJDH 4I4WA 4KKLC 5FYKH 4F91B 4JDTL 5K1NA 1RU9H 3RAJH 1X5FA 3VB9A 4TPRL 4ZMZA 1YY8A 2NY6D 4LVOC 2F0CA 4QRRA 2F5AL 4NKDA 4KVNH 2P26A 1W72A 3EYFB 3DRQA 3MA7A 3NCFB 1EXUB 3MCYA 3BT2L 5ACZB 2CMRL 5TJWK 5F88B 1A9BA 1JPSH 4OQTA 4HIXH 4NZ8A 1CZ8L 5KN5A 2FEJA 3DETD 3VXUA 1E5VA 4ENGA 4FHJA 1BF2A 1EX0A 3BPNB 3KYKL 4JPVL 4WK4B 1MRDH 4E41B 5D96C 2Y69B 4EDWH 2JKSA 1BXXA 3B4NA 2AXWA 4X6FA 1KB5A 5CBEA 4PJ9A 2VLRA 3U4BL 4EN2A 4LHQB 5ETUB 3FSVA 3OZKA 5CFHA 4PRNA 1P4IH 1RUKL 4NPYB 3VXMD 1AMYA 4MZ2A 5C86A 2H45A 2ZPKL 4Y5XB 1SMOA 3UAEA 3TF4A 4S1SL 3ESOA 3HUJA 2PYEE 2ERJC 5T1JA 1G7IB 1I1CA 2HUHA 3ZKMD 1U8HA 1Z7JA 2FJGB 3K6NA 4X0KB 5GRJL 2VQTA 4TSBH 4EF3A 1FP5A 5HJ3A 1UA3A 3K2UH 5DUPH 1CE1H 3BWAA 1NFIB 4JX0A 4N2BA 1I7ZB 5C08E 2X4NB 3QQDA 3WE6B 4XOAA 5DO8A 2F7IA 2CIIB 1Y7VA 3SQBB 3T4AA 3DX1A 1QR4A 3DDGA 3CE1A 1S4IA 3P9LA 4BKTC 1XGTB 2BFGA 3BZ4A 4LCCB 5DEFB 1LK3H 3WD5L 3N1MC 4G2AA 6FABL 5K9JH 2VUYA 4U1JA 1HEJC 1KBWA 3SDCA 3QHTC 4I5BB 5D2LE 4Z8FL 3MLXL 3U82B 2BY0A 4NO3A 5H37H 1JWMA 4KDIA 2E7HA 3GTGA 3BAWA 1HOEA 4S2SB 5F7FA 2DDQL 1SFDA 1KEML 1X7TA 1E8XA 4CRYG 3F8UB 2MEJB 2W8CA 3SIKA 3KVQA 1YNTF 3FT2B 4IU3A 3FSWA 5J6SA 5E5MB 1TU2B 25C8L 3ZMRA 2OPCA 3VSQA 3BH9A 3V6FB 4PVNA 2PLTA 5DUMH 1GA2A 3LN4A 3VRIB 4YXKL 4PJGE 1NEUA 5G5DB 4M5TA 5IHWA 3TPUB 2F8IA 2OK0L 1NMAL 1LO0H 5ESQB 4X9YA 4O02H 1YECL 3QEQA 4D9LL 2NY7H 4CC1A 3GS0A 1LNUA 3T65A 1D6VL 5JIKA 3HCVA 4M00A 2VDLH 1LK3L 3FU7A 1TTGA 1DSWA 4LPTA 4G43B 5GJSH 1BQHB 3EYSH 3NJIA 1U3JA 4JJ5B 5I6XC 3VFPA 4KI5E 3ALWA 2BOBB 3BHBB 1KCSL 2BPBA 3BO8B 5DS8A 4XNUL 3AT8A 3HRZA 4Z0BL 5MEND 5ITFB 1QSFD 1N19A 3WL9A 4EI6B 5K9OA 3K72A 5D7IF 4BFIA 4BGDA 3OHXA 4QGYA 5KBPA 1KEMH 3FUHA 4GSXA 1RK7A 5GRJH 5DD3L 3UEZA 4QRRB 1UJ3A 3U36B 4NT6B 2FAUA 5IB2A 5GSRB 3QG6A 2VW7A 2ZKYA 1OCWH 3LY6A 5MP6H 5DK2B 1WBXB 1QFUL 