4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
2AE0X 2BH0A 3D30A 3X2OA 3CZBA 3FT1A 1WC2A 2VXQA 3X2HA 2PJJA 2ENGA 3SUKA 2PI8A 3X2IA 3X2MA 4JS7A 3X2NA 1OA7A 4L48A 3FT9A 5GLYA 1OA9A 3SULA 5H4UA 1BW4A 2PNWA 1HD5A 2HCZX 2GAEA 3X2GA 3X2PA 4FG4A 1WHPA 3SUJA 2G5DA 4JP7A 5GLXA 4ZM7A 1WHOA 4FG2A 3X2JA 4JCWA 3SUMA 3ENGA 4AVRA 4JJOA 4JP6A 3X2LA 1BW3A 4FERA 1N10A 5GM9A 4FFTA 2KQAA 3M3GA 3X2KA 4ENGA 1BMWA 2PICA 1L8FA 2G6GA 2JNZA
chains in the Genus database with same CATH superfamily
5C2UB 1A1MA 1SHWA 2VDOL 1W91A 4G7QB 1HHHA 1JNHB 1OP3H 5GRZA 2BNRB 4LSVL 4PAZA 4WV1B 5AWNL 2R7EA 4FQQB 2EDEA 1SLWA 4K2UL 3VXPB 1WEJH 3TO4A 3NCXA 4PVLA 4NS0A 3N0AA 5JIIA 4JZOA 2AKRB 4J1UB 2PR9A 3W9EB 1KBGH 3TNNB 4XBEH 5F7NC 3ROLA 3LPFA 1AD9B 2BVYA 3T4YA 1SGKA 3KJ6L 3RZCC 3O9WB 1A7RL 2V5SA 5A40E 3D33A 2I60H 5LCVH 5LGJB 5FTJA 4Z95L 1TQUA 3QNFA 4H1LG 1MW1A 3QCTH 4LEOB 4M1CD 4P23D 4GNKB 5HYIA 1V54B 5L2JB 3MQIA 4Y9BA 1J18A 1BXVA 1N59B 1YY8A 1SZNA 1CU4H 1UUSA 3MYJB 4AIZB 1IC4H 1VACA 4K5MA 2M26A 1IKNC 4OQTA 1A2YA 2EECA 4QI3A 2J5LB 2OJZH 1TWGA 4YDMA 3UG3A 3SPIA 3ZKNC 1XTMA 5DSCB 5IB4A 4ODVL 4C56B 2B2XL 3QQ4B 3RIKA 3T6WA 2L3BA 3GQFA 2ZNXA 4QXUH 4BUGA 1MLCB 4E42A 4FJYA 5C8JB 3CCHB 2EKJA 3RIFK 4UIKL 5DMKB 2CGRL 2PYEA 5DK0A 3BZ5A 3QDGA 4P5TB 2AJ3A 3PRZA 4X9GA 4HFWA 4QWWD 3RTQA 1JGDB 1BLIA 4K7PH 4NNXA 1BJ1H 2AANA 3U82B 5C7XL 4UV4L 2GY5A 4BQBA 4IRZH 1R3JA 3NT0A 5EOCJ 5B38G 4C57C 4IQHA 1XVSA 5GGVL 2YSSA 4XNYH 2FIKB 3MLVL 3STBA 1PQEA 1WFUA 2EJ1A 3QG6A 4MDRA 1KEGL 2ENPA 4E9LA 2B4CH 4KKNA 4Z7UE 1K85A 1PF3A 3QZOA 3N41F 4Q0XL 4CN1A 1XF4A 1NSNH 4M03A 2DKSA 3HPJB 2BSED 2BVPB 3JV5A 3OMIB 3S35L 2BS71 4G80A 4KKAC 4W9ZA 3QUYA 3TBSB 1CPUA 2OW6A 3MA7A 1QACA 3U83A 1NAKH 1JXGA 2FX9H 4JCWA 2V2TA 4HIPA 5C3TA 3ZYZA 1OQXA 2IDSA 3HJEA 1I8KB 1VFAA 1MFBH 2BY1A 5MP6H 2PYFA 4PY7B 4PJ6A 4NO2B 4V1DA 2V7HB 3OZLA 3FB5A 4Q6IA 3VGDA 1A66A 4XP9L 4ZPVB 1K3IA 1RZKL 2GBTA 2VCOA 3BO8B 2R8SL 2W1NA 1CCZA 4XPAH 3CFKA 3EKCA 1T21A 4PW9A 4B41A 2ERJC 2DQFB 2VDRB 1WBYB 2DLTA 3RNKA 4DN3H 4R84A 1ES0A 1O9VA 3L3KB 2H1PH 3SB3A 2E8YA 3LH2L 2ATKA 4JRYD 3BQUB 3D18B 3VSUA 5I1GH 4HFUL 5FF6B 4E68A 1FNSL 1YNTA 2WTRA 4LLQB 3PDDA 3WGUB 4XZ4A 1U8PB 3SQOL 4EUPA 4K3GA 5GGRA 2YUZA 5IB3A 2Z92B 1N6UA 1BFVH 1O6SA 1JERA 2O6CA 1KGXA 1E2VA 2YGOA 3FT4A 3N9GH 1JZEA 1IMHC 1S7UA 2QSCH 3VRLF 5L9DL 4QGTA 3BDBA 2BSBA 3R18A 1JZIA 5JIKA 2DZEA 5DA4A 3ROOB 2EDDA 4ZG1A 1GTFA 3H9HA 4KK9C 3LNIA 2PWGA 32C2B 1MIML 2WAHA 3ABGA 2CA3A 1TVHB 4I48B 3MR9B 4RFOL 5DD1L 2NY7H 2X4NA 1KBVA 1AQKL 4P99A 1RIVH 4LGPB 1IBDA 5DFAA 5T5FL 3RE0A 4NUGH 1M53A 1ZDQA 4IS6B 4WWKB 5A43C 3PV6B 5EIIA 2HX8A 3FUMA 3DPDA 2EIZA 5CJOH 1WWBX 1HEZA 5JZ7D 3PGDB 3MRCB 1LK2A 4XVUC 3LKSB 4PIRF 3NZ8B 4Z7WE 1FG2B 1CFMA 1CFNA 1CXFA 2HFFA 2X1OA 3VFRA 4AM0B 4TUUA 1XGQB 3VRIB 2DQTH 1DMSA 1PQZB 4G8FB 2NLJA 4NUQA 5BV7B 1BECA 5GRJH 3IVKA 1QHQA 4BFEA 2DQUH 2OMZB 2E27L 5ISZD 3CAFA 5FECB 4H26B 2ZOLB 4TUKL 2XV0A 1LEKB 4W4NA 4Y19A 2P28B 3WJJA 5CJ5A 4ORGA 1OT1A 2KPNA 2WQRA 3ULAB 4GXVH 3ZUCA 43CAB 1DN0B 1E27A 1TTFA 5SWZE 4G8EA 4M5TA 1NCCL 3M88A 1AGDB 1BZ7A 3VDBA 2WLYA 3TVMB 4J3VA 1RCYA 2G60H 1W6LA 3CZGA 4KBPA 3IRZA 4PP1D 5I8CB 3SPVA 3D08A 1I85A 3BGFC 4YDJB 2XVGA 4JDZA 4U1GC 1QVOB 2VMJA 4P46C 1K8DB 1A0QL 2J72A 3S3BB 2XWZA 4PVNA 3WV0A 3UAJA 4D7BA 1HDMA 3ZKMD 5KVFH 3PG2A 1DE4A 1RKRA 1A8JH 5GJTH 3COOA 2WZPA 2R51A 4MQSB 3QEUB 4NQED 1NEZG 4YSRA 3KPNA 1JGVL 3R06A 4OZGB 4UTAA 4PG9A 4KGJA 3EHBB 3K2MC 2C9VA 3L1EA 1TITA 4FHKA 4QT5A 3DYOA 4DQOL 4ZXBA 2WYIA 3FAXA 1AD0B 1TQWA 3SE8L 1RZIB 3I2CL 1F13A 5E2WH 4I4WB 3NZHH 4ONHB 4OM0H 4TVSa 2UXGA 3IJEA 4DGYH 4G83A 3HLAA 2YPVA 5C2BL 2CBOA 4G9DA 1AO7D 1KGUA 2Z8VC 4CU6A 4G8IB 1QNZL 3EH4B 4FLRA 2XZQH 4DZ8A 2RCSL 5FWRA 3ARXA 3EOAA 3GSWA 3SDAD 1S3SA 1KC5H 4KO9A 2GAZB 4KKBC 3PPSA 4A6YL 4ZFOL 3WL9B 3AS1A 2GT9A 5LBSL 15C8H 1FSKC 4JDTH 1PJWA 1QTPA 1ZT1B 3RZCB 1XF2A 3SYAA 4XP5L 3GMNB 1BVLB 2V45A 4KQ4H 2ZZUT 3FCUB 2JWYA 3N42F 2WLLB 5CU5A 1KLUB 4HD5A 3IE4A 3B9DA 1PZ5B 1IAIH 2XN2A 5CSBA 5JQIB 3EFFA 3B37A 3FF8A 1OD9A 2G5DA 2DQEH 4WI6A 4CKQA 3JVGA 5H4ZA 2ADJB 3TBVB 2F7PA 3TO2A 1KLGA 4WCYH 5DJDA 4UM9D 2CIKA 1RU9L 2BVOA 3NH7H 3TYFA 4N2CA 1EEYB 2HPOA 3NJKA 3H56A 5EPPA 1URIA 4PLJC 3MLWH 3CC5A 4EN3A 1S78C 2MOVA 1M7IB 5AG8A 3DV4A 1YEFH 5F7WC 2E46A 1DSWA 2FBRA 4MCYA 2ZONA 3LPPA 3QQ9C 3U0TB 1OSPH 4HIHB 3IDYC 5AD0B 2R1YB 2A73B 3TNMB 1WSST 3LIUA 4M43H 3SDYH 4B7IA 3MRBA 4NQDA 3MOQA 1EBPA 2XWJB 4X6CA 4JN2B 4D0CB 1Q94B 1XF5A 1CGSL 2WIMA 2OCFD 1SOQA 4JN1H 3ZQXA 1M7DB 4FHJA 3FK3A 2P5WE 1G9MC 4FI6A 5HHMD 2A6DA 3FB6A 1OGAE 3C2AL 1SUJA 1YLBB 4F2ME 1EAPB 5HGDA 1AS6A 1KCSH 3I6KB 2MQ0A 2A9NL 4IKKA 4I3SL 1MFEL 2HXAA 4CSTA 1I4FA 1AOHA 5E8DH 1M05A 3EH2A 3FPXA 4HXBL 4AEIH 4Q9RL 3QA3B 1HC1A 3DBXA 1OP9A 1UD2A 1C1EL 1MVFA 2VDKL 5C0AE 2MWCA 4KY1H 1FP5A 3ULVD 3QO1B 3I9GH 4UWQB 3BZDA 2EABA 1X7TA 2VAAA 4KK8D 5TPWH 3FHQA 3O4OC 4M48L 1NBQA 3RX7A 4OZHF 4DUVA 2DEXX 4B9KC 4K71C 4NWUL 4MA3A 5FHBH 1DQVA 1OGPA 4MAYD 2H9GB 4ZW3A 4Q7DA 2HLAB 1EAOA 1F3DJ 3VW3H 4LPUA 4GIAA 