4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
4ZM7A 3SUMA 1WC2A 4FFTA 2G5DA 4JCWA 1L8FA 3SULA 3D30A 3X2IA 5GLXA 3X2MA 4FERA 3X2HA 1BW3A 2AE0X 1WHOA 1BMWA 3X2LA 2ENGA 3X2KA 3X2JA 2GAEA 5H4UA 4FG2A 3X2GA 1BW4A 2HCZX 1OA9A 5GLYA 1OA7A 5GM9A 3SUKA 3X2PA 4JS7A 3FT9A 3X2NA 1N10A 1HD5A 4JP7A 3CZBA 2KQAA 3ENGA 3SUJA 4L48A 2PJJA 4JJOA 4AVRA 2PICA 3M3GA 2PNWA 1WHPA 2VXQA 2JNZA 3X2OA 3FT1A 2BH0A 4JP6A 2G6GA 4FG4A 2PI8A 4ENGA
chains in the Genus database with same CATH superfamily
1DVSA 3WHXA 3WO4B 1PFCA 4EF3A 2ATKA 3LS5L 4EOWL 2YAHA 2E8YA 4U1MA 1UJ3B 1U4FA 5A16A 4BJLA 1A6VL 3FHAA 3RIAF 3MLUL 5BRZA 5I18L 2BVTA 1PZSA 2F5BL 4X9GA 1FAKT 3NBNA 5D72H 4Z7UB 1JWSA 4WWKC 2Y2WA 2VDPL 3IJHB 1D2OA 1Q0YH 2UVFA 1S46A 4A6YA 4QHKI 5EEYA 2FHBA 1JGEA 4DP6X 2OMXB 5GRXG 4CMMA 1FVDB 2PABA 1FIGH 4PRDB 4LCWA 4QO1B 1IZKA 3QPXL 4MA3A 4OFYA 5FV1L 1P6WA 2ZPKL 4YDLB 1LDPH 1ZLSH 4PJ8D 3UZVA 3TEZA 4AYBA 1F58L 4WW2F 2GBVA 1DUYB 4TN9A 2R0LL 2Y5EA 2MFNA 2E8ZA 1UKQA 3BUQA 3H54A 1CLOH 3GS7A 4P9HC 3U0PB 1AGBA 1N8OE 1N5YL 3NEXA 3OXSB 2WINA 5I1GL 3FB7B 3GIVB 2LU7A 4Y9BA 1FP5A 1MLCA 1A4CA 3TV3L 2C45A 4E42A 4PGZA 1U3ZA 1ZGLA 4EZMA 1MVUA 5BZZA 4M7JH 1CWVA 4KDLA 4UOZA 1KIRB 4JUSA 3O9WD 3BIKB 3KJ6H 5DZAA 1V7NL 4K7PH 1JPSH 3UABA 4CADA 1JHTA 1MSPA 2DBLH 2UXFA 3O3AB 5HHMB 3LS4L 3FB6A 4NQDD 1BQSA 4JFEA 1XCQB 5CSBA 5HHQA 3WFCH 4HWBA 1XIWB 4PCKA 3VDAA 1BA9A 3BP5B 5DC9B 2EDHA 3U4EA 1QKZL 2Q7AA 4MZRA 2X70A 3K2KA 1WC7B 4M7ZC 4L9LB 5L9DL 1JXJA 2NQCA 4WNSA 3BXNB 3UTPD 1P7QD 4PJXB 4LSVH 4NAQA 1JF1A 4RGMB 1NC4D 2WZ5A 4Y4KC 1X3DA 2VLRE 3ARUA 5E0QA 4KJYA 4JCLA 4QYOA 3DX8B 2PLTA 5BVPL 4HKJA 4PJGB 2QFPA 5C0EB 3CLFL 4I2XA 1G7PB 3VGEA 3QWRA 2H3NA 2XQBL 3QWZA 4J2QA 1JZ4A 