4JMNA 3BRGC 3VO0A 3VGFA 2VLME 1OT1A 1WAAE 4AEFA 4I3RH 4AYMC 4MCZB 2D7MA 3PPSA 3JWNG 1KT2A 3IPFA 3RZCC 1RUMH 3I74A 3LN5B 4YLQT 2Z1KA 5ISZA 4WW2B 4LSRL 3FS9A 5L0QB 1RZKL 1B3JA 1JF1B 3GSUB 1BYPA 3F00A 4XN8A 5H4ZA 5C0DB 1XF4A 5HGAB 3AM8A 3V4LA 1AKPA 3LX9A 1CFVH 3MRMA 3VXSB 1OQOA 1F18A 4G6KL 5GGSY 3VH8A 4K4KA 4JFFE 1U8OB 3ZR6A 2LR4A 4YFEA 4LCUB 4YVNA 5F7DB 3QDAA 1PZBA 1N10A 4N8VA 1SQ2N 3FT3B 1OK8A 1Y18B 1YEGH 5IJVA 2X9XA 4OLXL 4ZOCA 2FLRT 3K3QA 3ZSTA 3G08B 5CHNA 5HHNB 1S5IL 2NXZC 1FF5A 4ZTEA 4B9ZA 2X4RB 1KGCD 4KROC 2W9LA 1BQKA 1GZQB 3GNML 3GF8A 3JWNE 4P5RA 3IJYA 2FTAA 2R56H 1EXHA 1UXSB 1H6UA 2VZOA 3GMRB 2WQVA 1GTNA 3WN5C 4Y4FA 5D7LD 4QCIA 1AGDA 3HVDA 4PLOB 3K74B 5I1KH 4JP6A 3QZNA 4HWUA 1YEFL 4PJIE 1ETZA 3CLFH 4WUUB 4BK5C 3HE6C 4MTMA 4D9QE 4ZX6A 5JHBA 1BQLL 4WI0B 2NY4B 5J6HA 5IESH 1NTDA 2IPKA 4MX7B 4LL1A 2EACA 3G5YA 3IFOB 1QSEB 1N26A 2BLFA 4ODSH 5KSVA 2GC7C 1H0DB 1ZA6A 3M07A 2AJXH 1G7MA 3QC6X 3FQRA 2A6HD 2P5WD 3PY9A 3OVUB 3ENGA 1E4KC 3T0ED 4WRLA 1JSYA 4FERA 3CFBA 5LUMA 2A9MH 1YEIL 3C08L 1JWSA 2CLVA 2QV4A 3EZJB 5IFJA 2IWGA 2F58L 1WAAF 5I1EH 2NY4C 4ICWA 1I8AA 5DRWB 2GAEA 5DJ0A 4I1NB 1YRKA 2VL5B 3EHBC 4ZOAA 3PJSA 2J1YA 1QWNA 2FEDC 1YAIA 2KZBA 2R56L 4LBEB 5DD1L 3LDBC 5F9WC 4LPXA 3S3PA 1QR1B 1IGCH 4N22A 4JJHA 2Y6TE 1GGUA 2B15A 2DIAA 1OTSC 4XPAL 1GHFL 3GLEA 4OJYA 3UTTA 3KAAA 1EA9C 2DQUH 4S1DD 1DQQB 1D5XB 3D39D 3IDGB 4R7NA 5IBTL 4DETA 2CXKA 4K23L 1RURL 3HRZB 3T6XA 1FNEB 4OIIH 2X6CA 4Q9CA 1JHTA 2FWLB 3DX8B 3OKMB 2YPLE 4KU1A 1P4UA 3K81A 1D6EB 4XPFL 1DVFD 3X12B 1M6OB 3BIKB 1M7IB 1IW7D 1CGSH 1DJYA 1L0YA 3KGTA 1GYUA 4G6KH 2QLYA 4MA1C 5GGRB 5I6XB 3UZVA 4X6EB 4IBTA 4Q2ZB 4JANA 1N3NB 2ZSWA 2E76C 3LEXA 3HS0B 5GGVL 1NKRA 2XX1A 2AANA 1V10A 2BE5D 4WU5B 3CZGA 1UD6A 2W0FA 3MLTB 1VJSA 2B7DT 2A9AA 3IJEB 3O3DA 2WXPA 5HHXL 4ZFOB 3GDBA 4JHAH 