4XZUA 3U2JA 5E94A 3JWDH 2ERJB 2UWEE 5DZVA 2MTPA 3VH8A 1B4JL 2HG5B 4L3EB 2V9RA 1WIPA 1PW3A 3S8WA 4UQ9A 4QRQB 1L9MA 2PXYC 1OB0A 1OIOA 3CE1A 1IFGA 4OBRA 4XC3H 3O5AA 4I1PA 5SWQA 4YXHH 2CRIA 2W92A 2H8PB 5ESAB 3AQZA 4L4TA 4XPFL 3CC1A 5K9JL 2E75C 3FUNA 2XWCA 2EUZA 1Q8MA 5H4YA 3HEIB 2AQPA 4QXVA 5E8EA 5KBDA 2IDQA 2M2DA 1U2YA 4LRIC 3P4OB 1SFDA 3BPLC 3K81A 1HXMB 5FXCH 2CHNA 3KJ4C 1H3XA 4XAWL 2FDBP 2DQGH 2YSTA 3RUGA 5MI0C 4MJ6B 3OKOB 3FUHA 3TN0C 4N2IA 3A4EA 2SEBA 1OTUD 4TL4A 5HDQL 4BGLA 2H4EA 1HWWA 1SXAA 3CDZA 5F3HB 4H4NA 3QULA 1JFQH 2YD6A 4GRLD 1OAYL 3EJYD 2WVSA 4WY7H 1ZLUK 4XCYB 3RDTC 5AW2B 1GGTA 4H8WH 4IOIB 2RMNA 4OIBA 4Z3EA 1MCWM 2MIZA 1B0RA 4LO9A 1J0IA 4NM8H 4XVJL 2YAEA 5IF0A 4K9EH 3D2UB 1A6VH 1N0XH 2G0KA 2R0ZL 2RAMA 2WWKO 3WIHL 1ZHBB 3BUTA 1HI6A 3TEZA 4W6WB 1KV7A 3BVVA 5FK9A 3SBQA 5IBLD 3AY2A 2E47A 4LHUD 3QNYA 1HZHH 4LIQH 2Y3AA 3BD3A 3DWTA 1WK0A 1TVBB 1T66C 3N85H 3X3GL 1XGRB 3BP6A 2ED7A 2R29H 3NIGE 5CR8A 2FD6L 3EJRA 1FO0B 4YLBA 4HUWA 5EF3A 1PTZA 1CFQA 2VQ1B 3WIAA 3ZL4L 4FMKA 4WJ5B 4DKFL 4RMQA 4ZNEE 5C0GA 2P45B 2D0FA 4QY8A 2FJUB 2GSGA 3FQXB 4LNRA 4Y1AE 4J4PD 1CGXA 2HKHH 4AC2A 4X7EC 1AZVA 1YC8A 4KZCA 3N1GC 2WINB 4QIWA 1KYDA 1FGVL 1NBVL 2QL1A 3QQDA 3RVVD 3V0WH 4MJIE 3B2UD 2N0KA 4NPYB 3WFCH 3F8UB 5JR1H 1BIIB 1HVXA 2X2JA 5DD6B 3UGXA 1Q1JL 1RUML 3DGCR 4JG9A 4HV8A 4DT2A 2QTEA 5EEVA 4XE0A 2PO6A 4ZO9A 5E6RB 5EZLB 3G5YB 3O11A 1A14L 3ALWA 1P7QB 3FT2B 3ET9F 3ZSSA 4ZFGL 1UVQB 1KZYA 4ZMWA 4PJ7F 5ADPL 4JFEB 4NC2B 5I0WA 4YBQD 4ANKA 2P4AB 3K2KA 4WW1B 3FQRA 1NCWH 2RR3A 2OJEA 3BGFB 4A1RA 1A7NH 2AVFA 4U1GB 3B83A 1S3KH 2PJJA 3HE7A 3PJSB 4P46B 4NX0A 3U9PH 3VD2A 4RX4A 2C9PA 3QUKB 2VKWA 1XF3B 2CCLA 1JXFA 4LSPH 5FDWA 5I23A 5I6PA 4QXTB 2OL3A 2WQ8A 3PWVB 5IWLA 4B3EA 4N85A 2J8UE 1QLFA 4R96A 2KS0A 4RGNE 1IAKA 3FQWB 1N7MH 1TEYA 1G9NH 3BWSA 4QXWA 1J87A 2QR0B 2IFFH 1BV8A 3M8OH 2I9LB 3UTTD 3FN0H 1S8DB 2Z91B 1MWAA 1P4BH 3K2UH 3LV3A 4PJEB 3PWJA 5F8RC 5FUOH 4OFQA 2ZXCA 2PICA 2BVQA 2ZOOA 2ATPA 2XJKA 4NNYA 4DEUA 2ZKHH 4BWWA 4H20H 1NA8A 2AZUA 5BJTB 4UNUA 5I0ZA 1LE5B 1EMTH 2NDGA 1NICA 3L3JB 1A1OB 1TZ8A 3ECVA 3OF6D 5IJKA 4IGBD 4AYGA 2VPWA 2R39A 2YD2A 4NKOA 4ZSOB 2Z4TA 4N0RA 4BKSC 1KJMB 3J2PA 1H3TA 1WBXB 3BW9A 1VJSA 3APMA 4K3DL 4XH2B 5FYKH 5CLXA 1P9MC 1FSKB 1I82A 5F70A 5KSBA 2ZJSL 5B7EA 3UBGA 3RFZC 3WTWA 1MSPA 5M95B 5DUML 4LASL 4FQ2L 4FTDA 4LLMB 1Z6JT 1I8IB 2JELL 3QZMA 5CP3H 5PAZA 4CDHA 1FZMA 1V05A 3QSKB 5A16A 4GRWF 5IQ7H 4UM8B 1SY6A 2XYBA 1TUPA 3AB0C 2SODB 5C08A 5AG9A 2AERT 4ANUA 1RFDL 2VN3A 3FT3B 1URLA 5C70A 3NSFA 1O7DC 4GSQA 3SGEH 2XWEA 4U1IA 5EUKA 1T0PB 4LCIH 4IU3A 3G04B 4NCDA 1G6VK 4OLWH 5KEZA 1B4LA 1C08B 4HPYH 5TDNB 5DJZA 3IR7A 4JKNA 1U8KA 3FU9A 4BKTC 5HDBF 4BH8B 1DJZA 2XVBA 3MKGA 3WNOA 2AEQL 4GAGH 2CZNA 3LXCA 2R9HD 1LP9A 3BUDA 5DMGC 3OVUB 3X1GA 3ULUD 5HYSA 3H3KA 4N0UA 2YPLD 4AW7A 3I85A 4AEHL 2JE8A 3IDYB 4HG4K 1DUZB 3IJYB 5AVYB 2AZAA 3OPZL 3X2PA 1LO3L 2A9CA 2W9DL 2WXIA 3UEQA 2VLME 4MJID 3SGDH 5T3ZE 4NZUH 5MENE 1I9IH 3ESMA 1GPOH 3VQ2C 1NPJA 3OC8A 1CVSC 2LU4A 3GSUA 5ETUA 3LCYA 5IG7A 1G1OA 1H5BA 4X6EA 4N1HB 1AQDA 3IF1B 5D71H 3TWCH 3W0WB 3L7EB 4HJEA 3HS9A 2PWDA 3QWRA 4JKPL 4QOKD 2OJ1A 1X5IA 4PJ8D 4LCWB 1UWXK 4D7PA 2ZD0A 3MA9H 3O2VL 1OGTB 2QGDA 5DFVD 4X9HA 3V6OE 2AI0H 4W68A 1GZQB 2AJSH 2BVUA 2NTSP 1U8OA 4LSSH 4XVOA 1JL8A 4L1DA 3T8XA 3MMEB 1REIA 3QIWC 5K33A 3TJHD 4ZOCA 3AC0A 4I18A 3O4OB 3WKMH 1SFHA 5HVWA 3LD8C 3P9LA 1A3RH 4K71B 4HMEA 5FYLL 1BBDH 3QR1A 1YEIH 2XG5A 4P59L 4Z7IA 4FLQA 1RAMA 1NGPH 2DQIL 4N0CC 3RNQA 4TVUA 3LS5H 3IU3A 3OR7B 2TRHA 4F57H 2AQ1A 1E2ZA 3VD7A 3GSOB 3GZPA 4R8WH 4TLTA 3IBEA 2HKFL 1L6ZA 3EO9H 1DFBH 4E36A 1JYVA 2HX7A 4XI5D 2EC8A 5IJBC 3O3UN 2XPGB 2PXYB 3QRGH 4JPKL 3UBFA 5C0EA 4Q14A 4NKIH 5DYOA 1OAJA 1ZA6A 2YD5A 2I24N 5T5NG 1QZ1A 5T5MD 2OSLB 2V9UA 3ZDXB 3LQZA 4OCMC 1GOFA 2DYPD 4X6DB 5IHWA 5DWUL 3EOTL 5JHDE 3MLSH 1J5OL 5JMOC 5JOEA 3VFWA 1HHIA 3BCFA 3DOSA 4R4FH 3V0DA 3BPLB 3RIFF 4HIIB 2ADGA 4OY9A 5INDA 3KJ4B 4KFZC 3IFLH 2VDQB 3BP4A 4PYGA 3TN0B 3AZUA 3L9RB 4WGWB 5C18A 3LQAH 4GOSA 1Z32X 1DVYA 1OAQL 4PRAA 4S1DC 3EYOA 3RDTB 2XN1A 5DT1L 5KOVC 3O4LE 1S9KC 1EWHA 1WFOA 4EN2A 5D96C 1Z1WA 3E1ZA 2BWIA 2YLKA 3CZBA 2WXRA 4EIZC 2C1OB 1QEXA 1JWUB 3RYMA 3KM2A 5BS0D 3VD3A 1MJJA 1U58A 1I9JH 2R0WH 3FNKA 3P3RA 2G30A 1G0DA 2NZ9C 4JQIH 1ZTXL 3RWGB 4L18A 4NNPL 1UH2A 3HHSA 3HG1B 4OZFB 4PWHA 4O02B 1JI2A 1JD7A 4P0DA 3UZQB 5EA0L 3MV7A 4LU5H 2UUDH 4PSPA 3CDFA 1KB9J 3ZO0A 1FGNH 3UJJL 1DLHB 1W72A 5IMLB 3I02A 3VI3B 1KJ3H 1UYWL 1JUFB 3DMMC 4JQXC 4L3CA 5I1HH 1E5CA 4QTHA 3ZVVA 1JPSH 1ZJBA 1F6LL 1IKFL 4Y4HD 4KMLB 3MV9D 4QRSB 1X44A 1F97A 4H1LB 5I73C 1PKQB 3OQRA 2JIXB 5K39A 3BQVA 3BLBA 1F6AA 4NC1E 3QI9C 1BAFH 3CFNA 3S3DB 5CWSB 4ACPA 5IB2B 3L45A 1DTUA 3V4VH 1WD9A 5BVJB 2VN7A 5D1XE 4NENB 1UXWB 2BOCA 1PFOA 2Y4SA 4OI8A 4PJDA 4QYOA 4MD4A 1FAIH 2HA1A 1GC1C 1B90A 4H88L 1BXUA 3W9DB 4BZ1H 3QDJE 1TEFA 5F3BB 2P5EA 1IGCL 4HUMB 3JTTB 1PG7L 2G5RA 4KVNH 4O2CA 2I07A 3IKCB 1W0VA 3PWUB 5CBEB 1VADB 4L8DB 4PREB 3ASWA 3IJSB 3SDDA 1U3JA 3QUMB 1JHKL 4GKNB 