1QBML 4GI9A 3AJ7A 3ZTNH 2WWMC 5IIEB 2IDSA 4X6CF 2Y06H 5K39B 5ABDE 1AXSA 5FGRA 5D1ZC 3T3MB 4N2NA 1F13A 2V5MA 3MZTA 4NQVA 4HIPA 4M6ML 1E4XH 4ZMPA 4AQOA 5D70L 5C0AA 5DUPL 3D12B 1DJSA 1L0XA 4TLSA 4WFGE 5LCVL 2FNBA 1KPVA 3BKJL 5FCUH 1E18A 2K6ZA 1N68A 1LDSA 1DSWA 3KH4A 1EEQA 4AM0A 5FOBA 1H3PL 4HK3J 3S8FB 2E7LA 3IETA 3CLEL 3LYRA 4J3OH 4LKXB 1K4CA 2GSIA 2IWFA 5HDRA 5KANG 4TQHA 1JNLL 2HT3C 2B9AA 3IBOA 1CLYH 1WLHA 2CA3A 3MU3A 5EIQA 5EZPA 5FIEA 2Q3ZA 4LPTA 4R5TA 3GTMA 3K72B 1BVLA 1G7MA 3JVFC 5AZEH 3GSXB 3RWIA 4L9DA 4PJCF 1UT2A 4PAZA 2FWOB 4XX1E 3NSXA 3QUZC 5HGHB 3BRFA 2IOMA 4Q9CA 5E2UL 1INEH 3QZOA 4XNMA 1NMCC 2WZ0A 3DUUB 3LZQA 2HJFA 4LHUB 3CZLA 1EH9A 4RFEA 3VFWB 3NSDA 4X42A 2MCMA 4CN6A 4OLVH 3QQ4B 4FZEL 3FOLB 4FFWD 3NIDF 2XWRA 3FU8A 3EJPA 4LCIL 2WSKA 4TSBL 2ZOLB 3HE7A 5EIIB 3T0AA 3KZ8A 4HLJA 1I7RB 3X1NA 1WUZA 3PHOB 1SJVA 3L1EA 4RMWA 2PCYA 3HZMA 1OHZA 4QR7A 5CMAB 4LEEA 3VCLA 2NY2D 3H53A 3LN4A 2GC4C 4WFGD 1QW9A 2JKWA 3OC5A 4LMQE 2VXSL 4FNQA 3FO2A 4UINL 1RZKH 3QSKB 2BOBB 2XZCL 3TBWA 5F9AC 1G7LA 2EIDA 4UB0H 2GY7B 3VD2A 4XVJL 1P9MA 3L95B 2FBJL 3OLGA 3X2NA 3QNYA 4UT6H 1ZKAA 1A6UH 3LXBA 1LVEA 2Y1AA 3ZDZF 3RVWD 2BSRA 2NNRA 4KDTA 4AMKH 5KJRH 1M1SA 5CSGA 3CZFB 3GGWB 3QQ9C 3X2QB 4BE6A 3D39B 1EERB 3CSTA 4ZD3L 2RD0A 1SOSA 1QSFB 3EG9A 1A2YA 4XO4A 2C9QA 5KAQG 3SDYH 4N87A 4FQ1L 3N85H 3D9AL 4IJ3C 1GOFA 3K74B 3WNLA 1QMUA 3CFJB 5LGHH 5MHSE 3FRPG 4OCWH 4QRUB 5E5LA 5IP4A 2DQTH 3ECVA 4N5UA 3EYUH 5F88B 4RFNB 2Y24A 2O30A 4BELD 1MG2C 3B7SA 4Z3JA 1DLFL 3IDJA 3WKNA 1FLRL 2XIIA 1JGUL 5F0PB 2EADA 3GRWH 3BAKA 5CCJA 1PLBA 1RFDL 2VAJA 5CLYA 1BLNB 5I1KH 5KVEH 3UTSE 1OAUH 2QQNL 4QLWA 4AYSA 3JT2A 4MSWA 1QUNA 4KROB 3ARBD 2OV0A 1GY1A 2RH0A 1SPDA 1E5AA 3TEYA 