5EC2A 3ARDA 2HA1A 2YD9A 2A68D 4GW4B 2Q2EB 4FQXD 3U4BH 4P2QD 5I8CA 4PG9B 1A7QL 4S11A 1ACYH 4QRRD 5IQNA 3U6XA 4TVPH 5B38G 1KFGA 5KVEE 3ZE0F 1RIHH 3DX8A 1S8DB 2IBGA 4HUNB 4PGBA 1AS7A 4OI9A 4G42B 3P1VA 5GS0C 3GMPA 5AW5B 1AGFB 1VSCA 5B1KA 2W9EL 1AFVH 1N4XL 3RX8A 1YYMH 4LVOB 1J0ZA 4FXGB 1F11B 3X1BA 1DMSA 1LO2H 2JIXB 3WJLA 3DXAE 1R5VA 1LEIA 3L45A 4J12A 4JGJA 3UXFA 3DXAB 1J1PL 3HS0A 4AKPA 4FQ1H 5DZPA 2GAZB 3KDPB 3KLQA 1PF3A 4O2EA 3U0TA 3MXWH 4FQLH 3IDYC 4NFBA 1Y1VA 1IQDA 2ZXEB 3V9EA 2DI7A 2C7UA 1EZSA 4XBPA 4H8WL 1NCBL 4KVCH 5TF1H 4LDOB 5DQDH 1ECYA 4U1MB 1TYEB 5HGBB 2H1LM 3IJYB 3VXSD 3APCA 3D0VB 3O8XA 2UZXA 5TDNA 3UGEA 2JTDA 4P5TB 4QHLB 1OAYL 4PLJD 5ID1B 1JNJA 4NUPA 1OCOB 1J5IA 3E1ZA 4FFVC 3H7BA 3KWWA 1EEYB 4OQ1A 2YD3A 2ZNXA 1SOKA 4WI9A 3I02A 1E30A 1U33A 1TSHA 1T5WA 1ADQL 3KCWA 4OZHF 4W9CC 3RKDC 4Y5VC 1LEIB 3INUL 2FD6H 2IGLA 4UILL 2I5YH 1AKJA 4XRCB 4FA8A 3T0VA 2D73A 1A6WH 1XBDA 3BVNA 3OQ3B 4PN6A 1UH4A 1XB8A 4MQSB 3TT1H 1OPGL 4KUZH 2IG2H 4QRPD 4ERSL 3ABMB 1NFDE 5F7MC 4BH7B 2Z91A 2L0DA 4OV5A 3SDCD 2J1ZA 4ZNEE 4KO7A 4J3TA 2YMOA 4XB3A 2QLVB 1FFNA 1YY9C 4WUUD 3GIVB 4N9GA 1H19A 2QQKL 4GMSL 1ACXA 3MLUH 1PZUB 1LDPH 4YAQB 5LG6A 4Z7AA 4YDLB 4R96A 1JZ3A 1UWEL 3CSBA 3EYOA 4UDUB 5AAWC 3HC0B 1RZJH 2FEEL 3KS0J 5T5FL 4TQ8A 3WY1A 4TYUA 4ONOA 2P5WB 4ODWA 1FVEB 3BFOA 4HKJA 2OV0A 1W0WB 1R7RA 1T4KB 4N8PA 5E4OA 1DQDH 2YPKB 4JM2C 2WXHA 3NACL 2MSPA 3A6CH 1INDH 5GS1C 5AEAA 5BOPA 5I16B 4L3AA 4TSAH 1MZZA 3QEQD 1U3YA 1ZPUA 3CZJA 3RWEA 1TJMA 1U93A 2DICA 2CDFB 2RR3A 2V2WB 5KYWB 5D1QC 4AYEC 1IEHA 1PQZB 1BIIA 1T21A 3APDA 4R4BA 5F7HA 1WZKA 2FO4A 4ZQTA 2IQ9L 3AS3A 4BGLA 3VD5A 4FMVA 3HZMA 4AENA 1XFPA 5AAMA 5I1LB 2AQSA 1IBZA 4ZW7A 3RUGF 3O9WC 3EYOB 4H5SA 3GRGA 3V5DA 1NJ9A 5IG7A 3L3OA 5TDPA 1HHGA 1S9YB 1I3VA 1OGAA 4PJHF 3BRDA 1IFHH 4M7LL 4PGDA 1V5JA