4ZUSB 2RJMA 3V9EA 2Y7SA 1NBCA 1UT2A 4K8RC 5FO2A 3V0GA 4OZIA 3S37X 1TNNA 1F42A 4M4RB 2MKWA 3SDCD 4HMCA 5FUCC 4BE6A 5DVNA 5DQ9A 1KCUL 1CL7L 2E3VA 5D7LD 1K5NA 1T5WA 3FZUD 4CVXB 1YZZA 5BV7L 4IKNA 1SBBA 2NY5C 5GSRA 4BKLB 1D7DA 1IUZA 1JJUA 4NUPA 1S3RA 4DOHE 3IXAB 4R4ND 3U4EA 1ZA3A 5FKAB 5AZ2H 4BIKA 3EYVB 5AB2A 3TA3D 5C9JA 2BCKA 4AYFA 1MJ8L 4EIBA 4CS0A 3FBKA 3TURA 1OAKH 2B0SH 2CXGA 2Y2TA 3BDYL 3F62A 4AT6B 5L2KB 3QEQB 2F1BA 3BVNB 1EO8L 3BSZA 4PJCF 2C8NA 2Y5TA 3RFZB 1CE1L 1EANA 1UC6A 4RDBA 3LPWA 3Q44A 1EXUA 1FFOB 1MF2H 1ZLSL 3SKUD 3Q1SH 4LARL 5JTWA 4E5XA 1T1WB 4JJHA 1J8SA 1JZDC 1W0WA 5DJYA 3AB0B 5KS9A 3ABMB 3GTKA 4HULB 1CFTB 4P23A 2XN9E 5E8PB 4Q97A 4NZJA 4ZM7A 1NBYB 2AQSA 2WSPA 1SXSA 3B9EA 2EEXA 4N25A 3T2NH 1Q0YL 2X6UA 2E0PA 1DQKA 2P5WB 4Y4KC 3TIEB 3IAPA 3HU1A 1KTJA 4F9LC 5A7EA 5IVNA 1BFOB 3GF8A 3ZPDA 3G6AB 2WQXA 5JHLH 1JZ7A 3DPBA 1OOWA 3N44B 4OGAC 3JV4A 1GMIA 2VITB 2VQ4A 3MRIA 4H8VA 1PCXA 2KDGA 1XIWC 4N9OB 4L4VB 2YBGA 4PLKC 5ALBH 4QHMB 4PY8I 5GSVA 5LGHH 1XGPB 4NM4L 4PGCA 5CZRA 4JO1L 3V9FA 5C0FA 4Y5XC 4ILDA 4KI5E 3VI4F 3ABKB 4OLEA 3U2SA 4N0YH 2Q20A 1S4IA 5GS1C 2PPAA 1ZD6A 3QT2A 5D9SB 3DURB 2XXGA 4Y4FD 3AQXA 3MRHB 1B0IA 2DLFL 1TJGL 4TQHA 1DQDL 3QWZA 2WJ7A 4F80A 1I7UB 2PW1A 5D1XD 5D7JC 3SZKC 3MUGB 1D5MB 2VXTH 4ZAKC 4W9HC 1MEXH 4HSCX 5DK2A 5SWSE 3QHFL 4KZEH 3O6MH 3CN1A 2F58H 3U6RA 1HS6A 2VN5A 4LCCC 3T0XA 3CBJB 2NCMA 4HWNA 2E56A 1WYJA 4AQEA 1ZIBA 4N9GB 5I18L 4MBOA 3Q8FA 3S9DB 2NYZA 2EEOB 1YQVH 4RIRB 3K0WA 4XCEA 3L9EA 3GSXA 4H40A 2F54E 3K6IA 4D0BA 3HVNA 2BSEA 3SQBB 2O6DA 5FLUA 3QIWB 3AS2A 1GW0A 4ZO7A 2PN5A 2YOCA 3HMXH 1PQFA 2BSTB 4MB5A 5DJ6A 4KPHL 3LD8B 5KYNA 4C56D 3DC0A 3TFBA 4I85A 4EUPG 4RAVB 2EO7A 2F19L 5C0DA 3UDWC 4X5XB 5GS0C 4EVNA 3UGEA 1QX1A 2D73A 2NY4C 1XXFC 2WB7A 4P5TD 1CLOH 2HT2C 1DVTA 1MRFH 2KLRA 5ANME 1F4YH 1YRKA 2Y9RT 1ZV9A 4XHQA 3M7OA 4V33A 3V5DB 1GCYA 3HG2A 3T0EE 2EICA 1C5CL 2OTUB 4QAWA 5E5RB 1W15A 3T3MB 3H0TA 4LSQH 4B9IA 3LZLA 4OCSH 1EJOH 4JRYA 1WAPA 2X3BA 2Y1YA 3MOAL 2RB8A 3N5AA 4YHLH 5AOMA 3FTWA 3WFHB 4LDCA 1QSFB 2YFOA 5DEFA 4QHNA 1AKPA 1ZVHA 4K15A 1PIGA 5EIIG 3FYEB 1I8LC 1MCBA 2YN3A 4M62H 5EO0B 1RZ8B 4NO0D 3ZE1F 3PQYE 1AYRA 4PV9B 4GQQA 3AMLA 1JGLL 4UT6A 1KYUA 2YEZB 5BQDA 1YA5A 5CKGA 4YX2H 3UG4A 1NEZB 5SV3A 2OR9L 2VR4A 4HGMA 4KXZH 3DTDA 4AVKA 1D6EB 1FL3A 3EIFA 2BNUA 5EOTA 5F1IA 1A7QH 3QIBC 4L5FL 1FNEB 2EDJA 4G1MA 4LQ1A 5D96B 5I6LA 4IEFB 1P7HL 4IIZA 4JG0H 2Q2EB 4DFIA 2ZUWA 4HDIA 1BJ1J 3PWNA 4JLRA 3PIQB 4MMXC 3WS6C 2BC4B 3AWEA 1HQ4B 3G08A 3MN8A 4KO7A 4YLCA 1L7IL 1GY1A 1OWWA 3MCYA 4B50A 5C07B 2C4FU 4D8PA 2BINA 4XTRC 4R90L 1OARH 4M1GL 5HI5D 1M3JA 4YGVB 3BQUD 2N3JA 4YHNA 3MRMB 1FA4A 1WBZA 1YJDL 3ECWA 1KCRL 1RZGB 3LH8A 3MAWA 3DMMB 2OYKA 4JGUA 5LWYH 2VR7A 1U4EA 5I73B 3PJNA 4NRZB 3UJIH 1SEQL 4KRNA 1N0LA 5F7DA 5EU3B 3AS0A 3QI9B 5ISZA 3W57A 2FH6A 3VFUB 3EYQC 4Q6YA 5I76B 5JHBA 2WCGA 2D7NA 1CBVL 3UIZA 1CYGA 1BLNA 5D55A 3CK0H 3QHTC 3RWHB 3O6FD 4HH8A 5IQ9B 3IR5A 5DYIA 2ZWYA 4X7CC 4K94C 3QJVB 1JBJA 3SKJH 3KWXA 3VXRB 3L3OC 4HK0B 2BOLA 5IIEA 1OSZA 4MA7H 4WWKD 4ETYA 3HMWL 3TT3L 4IHBA 1A9BB 5JA8B 3Q3GA 1VLXA 5IT2L 4APXB 5GRXG 1NUFA 3ARDC 3VD1A 4ALAL 3GJFK 1NIBA 4H5SB 1CLCA 4NQEA 4PJFA 2CO7B 2DJ4A 2EE6A 4JK0D 5FM4A 1F3JB 3NESA 4S0SD 3MJ7A 2Q76B 4K7FB 1MAML 1ZLVH 2PI8A 1OF2A 2K9FB 3CU1A 3OJMB 3H7BA 4OCLC 2YMXL 1UWGL 2HTKD 3VSTA 2EH7H 2VXSH 3C5ZC 3VRJB 1UZGA 3TPUA 2C9AA 3CFJA 3GSVB 4BSWA 4I88A 1AO7A 3UC0H 5BCAA 1XGTA 5IQOA 2IXQA 1JNJA 2L7JA 4OUOA 2NNFA 2ZX9A 5HHOA 3FTSA 5JW4Q 1EGJL 3F58L 2W88A 3IXTB 4R7LA 3SDAA 3FU0A 4L23A 4WW2C 3DO4A 3NABL 2RH0A 2CRMA 4W9FC 1JYWA 2UY6A 4PBXA 5KJRL 4J23A 3TVMD 4P2RE 4FFYA 5K1JA 2GSIA 2R7ZA 3KW8A 3NBNA 5F1OB 4P4RA 1I3RB 1ZHNB 2AJVH 2CNZA 4XRCB 4EOWL 5GGSY 3FQUA 2QQLL 4HISA 4P5MA 2VYRE 1KTKE 2IWGA 3GNMH 5AZEH 5DC2A 3IFOA 3ZDWA 2NMSA 5CM1A 3WTSA 2X6VA 5F7MC 4RMBA 4EKXA 5IVXA 2ZYSA 2DQHL 5I0YA 3PGFL 4X4KA 3SBRA 4KH2A 3LIZL 1WWCA 4DESA 3GB7A 2VUOA 1HHGA 2EVFA 2XV2A 4KO5A 4Y4KB 3IDXL 1UT9A 2OX5B 1EO5A 1GXEA 3NJXA 1TENA 5HYJB 2MCPL 1KBWA 1ILUA 1P0SE 4UM9A 3HZMA 5DZOA 3RVWC 2APXA 2DJSA 3FONB 3KLHD 2FX8H 2EIDA 4F15C 5CP7A 1XIWB 4L48A 1F58H 2O6FA 5DZPA 3WXVH 4K23L 4Y5XB 5CZVL 2H1LM 4Z3JA 4PD4J 4PTTB 1S9YA 2FBJL 5GS1B 1CTNA 3QORC 4I87A 2I32A 1G7LA 3D12B 4HJIA 5F9JB 5D7JB 1J8HD 2DY2A 1JS4A 1OCOB 4ZAKB 1BQRA 4YXLL 4TQEL 3L16A 3RLSA 3RZCD 4ZK8A 2J1ZA 4PSRA 1OW0A 4J39A 1R24A 4LCCB 4PJIA 5KW9H 2ZKXA 2AV1B 3ARFC 1OAXH 3CSPA 4JPVH 4PLOB 5DD3H 4MZRA 3VH8G 5HVFB 1FH5H 3GXPA 4PW4A 1WV7T 1HH6A 5BOPA 4GQ9L 5E2VH 3U1QA 3AG1B 1R5IB 1WLHA 1QUNA 3P30L 2YJQA 3ZKND 1PGRB 2D7PA 2XA8L 1VDGA 5K9QG 2XQBH 4LOFA 4PJAB 4U4BA 4R3SB 2ICWB 1NJ9A 2X28A 2Z1PA 2YQGA 3LVEA 4NDMB 1EHAA 3IU4L 5TDPA 3C60A 4OLVH 2NY4B 1G9HA 2FYYB 3NJFA 3O45B 4MAYA 3RBSA 1NGXA 2O72A 4P2QB 2IQAA 3WIFA 1OHQA 4KAQL 2R1XA 5IGXH 1T0NA 4GSDL 5E1AB 4IMKA 4RAHA 7PCYA 2YR3A 3SDXF 3U6XS 3QCVL 1G9ML 1AIFB 2B8OT 3GS4A 3P9WB 4M5YL 1U41A 4WFFE 4DP1X 4G3YL 4AGLA 5AUMA 3ARBC 3K8KA 2FJFB 2EZ0D 3GUTA 3MLUL 5D1QE 4ODHH 4M8QB 5FA4B 