1PZUB 3ZKXC 1WC2A 3DX7A 3JYCA 2V4LA 4UQ2B 1V3MA 3WIIH 1KQFA 5T1LD 1S7XB 1EHLH 4KUCF 1V7MH 1GJUA 4GUCA 3T0DA 5DYIA 5G2NA 4JO8A 1T1WB 4OGXL 2QVFB 4TF4A 2BVOA 3MV9E 2ZKWA 5IVOA 4KRPB 4KITB 4I9XA 2QPEB 1AACA 3FQNB 1KY7A 3SUJA 4CAGA 1IGMH 4KO8A 2WXJA 1EV2E 5EF2A 1G4MA 2VDNH 3KE0A 3ZTCC 1BX2A 1RUKL 1BAFH 1RXLA 3LV3B 3QUMH 2K8QA 3FYIB 2AITA 1NOAA 4U6VL 4AQ8A 5KS9B 3TVMD 5EFIB 5GRUL 2NUTB 4Q89A 4FFYA 3OV6A 1ZJAA 4PJEE 4G1EA 4QTFA 1GHFL 5MHSD 4OZIE 2Y1YA 3VXTB 4C8XA 2IV9A 4WJ5B 3QS2A 2E2IA 2VNCA 3F5WA 1A1OA 3PLYA 1AANA 3SKMB 2CG9X 2DIJA 1MLBA 4JFPA 1K3IA 2VKXA 1EAQA 2NTFB 3Q6FA 5IHBA 1E60A 1O6VA 4QOKA 1SF3A 4F7PA 3EYFB 2JB5H 3OLIA 4BZ1H 3BDYL 3TA3C 1YNND 3I84A 1E8WA 4FHKA 1S9VB 3RWEA 2K7QA 3LZLA 3BEWA 3QUYC 2ED8A 5GIRB 4O58H 1MEXL 1VPOL 1S9YB 1GGBH 2J71A 3P77A 2R4SL 1PCSA 3O9WB 4PPTA 4BA0A 4EDXB 3NTCL 43CAB 2M83A 1KYUA 1FYTB 4TUUA 2FBRA 1ZHBA 3H9YA 5SX4H 4OH2A 3NABH 2VXTL 3MV9D 1RUPH 1DO5A 5J4MA 4G8GB 4UT7L 1E8ZA 3MOBL 4NN5C 2VISA 5GZOA 2RFXB 4M7ZB 2ZOKA 3HFML 5JHLA 2E27H 1UYWH 1AFVH 2DYPB 2HKHH 1IM3A 3UAJD 5GXBB 4QRRA 1DMRA 3T0WA 2ZCLH 1UFGA 3ECBB 3W1ZA 4AE0A 3GNMH 1SFOA 3W56A 3STBA 4ZZKA 4NQEA 1HH9B 1F4XH 3OJVC 4Y4FA 2UY7B 4OI7A 4F8NA 5EBMA 1Y6NR 3PNWA 2G9HB 4ONOA 4OF3A 1KLUB 5D7IB 5CINL 4YC2C 1P7HL 1HJCA 1U8QB 4KXZI 5HVHC 1S9WA 1SQMA 2G0LA 4YHIB 3RUGE 2VXVL 4WFHD 4XZUA 1KPUB 5IEKA 1RZIA 1FVCB 5JDSB 3ZQ9A 3MLYL 5D1ZB 1QLEB 4FEIA 4HUCA 4JPWL 2Y4SA 3MUGA 3QDMB 5A2AA 1VENA 3MKGA 3U6RB 4NO2B 3DJRA 4G11A 5GRZA 2RB8A 2E7DA 5I1DB 3LRSB 2AP2A 1DSFL 1ID2A 5E6ID 1BM3H 2BNQE 2OP4L 3WI9A 4K07A 3VXUE 2P24B 2DWSA 3N1FC 4MXWL 5BV7C 4XB7A 2LGNA 2X28A 5TDOB 3JVGC 3CXFA 1D7FA 1FSKC 2FIRT 5CBEA 4TNGA 4AV5A 4CS0A 3PV6B 4FXKC 4S1SL 4TUKL 