1B6UA 3DRQA 4ZTPL 1NM9A 4DVRH 4ONFL 4S1QH 3U7WH 3FQ1A 2V5MA 2EACA 3C8KB 1AHMA 2JK5B 2XWDA 2N7SA 4ERSL 1H9VA 4N90E 4H2AA 4H7VA 1TLKA 3CFDA 3CZKA 4KKAD 4Y7MA 1QR4A 5FKPA 4J3OG 4YHZL 1ZE3H 4YWGH 2D7OA 3KPOB 1LO0L 1J12A 1JV2B 2ZOUA 2QPFA 3HLKA 3QIBB 4GMTL 1DQQB 4KXCA 4GRLA 4B9ZA 3NCBB 5KVFE 3LZPA 3CBRA 4MMXB 1MZYA 1BP3B 4DKTA 2G2RA 5CINL 4RA0C 4PS4L 1T1ZA 1H9DA 4OTXH 4RZCB 5EPMB 1F1AA 5D7IE 3DX4A 5ENWB 2WLIB 2EDFA 4TQ8A 3QJHB 5HPMB 5I28A 3TTSA 1I3QA 4HH9B 3O3BB 4PIBA 5T5FA 4ELMB 4UINH 3BEWA 1XBDA 1KEML 1ND0A 3LKOB 4L3ED 1ESOA 5IBUG 3MBXL 1DEEA 4ENGA 4YZWA 4X8JB 4S2SA 2WWKT 4N3UA 5EOCL 4URTB 2VLKB 2VRAA 3GXFA 1XEUA 3IDIB 4OQTH 4BSWB 3Q9QA 2HT3C 3OV6A 3PS6A 4HK3J 4J4PA 4JHAH 2VDQL 1E3ZA 4E0RB 1XSJA 1GKOA 4N8CL 5KBMA 1E8YA 1FZJA 4TTDC 5DWPA 1XGYH 2BIQA 2VZOA 5AFAA 2PWEA 3OX8A 3FRUB 2CCWA 1NWPA 3L3DB 5DI8A 4KK9D 2W60A 4QTFA 3L8QA 4O2EB 2ARJA 4DKEH 2AFNA 2RFXA 3LKQB 4U05A 3HC0B 1U42A 3MV8B 1HCFX 5JXEC 3IEAA 1I7RB 2L4OA 2N1TE 3D50A 1MCPH 4FXGA 2IGFL 5EUOF 3RIAK 4NKMA 4F7MA 5GS2H 5D2LA 5DUBA 3ETSA 2IO5A 2A9BA 1H6EA 1L6PA 1MLBA 3L3OB 1LWRA 1ZHLB 3D2UD 4U31A 1CXLA 5I8EA 5IW6B 3X2GA 7FABH 3REWB 2VR6A 4TUOB 3L08A 3BZFB 4O02L 4UTCA 1ID2A 4K5NA 1LILA 2ITDB 2D03L 3CTTA 4XVUD 2JQAA 3FTGB 5K9KB 3ARDB 3LDBC 2OYLA 5JO5A 4MNGB 3KYNB 3WS3A 1R46A 3HZVA 4ZOEA 2H0JA 4AK1A 1X9LA 5FYJL 1MFMA 4WSKA 4TSBL 5AYQA 2Q8BH 1LVEA 2MFNA 4HXAL 4Q56A 3UTTA 1KYOK 2I85A 2NX5E 2KMWA 3U1SH 1IBBA 2YKLL 4F7PA 5BO0D 2F15A 1XBRA 4MFHA 2BLFA 2C1PA 3C5ZB 3IN0A 4RMUA 3JT2A 3LNGA 1B0GA 3QFDA 4LE8A 5FX3A 1QZNA 1KPVA 3KGUA 4OSUH 4PJXA 5BUPA 1AAJA 1C8QA 5JA9A 2DWXA 3OF6A 4KFMA 1LO5B 1PD0A 4IGBA 1F4HA 4JUSA 4U1NA 5DHVA 5F72S 1KV3A 1VCBC 5CJXA 2AV7B 4KQ3L 4WW2B 1XZ0B 2RALA 4F7TA 3NN8B 1P7QD 5IB1B 1U92B 1INQA 4OZHE 1ZCRA 3L2NA 4JFED 4OJFL 3ASNB 4BFKA 5I1AA 2EVIA 1GHFL 4XN2A 4H8PA 1T6WA 2VM9A 4ZFOA 1UHVA 1XR9B 3SKOB 3EXJA 1T0OA 2C3GA 4WDIB 4P46D 3GM0A 3P1VA 5F6IC 2XZZA 5FOBB 2A69D 1ZV2A 1NPNA 4NZDA 4EUPH 1U8MA 1R3IL 4NQCE 3BRFA 3A67L 2K1MA 4M3JA 4KTEH 5ICYA 4H8HA 1YEHL 4AV5A 1MFVA 1YNTF 2P8LB 3RA7H 3AAZA 3OJDB 3ZHKA 5TF1L 1FPTL 4AQAB 3NSYA 4NQTA 2IADA 2ZWKA 2CDGA 4PTUA 3PL6C 1A3LL 1KT2B 3VFNA 4L8SA 4F15B 5IJDC 4NZTL 1UXSB 5A2FA 1JZ3A 4CVUA 5FGRA 3HG3A 2WLZA 4ZQKA 2K6YA 2H6PB 3QH3A 3JXAA 2YU9A 2HUEA 5GGUA 1RMFL 2Y69B 2YPLA 5GIRB 3JTSB 2X4PA 4GINA 4LVOC 5L4JA 1YPZA 5GGQH 3PHSA 3BHBA 3FDWA 4LLUA 3QORB 5ESQB 1BD2E 1FHGA 1UD8A 1Z5HA 4MJIA 5I19H 4KKBD 4TQPA 1DVQA 1FFNB 3TBTB 3AM8C 4E41B 4QRPE 1RHHA 4FXLA 4OIAA 5E2UH 2ENYA 5KN5B 1VEMA 2WM0A 4OGXH 2WKGA 2B1AH 3WNIA 4Q89A 4D9RD 1I75A 3SIKA 5DMIH 4B27A 4U3SB 4MMZA 3QQ3B 4H0LC 3STZA 3SYQA 3ARFB 1JN6B 3DYPA 5E95B 4C2MA 3UAEA 2LLLA 1GZPB 1IL1A 4QOKA 3SBWC 4UT7H 5BPPA 4PJ8A 5ACZA 3ZR6A 2E7MA 1C7SA 4HIJA 2VDPH 1JPGB 1THAA 3LXUX 5J3HD 4NHUA 3BXNB 3W56A 4PB0H 1ML0A 3GIVA 3MODH 3RWEA 1PLGL 4MJJA 1PFCA 5IOPB 2FWSA 2UZPA 3S5LA 4PLJD 4Q4EA 1PX4A 1S78D 3HNSL 4LIQE 1HHJA 3EUUA 3D0VB 5HYQA 1FVDA 1X5YA 3DJRA 4R5VA 3RB5A 1MCOL 1ZSDB 4WSJA 1U93A 1K83A 5F8QC 3QQ9D 4YNYB 3GBNL 2EE9A 4LBEA 4NRYB 3WMPA 2QV2A 2X70B 1NCDH 3P4MB 3V5HA 1ETB1 1KTDA 2AK4E 4GUPB 3CVDA 4O51A 3CFCL 3BN9C 3M7FB 1IC7L 4OW6A 4IRSC 3RAJH 1SM3H 2X4QA 2DBLL 3FH8A 4L1SA 4CJ0A 4YHML 1CVRA 2W65B 3ARBB 3SUKA 1OSYA 3W0WD 4Z0BL 3S36X 5CCHE 2D31B 2IPUG 1N4XL 1PSKH 1J11A 2FWLB 2V3VA 3VCLB 4AYDC 1L9OA 4HOWA 2DYPA 1GIGH 3DX2A 3MRPA 5MERA 4GUOA 4NZFA 4PCTA 3NCYS 4LCWD 4PCSA 1Q72H 3EAKA 1JZ5A 4FG2A 4U6XA 2AABH 2VSMB 3V6FB 3IGFA 3K1KC 1JMXA 4X7FC 5BVPH 1HX0A 2YPVH 2EDLA 1XSIA 3LZFH 4NJAH 3FT9A 1AGEA 2VMCA 3BDXA 4YHIA 3ZU8A 2UXFA 4F3FA 2PTTA 2F68X 4L8BA 2Q6WA 4EPSA 4N5EC 1DQLH 5IR1B 2E74C 5TH2A 5FW7A 5HYFA 2C3HA 2WXMA 1ZS8B 4QCIA 2AW2A 2P1YA 4ATTA 1KELH 2FJHB 5D8JL 1NFKA 2DDQH 3T0AA 4LLAA 5BS0A 1QAWA 1ID5I 5KVDH 4ZI8A 3ZYJA 3BKJH 3T4AC 4BDVA 1G9EA 2PXYD 1T83A 4KC3B 4YHPA 5HHXL 1FAKT 3ZDYF 2VM4A 2Y0SA 1MQ8A 3L5WB 1KBBA 4C4KT 1P1ZB 1I1FB 4LEEA 2ZP9A 3X2MA 2L04A 2A1WH 5GRYA 1T7VA 3BKCH 3P54A 3QNZA 2EYTB 4Z7NF 5EZIL 2VISB 2CM6A 3MLRH 3U4AA 4GRWE 3CQFA 4PRBA 5F7UA 3S3SA 2QSVA 5E7FA 2PNDA 5FYKE 3WY3A 4S1RL 2K7QA 5J9PA 4M7JH 4XOBA 3UMNA 2HVKA 1DJYA 4MDIA 4Y4HA 3CIQA 3MV9A 3GSQB 4PRHB 2NUPA 5DJAB 3D3VE 3MGOB 1IAMA 2GEEA 3RDTD 4HF5L 1EHKB 2HTLC 4PJGE 5D6CB 5DRXA 3V6OA 2QT6A 4F8TA 3LNFA 1JP5A 3FSWA 4NC0B 8PAZA 5TK2A 4O5LH 3G6JA 5EBWA 1Y0LB 5EFIB 1KUMA 5CZKA 1CG9B 5CSGA 5FO7A 1VF5C 3T09A 3OAYH 4QHLB 8FABA 1KXQA 4AXWA 1ZHKB 1SQ2N 3ELAT 4W9JC 4I3GA 4W93A 3N41B 3VFMA 5IK3B 4X6CF 3C12A 2AHIA 3HG1D 2XT1B 3L17A 2VLJE 1T66D 3DUUB 1EFQA 3VFOB 1TTUA 1WA2X 4W4OC 3KS0H 2KQAA 3LDBB 5EULV 2A2QT 1TFHA 1KNOB 4GQZA 1T22B 2VJXA 3T1FB 4B0MB 2X12A 4FQLH 4JFDB 4ZD3H 5MEOB 3Q8BA 4X80H 3THML 4GKSB 4G9FE 2DICA 3BT2L 3SDCA 3CZJA 3FH5A 1MCQA 3IJ9A 4YO0A 4IW4C 1MPAH 4E5XG 5D7LA 4JB9H 1H3UA 4HQQL 3K8MA 5IEKA 2GI0A 1CIUA 3DIVA 4TPRH 1MCCA 2JIXD 5KYUA 3PP4H 3TA3A 4X0KB 1QR1B 4FQJL 1Z5LB 4PCYA 1T20A 5DJ8A 5LO7A 4BSVA 1XAKA 2IH1B 1FRGH 2NQ3A 3ZJAA 3O3DB 4JPIB 1G6RL 2VLLA 3RURA 3U2IA 1QBLH 3UBXB 