3L3HB 3DJ9A 2CRYA 2A2QT 4FE9A 3UFIA 4GBXD 3DX9B 2CLRA 1T4KB 1FE8L 3OKMB 3QUZB 3K2MC 5JLZB 1MFNA 2X1QA 4UIKL 5DLML 3AACA 1TNMA 4AVHA 4KXZH 5F7UA 2IMMA 2MQ3A 3SPJA 4LT7A 2BLFA 2OMZB 1BVKB 4MRBA 2F8OA 3KYAA 4IBVA 1EFXB 4FFZH 2D03L 4UQBA 3D4ZA 4OQTH 3SPCA 3IR5A 3WKML 3WEAA 4JZOB 4PG9B 2VDOB 2WP3T 1TIUA 2C9AA 1GAFH 5LXGH 3ZW3A 5KJ7E 5FXCH 2FR4A 1FGNL 3F62A 5E8NB 5D1QA 3EHBD 1NFIB 1A7OL 2A6DB 1CR9H 5F7EH 4W68A 3CZGA 4E9YA 3GI9H 4XP9L 2C7FA 5SWSE 4HHAB 1CI5A 3QR0A 1MJJA 3BSZA 5TTRA 3RGBA 2D73A 4PU2A 1U8HB 4AG4L 3BN9D 3EH5B 3V4PA 4HHGA 3N50A 4BSWB 3P9MB 4MXVE 5C09B 2F74B 4BFRA 1ID5I 5DVLA 3O6LH 1H8OA 2BNQD 3K81A 3VXUD 2XV2A 1CDBA 5EDXA 2DKMA 2AMUA 4U1SA 1CBJA 2IOOA 4R4BB 3MREA 1NFDB 2A3TA 5MERB 2H0FA 4BFJA 2ZNXA 4XHJC 4NC1C 2IQAB 4X0NA 4IJ3B 1TZHA 1FVEA 1QSVA 5F6HJ 4QTIH 5I16B 4M1CD 3RJOA 2PTTA 1T20B 4QWWD 4YZFE 5CJ8A 4CVUA 1Z5HA 5FTKA 7TAAA 2VR3A 1E9PA 1I9RL 5C8JA 2GKIA 1C8QA 1A3ZA 3AS1A 4WUUA 1X9LA 1ZT7B 2BSTA 2W0KA 1TQCC 2PKDA 2VC2B 3WEBA 4HLZH 1HD5A 4BUGA 1C5BH 4GO8A 1KJ2L 3OKDB 4DTGL 5DMKA 5FK9B 4I7ZC 4GG6E 4PWJA 3Q05A 3IGFA 2X6CA 5MEPB 3HPLA 1L9MA 1M6UA 1WFMA 3IJYA 2JFCA 5DD0L 1V10A 3JZ7A 1ETA1 3QHFL 4GG8A 4Z77B 3BH8B 5C9JB 3VXRA 1SBSH 15C8H 4NHUA 2VE6A 3MLXH 1UWEL 2BP8B 2CWRA 5SWSD 3T2LA 3F84A 1VERA 3R06B 3S9DB 4N22A 5FAAA 1KIUA 3UIZA 2HKFH 1HINL 5DHVB 3AS2A 1MCCA 4JFWA 4O2EB 2F54A 5FHBH 5LNDA 4H8HA 2P3YA 2W59A 4ANVA 5FLVA 1X5XA 4OD3L 3EDKA 3RFZA 3ZRSA 1KYOJ 2MNWA 5ANMB 4ZUSB 1UEMA 5C92A 5JYMA 1PGRB 4DN3H 1G9EA 5I0ZA 4HJTA 5MI0B 3K6DA 3BWAA 4TS6A 4RGNE 4D0BA 5T1MB 3TVMB 2CALA 1LO4H 5L4FA 1MDAA 5HD8D 4MJ4A 1TWHA 3O2VL 4PRHA 4LE8A 3NJIA 1CGSL 2ADJB 5CU9A 5E00A 5EA0L 2KBGA 1IAOB 4TNFA 1B0GB 3LH2L 3ZL2A 3VFTB 2P49B 