2WZ0A 2PPDA 4OLZH 3UC2A 1NBZB 5F6IB 1QSEB 3KWWB 2EDRA 3DJZA 1HFUA 4RWYL 5IV2A 1EHLL 5DJCA 2ZSWB 2BRRH 3CUPA 5ACMA 1NH6A 5HHPB 4Y9FA 1J86A 4K8RL 1C5DA 3L4VA 2IG2H 3BGMA 5IQMA 4KX9A 3PL6B 3IR6A 1IJNA 5HY9A 3OAUL 1RZ7L 3NQIA 3X3FH 2DH3A 1A6UH 1VFUA 3G6DL 3TM6A 4BHUA 3DX9A 1MREH 3WDHA 1BQLH 5D93C 4LSRL 1JNHA 4LVOB 4IKIA 2FATH 4G5ZL 1NCAL 4WV1A 1TJHL 2JKWA 3TYGH 3DYMA 4FQQA 3BPCB 2QHRH 3VXPA 4J3OC 3QEQD 1MRCH 1Z9OA 5DQJB 1CI3M 2NRDA 3PDOB 3MNMA 4Y4FA 3EF7A 1OB1B 2V3DA 1CL7I 4J2QA 4J1UA 5IM7B 3W9EA 3TNNA 1LMIA 1QFUH 1M7UA 2WKLA 4ZOBA 5D1XA 5SX4H 4MZ2A 1AD9A 1G7IB 4HZ1A 1WH0A 3NJMA 3RKDD 3WSQH 3FFOA 2OZ4H 2Q87A 2CR6A 3O9WA 5T1KB 1LDSA 5LGJA 1BGXH 4JFTA 2L7QA 1MXDA 5T3ZL 3CZNA 3FHEA 5L2JA 2Y23A 1N59A 4R7NA 3QXDB 3MYJA 4AIZA 5D6DC 2IALB 2DBJA 2XFGB 3KG5A 5FM5O 2CDEB 4POZC 1AMXA 1LQSR 5DSCA 3ARTA 5JQ6H 4C56A 1I7TB 2DM3A 5DMGD 5GGTL 3QQ4A 5DO8A 4KKRA 2OMUB 4J12A 1D2OA 1MLCA 4L4VD 5C8JA 3CCHA 4GAJH 1BQ5A 3RVUC 4HWUA 1HOCB 5F0MB 5DMKA 5HHVH 4P5TA 3A3YB 4ZX6A 5J6HB 1JGDA 1DVUA 2BK8A 1BVOA 4IRSB 1Z7JA 2NT0A 4AUYA 4F1SA 1KWGA 3NIFB 1J1PH 4C4UA 2OL3H 5DHXB 4XWOC 2HH0H 3HI6L 4U1KB 3WTYA 1IEAB 1NGYB 2V17L 3PF2A 5EU6B 2F0CA 3D39E 3T6ZA 4HGWB 2FIKA 4JY4B 1MWAH 4FFWC 5FTMA 1AI1H 4PUBH 3UYRH 4YSSA 2O6PA 2WMPB 2K3TA 2AXHA 4DGIH 4XE5B 2PWFA 1ZTMA 2JB6B 2L8AA 4NQVB 4DTGL 4LDOB 3VNZA 5JPMC 3F7VB 3HPJA 2BVPA 5IKCB 4ZTOL 2N0MA 3QIWD 3TBSA 1ULVA 2YUXA 4IBLT 4K5PA 2J7LA 4YSOA 3GTLA 1N64L 4FKHA 3WNJA 3NIDF 3UTZB 5GS0L 4XBMA 1I8KA 2FX7L 2HPTA 1A7OL 3FCSB 3ZDZF 1P1VA 1UEMA 4PY7A 4NP4H 5F6HJ 1J5HA 4NO2A 4PRPE 2OCCB 3KR3L 4FJZA 3DO7B 4OD3L 2V7HA 2J55A 1V3JA 2JJSC 2BXZA 4PJ5B 4PRDB 2GJ6B 4GJTB 2GVYA 4JVUA 4ZPVA 3BO8A 4BK4A 3MUUA 1XFPA 2JIMA 2KZBA 4R26H 2CLRB 4XO9A 3RPKA 3T4AB 2OZNA 1DUYB 4OLYL 2J88L 1Z9LA 1SY6H 2DQFA 1WBYA 1A6WH 2CD0A 1G87A 5KSBF 2FO4B 1Y1DA 5KYYB 3L3KA 4PJCE 4UV7H 3QXAB 2IDTA 1MDAA 4B0MM 3BQUA 3D18A 1DBKH 5FF6A 2XCMC 4QDGA 4AZ8B 2LGNA 4Z7VB 4LLQA 1QWUA 3A24A 3Q8EA 4KVCL 4YJZL 1U8PA 1V5JA 3LS4L 1YLEA 3UPAA 4G1EB 5DD0L 1H8OA 2Z92A 2QLVB 1OAUL 3UTOA 2V0AA 1EJFA 2W81C 4FERA 2EO1A 4YSPA 2ICES 4S1DD 3QDAA 1ECZA 1UQSB 2QTVA 1BWMA 3FJTA 1RURH 3ATAA 3BOVA 3ROOA 3NRQA 1QATA 3AXLA 3F64A 3MO1B 2RIKA 1MCEA 3RRQA 1GA2A 32C2A 1BM3H 1T03L 5E51A 4RMTA 1TVHA 4I48A 3MR9A 4AMWA 1CUOA 3O6FA 5D72H 4L1BA 3OKDB 2J8HA 1D7BA 3CFEB 5C09B 3RX9A 1IRAY 4FYQA 5L88H 4L0YA 3CXFA 3X11A 4WWKA 3VXSB 4IS6A 1O9ZA 5C07D 3PV6A 1RY7B 3NDZE 3VFTB 4AAYA 2R93A 3WNPA 1ED3B 3VGHA 3PGDA 4GO9A 4L2LA 3MGTB 1UB6B 3MRCA 3GMMB 4EEEA 5CD3B 2WZ6A 4MA8L 2I9TB 3LKSA 1JHLH 2EDTA 1FG2A 2UXTA 1AYOA 4JAMB 4UUJB 4IHOB 4AM0A 2D3NA 1BFSA 1FCCA 1TKWA 1TLMA 1XGQA 5I30L 3DMMD 2Y25A 3GTTA 1E4KC 3VRIA 4UZUA 4G8FA 5HJDA 1PIFA 1E5BA 2ROYA 3ASOB 3BFWA 3D39D 2VW4A 4ELKB 4ZS7L 4A7GA 4AENB 1CBJA 3BAEL 4OT1H 2OMZA 2P47B 5IFAL 4ZMVA 3QI9D 2F7IA 5FECA 5BQ7B 4HKXB 2YGQA 2ZOLA 4LOVA 1LEKA 3DX3A 1DJWA 5PCYA 4FP8H 3E2HC 5AW8B 43CAA 2YAQA 1DN0A 1WFJA 1DBJL 1FORL 1PYQA 1AGDA 1LGVA 3X2QB 4DQAA 3TVMA 2CRZA 4F8OA 4ZS6C 4OF6A 1GVIA 4YLQT 5J7CC 4FTVB 4IDJL 4L29B 1VPOH 4PBWD 4YDJA 2AJXH 1LO4L 1QVOA 4NYLB 1K8DA 4OVUA 3GI8L 1MRDH 1J0KA 3GD1C 2XRAL 2A83B 5F9OL 1DVSA 5ITBL 3OTTA 2HVBA 1N5YL 2X38A 3H85A 2Z9TA 5I1CL 1W0YT 3QEUA 4GQRA 1FC1A 2YWZA 4WO4C 1IM9B 2Y2YA 3JYBA 4HIQA 4OZGA 3PHQB 4WNQB 5CIPB 4P2OC 4P4KC 3Q2CA 1BQSA 3NDYE 4CRYG 4GG6B 2YD7A 3M1CA 4YDKL 3RIAF 1AD0A 2IH3B 2VXUL 1QWHA 3ILQC 5I8OH 1RZIA 2IAAC 4M93C 1SJXA 1NOLA 2WQUA 3ISYA 4I4WA 1RULL 4ONHA 2ZUSA 4X6FB 5D93B 6PAZA 5B1JC 5DUPL 3BE1H 4UT9A 1AGBB 2EEFA 1BM7A 3DXAE 3GTGA 4G8IA 2PR4H 2J57A 4XO8A 1J9QA 3F7PC 3QUHA 4FADA 4Z8FL 1MHPH 4KXAA 4KI1A 1DR9A 3HS8A 3VFGL 4D9LL 2GAZA 3VDCA 5IMMB 3I6LE 4JM2F 4CMMB 5GPRA 4TNEA 3WL9A 1J8HA 3UAFA 4PGBB 1Q16A 4HUUB 1ZT1A 3RZCA 2EIMB 2NR6C 4FQHB 1YQ2A 3H42L 4XP6L 3GMNA 1BVLA 3ZTNH 5CCKL 3SD2A 2VXVL 1JVKA 2XFXB 4I77L 1W72H 1RJZB 3ZT6A 1KLUA 3PAYA 5ALCL 1PZ5A 2VB5A 2A3TA 1MI5E 1O9WA 3Q05A 2AEPL 2VTFA 1IC5H 3P4NA 2G4EA 4O9HL 2G2NA 1NL0H 1IKNA 4Q9QL 2Q8AH 2ADJA 4PJ7B 3TBVA 1GYAA 4KX7A 5HYJD 3A4DA 4XNXH 5H37A 4GAYB 5B3JF 2ZXDA 1UM4L 1AH1A 3WTTA 4OGAD 5F1SA 1EEYA 1MHEB 1UACH 4RDQF 5HJ3B 1MDTA 4YQXL 3D4CA 1XIWD 1F8TL 4PLKD 4PGJA 3ES6B 4JFOB 1M7IA 5CSZB 4LPTA 3NCJL 4I0KA 5CMAB 1R75A 3UMTA 1QRKA 1XB6A 5GJSL 3VXTB 5E6ZA 3U0TA 4HIHA 2R1YA 2HWZH 3MRNB 3TNMA 3KL0A 4WTWA 3CFTA 4IRZA 2G3MA 3I6SA 5AOZA 3F7RA 4PJDF 4XN8A 4JN2A 2P8MB 1Q94A 1KDJA 3ETTA 5D7JD 1DJXA 1M7DA 4ETQB 1MJUH 3C5JB 1HK6A 5T1DL 2FGWH 1DVXA 1TMQA 1YN6A 4FFVD 2GIYA 1XWVA 1BJ8A 4RBPH 1ZDSA 3FUJA 3I6KA 1DQML 1T2JA 3SOBL 5CLWA 3PREA 1HEJC 2OV0A 4XNZC 5E4EC 5EORH 4NHCL 5JPMB 2MSPA 1KQFA 1PX8A 4NT6A 3W39B 4BQ8A 3QA3A 1KENL 3POCA 2ZCLL 2NT1A 1D7CA 3QO1A 4FLSA 4LPVA 5DR5H 1ORSB 2J3SA 3ILPB 3BSZH 3O6KH 4M56A 5GRVK 2NY4D 2F1EA 1TWHA 2AQQA 3GIZH 5J6GB 2H9GA 2WYZA 1QFHA 2HLAA 2HT2D 1LK3L 1UJTA 4P2QD 4BK5C 2BOBB 2X2IA 1U4FA 5KZCB 1CDHA 2VSCA 2WXLA 3DXAD 2HG5A 4L3EA 5F44A 4DN4H 3ZOAA 3CN3A 3SZ6A 4IRJC 4BINA 4QRRE 3OXSB 1KJ2H 4QRQA 3GWJA 1KWKA 