3G9AB 1XAKA 4PS8A 5D2LB 3VUAA 1JFQL 1HOEA 1QTPA 4P2RA 4ZTPL 3OAYH 3WN5A 4HH9B 4X5WB 2RTTA 5J11B 3H0GA 2BH0A 1UH2A 4JG9A 4W6XB 1T7WA 2D7NA 1JXKA 5E4AA 3S35X 2LHAA 2X09A 1C16B 3GSNB 3QUYB 5ESVB 3UROR 5DUBB 4AH2A 1JXDA 1FBIL 2NY1C 3CDZA 1DJGA 3S3PA 1SOQA 4GIOA 4ZUVB 3FB5B 4AXWA 1UCBH 1UD4A 4OLUH 4H4NA 1PL3A 5DS8B 3FF7A 3UMTA 2Y5TB 2ZTBA 1SY6L 5AFAA 4Z3EA 4LLQB 1LWHA 3EBAA 4Q52A 4F20A 4PCTA 3TXAA 4NN7C 3RWDB 5KBDA 2Z64C 4H0GA 4NKIL 4R4FH 4APQD 4ZODA 4OZHE 1KJ3H 2X4QB 4KDVA 4NN5B 3PWNB 1O5PA 5K1NA 3TV8A 4K3EL 2H3XC 5DCCA 3QE5A 1A14H 4RGND 1DEDA 4JFHE 5GGVH 1NINA 4HX1A 2XU9A 4ICXA 3MXVH 4GRMA 2CO7A 3BZEA 4Z95H 3Q8AA 2PN5A 2VDKL 1I8KB 1A1NB 3O0RL 1EEYA 1YMHA 3HG1A 4X4ME 4EVNB 3FFCE 3HBQA 4X6CE 5JOPE 3GKWL 1GKEA 2YAFA 1OE2A 3IFPB 4HUXB 4FCHA 2P5EE 3V4LA 5HVHB 1KIPB 3D08A 3VGFA 1UM5H 3HI5L 1N12A 2GAZA 3VX1A 4XAWL 3G6JF 4UTAH 5A6LA 3IM1A 3TO4A 5JUEH 2B14A 3PXLA 4QHUA 3D25B 1FG2A 3O4OC 4KKRA 3ULUF 2HN7A 3V6OE 2C9RA 3NCYP 3R0MA 2N3JA 3SUKA 1MUJB 4L1SA 2FJUB 3OAZK 4TNVF 5LAPA 4PV8B 2VMCA 3H42L 2CGRL 5C2BH 1TWAA 3KWXA 3WXWL 5B39B 5DHXB 3B9DA 3VXMA 2JSFA 3CCHB 1D5IL 2DWXA 4MTMA 1A21A 2Y07L 4AEHL 5BV7B 4I85A 4NX0A 4OJFL 3HG2A 3U48A 1DVFB 2Z6FA 4WCYH 2W07B 3ZN6A 1FSKB 4PJCE 1MIEL 3BVWA 5DJCB 3VWKD 4FXKB 5KAQF 4Q14A 4DEPB 4X8XA 2YBGA 5DUML 5TGBA 1EZVY 3ZY7A 1U8KA 3EGXA 4JFHD 2I5YL 2ZKXA 3PAUA 2CO2A 2H8PB 3DGDA 4JRYA 3IK2A 4F91B 1QEXA 1MCSA 4O51A 1UOKA 1TYRA 3G6JA 4PLOB 1NCTA 4FMFA 3UZEA 5HI5C 1RLWA 5KSBB 3U2IA 4J3OC 1D6VL 3FFCD 4L8BA 2H32B 5JOPD 1J5HA 3HC4H 2V3VA 1QR1B 1D5XB 5E8PA 1ZT1A 5F1OB 3S88L 2Y7QA 2P5ED 1DVUA 1V55B 4HD5A 3BPNB 1TTUA 3GHPA 3A6BL 4FX5A 4UNIA 4Y19B 1XCTB 3VH8G 3D2UB 3AMLA 3HE7C 1EXHA 3MGOA 1XB3A 3Q5YA 1FZKA 4MNGE 2LTQC 5LQBL 1M71B 1XGPB 2OW6A 3L3JA 3S34H 5IESL 1UT1A 1HYRC 1DCEA 1BG9A 2ZSVA 3KPMA 4L5FH 4AKQA 2BXYA 2CCWA 1MG3C 1XEDA 1WO2A 2PTUA 4WY7L 5D1XE 5E4OA 4E41E 5E5UB 2QGBA 1TCRA 1RH8A 1MCOH 5I6MA 2YRBA 2KYIA 5ETUA 2JI3A 3DV4B 3NPSC 4P4RB 3M1OA 4PRPA 2AQQA 2FTAA 3V5DB 4NZTH 5DRXA 3GMRA 5ECGA 5JO5A 2QLYA 1AXTL 4HEPG 4JM2D 5I74B 3QIBA 4IU2B 4JZNA 4KRLB 2ZWNA 1A6TB 2PPCA 1NBVH 3NEOA 4KDTC 3CUPA 4H1LG 4EIGB 1FFTB 5IBUB 1MCLA 5EU7E 4ELMB 4Y5VC 4CJ1A 5CIPH 3TJHC 1YO4A 3Q1SH 4ZW6A 4BZYA 4UDTA 4MKMA 2YJLA 1YY9D 4LNRB 5DK2B 5IW6B 2VLKA 1KGJA 4G6MH 4JGUA 1I1AD 1ZVSB 5ISZA 1JRHH 2A73B 2OKMA 4GRLD 1N18A 1JG9A 1LO0L 3QYCA 4L0ZA 1U95B 2V5YA 5DMYA 4OD2B 1A7NL 1O7DE 4OLYH 4QD2E 3WHE1 3KYNB 3ZZSA 3N1GC 2UY6A 2YD3A 5I0WA 4HCRA 2PNWA 5IBTL 3GM8A 1ZK9A 5DRZA 4NM4H 4HJSA 1IAIH 1PKQE 1G87A 1ZWIB 1KCUH 1QSZA 2EXWC 2C3GA 2YBRB 3FO9B 3K2IA 3M7FB 4LRNL 4DGIH 3L4WA 3VJ6B 3SKOB 3SKNB 2JCCB 5KSUA 5FTMA 3MBXH 5J1AB 5IGXL 4E41D 4F9PA 4U05A 1IFGA 5KTEL 2F6AA 3HPJA 2RA1A 3N06B 1P84K 2AMGA 1KELH 4XB8A 4GSDH 4HAGA 3PPSA 2YEVB 4X6DF 2FJFB 5AYTA 1D5ZB 2XN1A 3LD8C 4AIZB 3GLEA 3EXJA 3PE9A 4S0HA 4I4WA 2K70A 2H6OA 5JW4R 3WHXB 5I71B 1YN7B 3UO1H 1HN1A 2ATKB 4HF5H 1P7QA 2BWDA 1AZNA 4U1MB 2J2ZB 5BXFB 4HS8H 1I4FA 5FCSH 5A16B 3EYQD 1XDTT 1GPOH 4IOFD 4AQ8C 2OMBA 4A2EA 5BRZB 5C08A 4QLRA 1OGAE 1HE7A 4OJCA 4PRNA 4UT9H 4A6YB 1JGLH 1MCWW 1OAXH 3MX0B 3OZLA 4RGOL 5DC0A 4Z7VE 1JGEB 1QO3A 1BVOA 4OZGA 1K3ZA 4CMMB 3NFSL 1HKLH 4MA3B 3LPGA 1OSPH 3NRQA 1SHSA 1M9WA 5IQ9A 1RJLB 1CD8A 1EDYA 3ZE1B 4DGVH 3P0YL 5DMIL 2A0LD 2EDKA 3TESA 2WCGA 3L2MA 3B5TA 2OMUA 2VPZA 2O26U 2NY1B 4C56A 5HI3C 4XTRD 4UNTA 4XP1L 5FUCE 4EXPX 1OOWA 8PAZA 1PT0A 4Q9QL 3DETD 4NRXA 4DKDC 1U3HD 2HT2D 2AXHA 