2UZYB 4TYUA 5AKTA 4OD2B 2FIRT 3MCG1 5HDBB 4ISVB 5H35B 4HUVB 1G0XA 2H8PA 2YARA 5ESAA 1X3DA 3SE4C 4XMPL 1IARB 1RUQH 2WNXA 3BH9B 4MXVE 5GHWH 1PJ9A 3UCQA 6FABH 3EYSH 1UFGA 3BRGC 2AVGA 3P4OA 1HXMA 2YGVA 2VABB 3OKOA 1P5VB 2FHFA 3MV01 4LOUC 4D8OA 2ZWNA 3KYOA 2EIEA 3CLFH 4K3JL 5F3HA 1IW7D 3WTUA 1TU2B 1JRHL 4XCYA 4IOIA 1DVFC 1WEJL 2WBWB 3QZWG 4K7PY 3D85B 1KBGL 4KTYA 2HJKB 3D2UA 1QLRB 3D0LB 2RQ8A 1COBA 3CVIH 5GISL 1AXTH 2D7QA 2NY3C 4HG4J 2MHAB 1ZHBA 5KG9B 3FL7A 3DVGB 5KVGL 4UILH 1BWWA 1WIOA 4ZUWA 1TVBA 1XGRA 3VD4A 1FO0A 1KGWA 3V0FA 5AKSA 1CU4L 2VQ1A 2WKOA 3F04A 4UIMA 4E9TA 4X99B 4WJ5A 3GBMH 3T1WA 1TCMA 4U7MA 3L2LA 2YA1A 4U7SA 3T6QC 3GHBL 1NIAA 3FQXA 2WLKA 1NQBA 4FMVA 5AQ0A 3RWIB 4ADIA 3IDMA 2PPEA 4XMUA 4MNQB 2WINA 2JJUA 4JZNB 4A39A 3CQQA 2V2WB 3EYQD 4GAFB 3L1FA 4NPYA 3FYIB 1KN2L 1BIIA 5DD6A 5C0BB 1S6NA 4PRNB 4WUUE 3H54A 5BRZE 2KZWA 4S10A 4DK3A 5E08L 2XBDA 3MV8D 2DKMA 3E2HB 5EZLA 2CG9X 3B2XA 3G5YA 4FABH 2IPTH 3P11L 3TF7C 1VGEH 3FUFA 1P7QA 3FT2A 1UVQA 3G5VA 4JFEA 1ZGLP 4WW1A 3I74A 3KPSB 4P9HC 3LYRA 5E70A 3VXUB 4RSVA 5F88B 1S9XB 3QIUC 4P46A 3PJSA 3U6XA 3AITA 2Y3NA 2DQCH 3FMGL 1Z9SB 4J6IA 2XJLA 4HJJH 1XF3A 3D05A 3DHMA 3WDIA 3I9PA 4JQVC 2Y1ZA 3ARDD 2F1AA 3LJ3A 1WP6A 2Y1AA 3PWVA 4QXTA 1WPCA 4WO4B 4XB8A 3RGVC 3SDXE 2MKLC 1R9FA 3FQWA 1U3ZA 1OO2A 2CO1A 3BUYB 2H1XA 4P2OB 4PR5B 4P4KB 4QRRD 3BKYH 2NVXA 1E7VA 2I9LA 4UT6H 4ES8A 1S8DA 1ZT4B 2Z91A 3IAQA 4PJEA 1NGWB 4UQIM 5HHNB 4F27A 5F7YC 2ZP8A 3C5ZD 4M93B 1YEJL 5GRWA 4OCXH 1AGCB 5BJTA 5MP6L 1LE5A 1EAJA 1LWHA 2WVVB 1EDHA 5HDRA 3L3JA 3QISA 1A1OA 3WFEH 1BZ8A 3DUHA 1SMAA 5FW6A 5B39B 1NCBH 3OMNB 2D0HA 1XQ4A 3QVAA 4TQIA 2R56H 3O3EB 1JCKA 4NN6C 4XPAL 4ZSOA 1KJMA 1X4YA 3KGRA 1S46A 1WBXA 2MNUA 4XR8C 2JKTM 5E0QA 4GFXA 4XH2A 4O58H 3S5LG 2E86A 1RZJC 2YC1B 4AJ0A 4DN3L 2AITA 2BS8A 1NC2B 3GSNH 4KHTL 4LLMA 2R2EB 1I8IA 2NVYA 5I0XA 4Z7OB 5EU7E 2JKNA 3ZTCC 3GS0A 4UM8A 3IM1A 1TO5A 3B43A 25C8H 1RD6A 1T6BX 4J27A 3TH2T 2X87A 3IDJB 5DHYB 5EU5B 3FT3A 1BFVL 3VGFA 3D06A 1J5CA 3WNLA 1QFWI 2P8PB 1KXVC 2I5YL 3NP3A 2OMTB 5LAXB 1R3KB 2EDYA 5KVEH 1GW6A 5F2FA 1XCQB 3G04A 3HS0C 4MS6A 1C08A 4TRPL 1LO2L 5TDNA 3RVWD 4Y2OB 3H9SB 5KUKA 4AIEA 4BH8A 5EIQA 3VFVB 2J1YA 4D3CH 2VRKA 3BAYA 1HSBB 4KK6C 4LSTH 4PCKA 3BAWA 3ZN6A 4GW4B 5I17B 4P48A 2WYHA 1A64A 3PHOB 3OG4B 3NYKA 3AGVA 3SBPA 1LWJA 2IBGA 1DUZA 1E9QB 1LEGB 3IJYA 3O0RL 2O5JD 3GZQA 3DDFA 1PNDA 4ZW5A 4NUGL 2YKKA 2XQ0A 2K4WA 4HEMA 1OP4A 4FNLL 2NXYC 5BMFH 5BRZD 5E8OB 4CC0A 4AONB 5HI4C 2W38A 2DWEB 1FLRL 2YRLA 1F02I 1CFBA 2G9HB 1SYVB 2BS9A 3IF1A 3CDCA 3EJUA 3MGAA 3W0WA 3L7EA 2VJ8A 3QDGE 3ARFD 3RY4A 1A5FH 4WI4A 5FHAH 5F9DC 3ZT5A 3BIAX 1BEYL 4NGHH 1JXJA 3QC8A 3EDFA 4LCWA 2XSKA 4XNZB 5E4EB 3I75B 1TSHA 5DF0A 5GRJL 1YECL 3Q2VA 1JPST 1OGTA 3PWPB 1F5WA 3DGGB 3PGCB 5DS1A 3VSVA 1FWXA 3P30H 1SDDB 2E4FA 2LLNA 1GZQA 5J0BA 3PUUA 1ONQB 1FFQA 1T0MB 3MMEA 1FYTB 4LSVH 2NXZC 2VSKB 4OH2A 1V7NL 3O41B 5KBKA 2ZAGA 5TE6L 3ATEA 2CLVB 2VUMA 3L81A 4K2UH 4K5LA 3RHWK 1BF8A 4YMPA 4YSCA 3ZYOA 2COQA 1U9KA 5HHQA 3OR7A 3OZ9L 3GSOA 1CDUA 1KJ2B 3FOLB 2XNAB 4BFOA 4MHHI 2FT6A 1X9QA 1AMYA 4IRJB 1A4CA 1G4MA 1A7RH 1XDTT 2F53B 2XPGA 2PXYA 3A47A 3KWTA 4AWJC 3FKIA 4Z95H 5KVFL 2VZ3A 2AJYL 5GJTL 4MSWB 3ARBD 3QFJB 2VDLB 2IQ9H 2OSLA 4V1DE 1OCCB 3VJ6B 1RP9A 3K6FA 4DP2X 4X6DA 2NAPA 5E6IC 3TASA 5LN4A 3DX9B 1NKOA 1HINL 1SJEB 5IVXF 1FZKB 4LRIA 3VI4B 3B5TA 1JCVA 2R15A 3CZUB 4HIIA 4ODVH 2B2XH 5DVKA 4PWJA 4LSUL 1G1KA 4YAQB 3DA0A 2GC7C 3L9RA 1SHMA 1FQ9C 4UIKH 2C7FA 2CGRH 1RUAH 1PPYA 1THCA 3RDTA 4FHBD 1A6ZB 3WMQA 2C9RA 5AVUB 4PRIB 1DVFB 4Q58C 3WAJA 2CUIA 5KBPA 3P3YA 1XR8B 3DHPA 3HNTL 5IHUL 5JW5B 5BZZA 2P48B 1JOIA 3Q6FB 3HN8A 2O26U 15C8L 5C7XH 2C1OA 3GEFA 4UV4H 1JWUA 4ZO8A 1CGVA 5C97A 2NY3B 5TE7L 2D7TH 2XACC 4Q74A 2IV9A 4ICXA 5GGVH 3L4YA 3GMLB 4YZFE 3RWGA 3MJ9A 4JL2A 1KEGH 3VXQB 3HG1A 4OZFA 5EF2A 4O02A 4XCCL 1YNKL 4P05A 3KXFB 1MZZA 4OGZA 3UZQA 3UX9B 1EEQA 4Q0XH 3TIWA 2FWOB 4Y8DC 4PJIF 4UBDC 5IVZB 3S35H 2E59A 4MLSA 1JYNA 3GFUA 3CHOA 1A6TB 4Q8BA 5IMLA 2HT3D 1FE8L 4FOMA 4KK5C 3VI3A 5ESVA 3ULVH 4RETB 4BGDA 3PWLB 1JUFA 3NH7L 4KY2A 3CVBA 2AQRA 1WUZA 2WCSA 4GQPH 4TTDD 1ICTA 3EF4A 3I50L 4JHWL 1L6XA 4H1LA 2A6IB 5CGTA 1BMWA 1PKQA 4PB9L 1YEFL 2JIXA 1UM5H 2CKNA 4YFLI 2BW5A 4X98B 2BNQB 3RG1C 1CFSB 3FB8B 1U3HD 5CWSA 5GS2D 5IB2A 4MB1A 4XP9H 1RZKH 4YC2C 5LG6A 3ULVF 1SF5A 3SY0B 5BVJA 2R8SH 3DUSB 4NENA 4ADGA 1QO3B 4FA8A 1KPUB 1G84A 5T5ID 4U3XA 1UXWA 3PLYA 1XMEB 2FQFA 4GEJA 1SIWA 4ZTEA 2JJWA 3W9DA 3LH2H 3QIUB 3FU7B 4FYRA 5F3BA 1K2DB 3JTTA 1FIGH 4HFUH 1M7XA 2WLHA 1FNSH 5AL8A 3IKCA 4Y19E 5CBEA 3PWUA 3ZE1B 1VADA 4WI5A 1QEWB 1IKOP 3SQOH 4L8DA 4PREA 3U46A 2EE2A 2AQ2A 4DPRA 3IJSA 1TTAA 3RGVB 3HFML 1CXHA 4A7SA 2ENGA 1UD4A 3QUMA 4GKNA 4KROC 5H8DA 4ZUSA 1NCOA 4JFDD 3FTYA 4RCAA 5T3XL 4E2OA 3ZR5A 4M4RA 1U8IB 4IBZA 4YHKH 1A7PL 3GINA 5BZXA 5ID0B 5KAQG 5L9DH 2WUBL 5IVOA 1EA9C 1OKEA 3MNWB 2X0WA 4CVXA 4V1DD 4KY1L 1IQWL 2CR0A 2EDNA 2E2IA 4BKLA 4X2UA 3TIDB 1JGEB 5LHDA 2XXCB 2HN7B 4WRLA 3IXAA 1L0YA 3QQXA 5FKAA 3BLPX 1A4JB 1MIMH 1TWAA 3EYVA 4Y1SA 5DD1H 4RFOH 5HJGA 4GO8A 3SD5A 4B6ZA 3VW3L 3REVB 2YUVA 3DNKA 2W0KA 3MTXA 4GMSH 4NN6B 1RLWA 5T5FH 5HGAB 2R0LL 4AT6A 1P9MA 3QEQA 4TKWA 5L2KA 3BVNA 1OCRB 3RFZA 4OB5L 3JWOH 4F37K 3NJGA 1SOKA 3KS0J 5CAYB 1TZGH 4EDWL 1FFOA 1QSED 4YXHL 4K07A 4UTBL 2GHWB 1T1WA 1NFDB 4CC1A 5MEQB 1VCAA 2ALWA 3O2DA 3HRZA 1KFAL 2JB5L 4JPSA 4AUJA 1CFTA 5E8PA 3GM8A 1NBYA 5B8CC 1V55B 3ZDYE 2VKXA 2W9EL 3HS0B 3DROB 2E27H 4OFDA 5KSVB 4YFEA 3SE3C 3PL6D 5KVDE 3TIEA 1BXAA 1E28A 4U1MA 1ILSA 1BFOA 3FFCB 3GMPA 4PV8A 4FXTA 1PZ3A 3KM1A 2JQMA 2EUXA 4H8WL 4ENZA 3RWFB 4L4VA 1LEIB 2DI8A 4QHMA 1LE9A 3K91A 3GMOB 3CSGA 3TA4D 1QKZH 2LR4A 1ETA1 3ML9A 3X2HA 3WEBA 2NXYB 4DKAA 5D9SA 1A0QH 3DURA 2FECI 3MRHA 4U6HB 2ZUTA 4JO4L 2AXFA 1I7UA 3TEYA 4XPBL 2F5AH 2R29L 2VOTA 3MUGA 1D5MA 3FW6A 1QBAA 3IPBA 2J43A 3KPRB 5LNDA 4GKOA 4DP6X 3KWUA 1W8OA 2GFBB 3FUDA 2BWDA 4HJUA 4W6YB 3CZFB 1YEWA 3DOIA 4NQDE 4XNDA 2VDOB 1Q90A 4N9GA 1QRNB 3IJHB 4DQOH 4RIRA 3BWUF 2ZG3A 3SE8H 3P3SA 3I2CH 3V8OA 2AAVA 3QEGH 3WFCL 3SQBA 3LVTA 1N18A 5C2BH 4ACTA 3QIWA 2NY1C 3OAZH 2NXZB 2JCCB 2BSTA 4OGQC 5DHVH 5F96L 2PABA 3MPCA 2FSDA 5FPIA 3VXMB 1HNGA 1TJIH 2RCSH 2DMHA 3I6GB 1F00I 1XF1A 1YAZA 4RAVA 4X5XA 1PYWB 4HX1B 1XZWA 5LBSH 2ZUXA 3QUGA 3IMVA 4ESKA 1U8QB 2FUQA 1GJWA 5JW3L 2PCFB 3TZVC 2Z34A 2GJRA 2FK9A 3BN9D 3GJEB 4LCUB 3V5DA 1BAWA 4IRSD 5KVMC 4LSPL 4YFLF 1K72A 2OTUA 3VAEA 2EC9T 2PF6A 1FZOB 1OF0A 3L6FB 3QRBA 5EU6D 5E6IB 1X5LA 1N7ML 1G9NL 1KYAA 3M8OL 4CN6A 1QSFA 1P4BL 2C3WA 1TZIA 2HFGH 3VGAC 4J3SA 1TO4A 5JOFA 1J88A 1MH5B 3KHQA 3NFPB 5F21B 5LNGA 2XPYA 2X41A 1DEDA 3CSYB 3ZW3A 5EO0A 1RZ8A 3QW9A 3Q1EA 1EMTL 4L9DA 1KIQB 3ULUH 4PV9A 3T9WA 4L4TE 2YEZA 3EOBA 1NEZA 2B5IC 5B4MC 2CJUL 2HCZX 2P24B 4N5ED 1D6EA 1EXHA 1FNEA 4IEFA 5FYKL 1LNUB 4M3KB 4X4XB 4XNUL 3Q9PA 3V52L 1CGSH 3PIQA 4XMVA 3ULUF 2BC4A 4D9QE 4B5EA 3RUGE 1DHKA 1HQ4A 4J3XA 4PJ5D 4R7DB 1YPZF 2GJ6D 4PWEA 4LL1A 4DAGL 4UQBA 4GAAA 3C2AH 4B9GA 1Z9PA 2EUWA 5C07A 2A68D 3HU3A 5C9KA 3H4HA 3D07A 3OKEB 1KULA 2CJTA 1U6AL 1GYWA 2A9NH 1EFXB 4I3SH 4HS6B 4YGVA 1MFEH 4ZMYA 5I1EL 4R9HA 1BSIA 4P9ML 3MLYL 3MRMA 2ZAIA 4X0NA 4NJ9L 4APQC 1IGYB 3LQMA 4Q9RH 3GPEA 1RZGA 4OLWL 5DRNB 1BQHB 4B3VA 4HPYL 3BJLA 5C86A 2VDKH 3DMMA 1C1EH 4JQXA 3VM5A 4NCC1 5J1AB 2ESVB 1SF3A 2ZYIA 3S3JA 2QEJA 3T2QA 4NRZA 5FTKA 4HAGA 3SJVB 3ZQWA 2WBKA 1FBIL 2VC2B 2X6CA 3HBGA 2CO6B 5EU3A 3QI9A 3T5WA 2FCBA 2HTLD 3VFUA 4YC2B 5I76A 5FM5M 1UOKA 2NPLX 3CZEA 4KDLA 1SDAB 2WLJA 3MRGB 4F7EB 1J5IA 3G9AB 3IK2A 1I9IL 1B4JH 1OQOA 3RWHA 3CHSA 5IQ9A 1UA3A 5ABAA 4QPEA 2Q2LA 2J1WA 4QO1B 5C09D 1EK3A 4HK0A 3TWCL 4BUQA 2APSA 1N67A 3NA9L 3HB3C 3ZUNC 3VXSD 1BZ9B 3AT0A 1WD8A 1A9BA 1QI4A 2DMKA 4I9WE 4N6QA 2CBQA 2XN0A 4KROB 3MXVL 4KJWD 3VTAA 4APXA 1B9ZA 4L4JA 3MLTA 3RY6C 3K72B 5GS3A 5EBLA 1D6VL 3PYCA 5T3XD 2CO7A 2AI0L 2GK0A 4XAWH 4RVBA 1A1MB 1VZHA 5FB8B 1F3JA 1E9PB 2VSDA 2MTAA 2Q76A 4K7FA 4CRZA 3X2LA 1KCVL 3WKML 1OAYH 1A3RL 3VRJA 1NGPL 1ANUA 2Z7ZA 4LF3B 4XVJH 3Q2WA 4XVTL 3GSVA 3OKKB 4Y2DC 4XCNB 3EJZD 1P6FA 2FZ3B 2G3NA 2R0ZH 2YK1H 5GZOC 5GQBA 3SQRA 1LD9B 5IHZB 1GSMA 3FH7A 4BJLA 2HMIC 1A3ZA 2HX9A 3BEVA 3IXTA 5H37G 1TETH 3NIDE 3F85A 4KV5E 1DCLA 3QRGL 2VMFA 4NKIL 1CWVA 4ZFFB 1ERNA 2OMBA 4FTVD 4H2CA 4N2LA 5FWQA 3ZDZE 1HQRB 3X3GH 3ZZLA 4BXVA 3FSAA 4M7LL 1I3RA 1ZHNA 2YIHA 4N2HA 4XRCA 3FTXA 4MQTB 2IANB 4DKFH 1TEGA 1VFBB 3IKKA 4GRMB 1DANT 4J7RA 4F92B 3JWNC 4R4FL 5D7SH 4DP8X 1ZLDA 5B8CB 4IBYA 4I3RL 2JIOA 3VD9A 4G7VL 3VI3E 5KJ7E 2OMYB 3IFLL 4WAFA 1VIWA 1IM9D 4O4YH 2XQYK 5EUOB 5C6TL 5DURB 2OX5A 4F9LA 1NTDA 3KVDD 5HYJA 1TYRA 4JEGB 5KJ4A 2PYEB 5DK0B 2FYVA 2EUVA 5I16B 2GTZB 3FONA 5C08E 2O6EA 3MJWA 3F01A 1CQKA 2UZIH 1XIWA 1H3PL 1A14H 5GGTA 3WEXB 2CO3A 2DTMH 3DETC 1J1OL 5ADPH 1OTSC 1INDL 4Y5XA 1Y7VA 2WV3A 3GYRA 3QP3A 2ITCB 4KUCF 2CGZA 2HT4D 4YSDA 4PTTA 1R3JB 4J3OD 2R0WL 1I9JL 5GS1A 3RI5K 4Z23A 1FNHA 5GLFA 2H47C 3G6JF 1U8HB 3D34A 4M8RA 1LP9E 2Z93B 3LPGA 5D7JA 5JORB 1QLEB 3MRDB 3UCRA 2XTJC 1ETZA 3OLGA 4N0UE 1L7TH 3TCTA 3DI3B 4JJOA 3QZWB 3VB9A 6CGTA 1PLAA 4FYTA 1YCSA 2BIMA 2NW2B 4LCCA 1IM3B 4MTMA 2EXSA 2AV1A 5BRQA 2E7CA 4KKPA 5D7HA 3PHAA 2OI9C 1NKRA 3GTNA 4A63A 2DTSA 3RGHA 1E4XH 1QG3A 1JWMB 3ZY7A 1E5ZA 4YVUA 3AUVA 1R5IA 2NY1B 3S6CA 3OR6B 3T3PE 4POZD 4PWKA 1IGFL 4K3EL 2ITEA 4I2XE 3RQ3A 2K0RA 1AE6L 1ET7A 4MBRA 4PJAA 4KQ0A 5I6OA 1KYOJ 2NZIA 4A6YB 3AG4B 5SWSB 4R3SA 2ICWA 3OMZA 3UDWA 5AOJA 3HE7D 4NDMA 5L0QC 2YXMA 3RVUD 3UTSB 2F8XC 5CEZD 2FYYA 3O45A 3B2MA 4P3CL 2JKJA 2MQ3A 1BG1A 4M6OL 3NJJA 2GY7B 3TZVB 2ATKB 4LASH 4P2QA 4QRBA 2Y06L 2JELH 4KVNL 1J7VR 5E1AA 1OE3A 4HKBB 1AIFA 4XWOD 1UG9A 1BVZA 2ZQKA 3VVVA 3LN5B 3N3EA 1UTDA 1AZBA 3MROB 1WE5A 2BP0A 1YVLA 1ZXKA 4KDTC 3WHE0 2FJFA 2Y1VA 5BZWA 3VGAB 3AJ7A 4M8QA 2DYRB 5FA4A 1XV8A 3Q6GL 5INCB 5G5DB 3FCGA 4EI5C 2FR4B 1OTTD 1I8LA 1KY7A 3C8KA 2JK5A 2AEQH 4IKLA 5I8KL 2Z64C 1UXMA 4KMTL 5J11C 5J1SC 4IBTA 1FNLA 4JPWL 4TVPL 2B5IB 3KPOA 2QPDB 2LQRA 2KL6A 1JV2A 2EDHA 3OPZH 1LO3H 4BM7A 1DQQA 2W9DH 5A2JH 4CNIB 3EFOB 1DFXA 2CALA 5F7EL 1WG3A 4MMXA 3WS6A 3DJ9A 1EEUA 2A0LC 4RZCA 2VERN 3KLAB 1AR2A 5EPMA 1ZLWK 5ENWA 1MF2L 5LGYA 3TEUA 5KZCD 3QJHA 1PZUB 5HPMA 3MCKB 3PXJA 3PNWB 3MZGB 4HH9A 2NDFA 3O3BA 4ELMA 1B2YA 4AEFA 3LKOA 3ZE2E 2W95A 2X9WA 4JKPH 1U8LB 2NLJB 2Y7OA 2ZE0A 3O2VH 2R0KH 2X4TA 3QDMB 4XCFL 4APQB 2C26A 4JFHE 3IDIA 3T2NL 3VNYA 5DD5H 3UFIA 2V8LA 4LP8A 4CW1B 4Z78B 4UOW0 2Q9OA 3HUJB 3RHWF 1L5GB 2VIRB 4A2DA 1AHWC 4M1DL 3NSDA 5JHLL 1BVNT 4G6KH 5LLIC 4E0RA 1UZ8B 2PO6C 5KUMA 1Q38A 3MV7E 4P59H 4KXDA 1K4DB 4RWHA 2DQIH 2H2PC 2C9XA 4LT7A 3FRUA 2PPFA 5AOIA 2PNWA 3L3DA 1J5DA 1MKFA 4PYHA 3V55A 1SXBA 4O2EA 2WD0A 3LKQA 4LMQE 4CVZB 4ZPTB 4N0YL 1N2RB 3HC0A 5B3JE 3MV8A 5FR3A 1IT9L 1I7RA 2WBXA 1Z0MA 3GSRB 3K80A 4HMDA 4U1HB 1KSRA 1O7VA 2OK0L 3D5OF 5TE4H 3D85D 4BV1A 2OCJA 2WXFA 1DE4B 1FV1A 3L3OA 3HR5B 4WUKH 4AGMA 1ZHLA 2Y07H 2ZX7A 5IW6A 3HB3B 1HYRC 1R3LB 2XKSA 3REWA 3O6ML 4MQ7B 4P5SA 4TUOA 3BZFA 1GKEA 3KCWA 2F58L 4PG9B 3F84A 2QVTA 3EJPA 1Y4ZA 1J5OH 1RK1B 3TEXA 4BWUA 2ITDA 7PAZA 3MRLB 2CDFB 2MNWA 4PJDE 3FTGA 4XB3A 5CGYC 1GYVA 3ARDA 5K9KA 3RBGA 3DK0A 1YHPA 4MNGA 3KYNA 2F9BT 4UOJA 2P5EE 4QRRA 2CR3A 3BIKA 3V4PB 2Y5QA 4F7CB 4OD1L 4GW1B 1Y5IA 2YPKB 5I5JA 4AYEC 2AQ3A 2ZPKH 3V0HA 1OAQH 4DZ8B 2GC4C 2J8OA 1XH3B 3C5ZA 2E9IA 5DT1H 4MNQD 4BCXA 1D5IL 3T08A 4UNVA 1LQBC 4OZIE 5DS2A 4OJYA 4Y2DB 5IROC 1PG7W 4FI8A 5C0BD 1LO5A 3LRMA 5JLZA 4XX1G 1CLOL 3TS8A 1XF2B 3O3AB 5EV7A 4LL9A 2AV7A 4WW2A 3CN2A 1XZ0A 4Z7NB 4HCRA 2VDRH 3NN8A 3KYMB 3QJFB 4FQ1L 5IB1A 1U92A 4NNPH 4ZS6D 3NSCA 2GTWB 4P9HL 2FJSA 1U3YA 2Z7YA 3ZIYA 3DOHA 4YE0A 3VGBA 3KPSD 3MYZA 5TTRA 5TDOA 4LSQL 5EA0H 3SKOA 1XR9A 4OCSL 3VXUD 4XOAA 1OK0A 4HBCL 4WDIA 4WFED 5FOBA 4ZMZA 1JVLA 2UX7A 2IPKB 1LMKA 2WTPA 5FTNA 2X05A 4TM9A 3TOPA 3UJJH 5CD5D 2H7WA 2AMGA 1IJ9A 4QMEA 3RU8H 2X44D 4BE5A 1UYWH 2V5RA 1E6OL 2VR5A 3MJ8B 2BHYA 4DNLA 4M62L 3AS3A 4LVEA 4MCNA 2P8LA 3OJDA 4P2OD 4R2GC 4P4KD 3VUAA 1VFMA 2O5ZH 2A77L 2OA9A 2V33A 3DV4B 3PU7A 5DUJA 1VAHA 4MCYB 3VG9C 2Z35B 2B15A 4AQAA 2YD4A 3U48A 1AACA 3KLDA 3ILQD 2W94A 1KT2A 3ULSA 1MCWW 5KS9E 3C87A 1JNNL 1A7QL 2YZ1A 4LQFH 1RPQA 3DLQR 1UXSA 2IBBA 2XIDA 1JZ4A 4X6CB 2H6PA 3NFSL 3GTQA 5GIRA 3JTSA 3NTCL 4FGMA 1DQTA 4ZDHB 5ESQA 1E90A 1IGCH 2VWEE 4LLWB 2B63A 1PG7H 3MU3A 3WKQA 2DF3A 1RZJL 1CZ8L 3CLWA 1FFNA 3TBTA 4E41A 2GUOB 3S5ZA 5KN5A 4HJSA 2XTJB 3ZZ1A 1NC2D 1JZJA 1JHKH 2NR6D 2H32B 5D2NC 3P73B 4TNWK 4U3SA 2Q86B 4IOSD 1CXEA 3QQ3A 4JO5A 3V9CA 3ARFA 1JN6A 2KKQA 1NMCC 3J27A 1KCUH 5A1AA 1GZPA 2OI9B 1RJYB 5BV7H 1I8UA 1WZ1L 2ZX8A 3NJLA 4G7RB 5D1ZI 3EO1B 2VAAB 2DM4A 4EZMA 5AAWC 5F71A 5D70L 1JPGA 1L9PA 1B9KA 3ZK0A 2WY3B 3A21A 3H3BC 1HH9B 1EJ6A 3BXNA 3AY4C 5F3FA 1MJ8H 2Z7WA 4FEMA 3H9SD 3VO0A 1RSFA 4N5UA 4A7GF 4F37F 4FN0A 4FEIA 5L0QB 3D0VA 3BDYH 4JFZL 1S5HB 4G7YL 4AOFA 1ZSDA 2GI7A 3T2LA 1H6UA 4KKLC 4WK4B 1CE1H 1ZEAH 4NRYA 3EH3B 2X70A 3X1BA 5DMYA 4IU2B 4LARH 3S4SB 1XCXA 3P4MA 4Z7AA 2XI9A 3MXWL 4GUPA 3MACH 1YYMH 2VLRB 3ME0B 1IBYA 3ISWA 3LNDA 3N1MC 1NANI 2W65A 4YIQB 2AXJA 3ARBA 3BAJA 4JDVA 2D31A 1YY9D 4KZ0A 4CILA 1LE9B 1JDDA 4Y88A 4YEEA 3QPKA 4EI5B 1HN1A 4WEEA 3X1EA 5C0CB 3PFUA 4OCYH 2XIBA 3PWPD 3V6FA 4OZFG 4NAQA 2IMMA 5J11B 3GO1L 4OZGF 4JRYE 2DM2A 2X0UA 4UT9H 5LAPA 4TVPD 3GJFB 4NM4H 4JM2C 1FYTD 3KNBB 2Z8SA 2WOBA 4FYSA 5DDHB 2YXWA 4QRTB 1BZEA 4MCMA 2ICCA 5IR1A 1HI6B 2WUCH 3U9UB 3E6HB 3ML8A 2JA5A 1ZS8A 2DLFH 1TJGH 2YFNA 2FJHA 5DGRA 1DQDH 1CD1B 4WSGA 4F8PA 5F7AA 1YO4A 7TAAA 1TTCA 3ZE0E 4I5BB 3OB0H 4GT7A 1KGCD 1FDLL 1P2CB 3QHFH 1U0QA 4IRJD 5ITFB 5AZEL 3FF7A 1PY9A 2F53D 1U8NB 1KY6A 3CHXA 1GAFL 4PJ9C 3QFJD 1AOZA 3L5WA 5BW7C 1FUNA 1P1ZA 2ADFH 1OV8A 1I1FA 4MXWH 1BMGA 2CBPA 2EYTA 2DLGA 1FVCB 1UA6H 3ZRFC 2VISA 2CK2A 5H37H 4FNSA 1MELA 4N1EA 1CF8H 3OB8A 4KPHH 1AHWB 1R9TA 1F11B 5JMRA 2PO6B 2E4TA 2EXTA 1KPRB 3KYKL 2DWSA 4FF9A 3IRCA 3GSQA 4LOUD 4PRHA 4OLXH 5DJ0B 2X4RB 4KRLB 2CK0H 1U3HA 4LLYB 4EI6B 2LHAA 1G7PB 5D6CA 4PRID 1DVFD 4YL4A 3L3HB 3CIAA 4JGJA 5B7MA 3FAWA 1Y0LA 3PFQA 5EFIA 1CG9A 5ISZE 1C5CH 4QHLA 5KVEE 3T0BA 1ZHKA 2NY3D 1MCDA 4AV4A 1QLFB 1YMHA 3GXDA 3MOAH 3HAEB 2FSEB 5KW9L 5IK3A 1DJIA 1IAOA 2XZAH 3F2LA 4AIOA 4PJHB 1ZPUA 3DUUA 3KXFD 3VFOA 2WO4A 1MNNA 1WF5A 5DC9B 4W1TA 3T1FA 1KNOA 1T22A 3GXUB 2XVLA 4MJ2A 1A25A 4JFDA 5T1LB 2EVJA 5MEOA 1MCIA 1D5BB 4GKSA 5CN3A 3AROA 3P2TA 1JGLH 1YDPB 3ARPA 4Y5YC 4XX5A 3JUZA 3DMRA 2UUDK 3WY4A 1I1RA 4L5FH 5E99H 3CDGB 4GP5B 4X6BB 2VC2L 1XTLA 3AU1B 4PJFE 4NQEE 2BNQD 5KSBB 1QR1A 1Z5LA 4N2KA 2IC2A 2H45A 2IH1A 1SN5A 1IAII 1MFDH 3R0NA 3O3DA 4XODA 4HUCA 1NCIA 1L7IH 3JQOB 1DQJB 4FNUA 4JPIA 1CIDA 4XHJC 1DL7H 2RA1A 1UADC 4MJHA 5D5MB 5C0IB 4YFDB 4R90H 1AG6A 3ZGIA 3UBXA 4M1GH 2OMVB 2J25A 1YEKL 1S5IL 1GOGA 1YJDC 1NBZA 1QSEA 4M1CC 1AO7E 3KWWA 4L05A 4CMHC 2GK2A 3GKZA 2VDNB 4I0CC 1E67A 5HHOE 2GCYA 2ZSWA 1T7ZA 1KCRH 5HHPA 3UTQB 3RGVD 4EXKA 1ZRUA 3VDAA 3U7WL 1TZHB 3QXTA 5FGCE 2L0DA 3TBCA 4BFBD 1YC7A 4R2GB 2O5YH 4WHCA 3VG9B 1SEQH 3AREC 4YUEL 3ZYIA 3PL6A 1ECYA 1G7HB 1OSEA 5AOLA 5KANI 3AT8A 5I5IA 3MRRA 5IVXE 1OLZA 3LHPL 4C58B 1CBVH 2LTQC 1YNLH 3GGWB 2AEIT 2J6EL 2VDMB 5BXFA 2QELA 4O2FB 2QADC 4J3BA 1F4XH 4OV5B 1RHFA 3BPCA