5E95B 4TSCH 4NN7B 3SPVA 1DBMH 4CADB 1JHTB 2DWEA 2OSWA 2ZWLT 3A67L 3MQIA 2VDOH 3FB6B 4ZW7A 4B9KC 4G7YL 1CFSA 4JFEB 5FGBA 4Z7NE 4HYTB 3ML1A 2FYYB 3OG6B 5CJXA 1NUDA 2HRPL 2F19H 4AK2A 3U4EB 2EDMA 3LKOA 4UTBA 1DQLH 1DFXA 1RK0B 1UACL 2X70B 3FSAA 1QA9A 1AAJA 3RWFA 5I5JA 5GZOC 1NGWB 3GBDA 4JFZL 1WG3A 2F2HA 4KI5C 4ZSOE 1SXNA 2H7WA 1LD9A 1O7VA 2VLRA 2LU5A 3SQOL 3EJCA 2FVNA 1QLRA 1LK3H 2A4EA 4WW2B 1OGAD 5ITFA 5BOZG 4ZOEA 4HIIB 1PZ5A 1CD0A 1N8ZA 1ZSHA 2HFTA 4KJYB 4ODXB 4QYOB 4Y4FC 4BRJA 2JELH 2R83A 4KPHL 4KK6C 1L7TH 4HKJB 2YPVH 4LMQI 4NT6A 3L4YA 3NIFE 4I2XB 5JMOC 1CGXA 2B5IC 2XA8L 2XPYA 3CN3A 1AR2A 2H3NB 2ARWA 2X6BA 3GJEA 5IVZA 3S98A 1UZ6F 4YSOA 3OTTA 5I1CL 3O4OB 3FPYA 1SXCA 4QCIA 1DQJA 2R2CA 3MOQA 3ABZA 4M8RA 1AXSB 1ZT4A 2Y36L 4G5ZH 4H8QA 4NQVB 3VFNA 3V6ZA 2MH4A 1WWAX 2XQYK 3BD5A 3HZVB 2AEQL 3QNXB 4ODWA 4YE0A 1KPVB 4BDVA 1AP2A 2AS5M 3TEWA 5FOBB 1F42A 4IRZH 4ZX5A 5JXAH 5DRNA 3NPZB 5I76A 4OB5H 2WB1A 4IRSB 1QPPA 1MREL 2JIXD 1GGUA 2VC2H 1E65A 1TWFA 4RH4A 1K4CB 2GSIB 4WTZG 1FNSH 2ZX9A 3Q8EA 3VWKB 2UZIL 5IEHA 3BVUA 4ENED 2OJZL 1F5WA 1R3JA 3CN0A 3FQTA 5DEJA 3RVVC 4UANA 5TE7H 4YX2H 2WLJA 4AQZA 3CF2A 1AD9B 1BVLB 1G7MB 4JS7A 3CFKA 3EJTA 4Y4HD 3RWIB 2QZQA 3P1VA 3OJMB 2R23B 1JPST 3ARGD 3EIFA 5B8CA 5F9OH 3RHWK 2XSKA 7FABH 4XC1L 4EE2A 4FLHA 4XNMB 3TIDA 3QJUB 2WB7A 1VCAA 4PI0A 4DGYH 3KBFA 1AGFB 1KT2A 1E2VA 5GJTH 3JWNC 3REVB 2KPWA 5IJVB 1QSEE 3FCSA 3HE7B 1BXUA 4YXHH 3B34A 5L8KB 2NRDA 2LTQB 5T1LA 3DSNA 1FNGA 1MOEA 1VIWA 2P28B 1QZ1A 3WFHA 2Q2EB 1SN2A 3IPFA 2HJLA 2WQUA 4DJMA 3HVDA 4NQUA 1GH7A 3VCLB 3LN4B 5LN4A 4JGJA 3M8OL 4AQ1A 4A63A 2AQ1A 5IJDC 1M05A 2I9LA 4JO4H 4W93A 5AVXB 1JTPA 5FYJE 1J10A 1B4JH 1N70A 2OMWA 1E3XA 1E90A 4WEEA 1HT6A 1DVYA 3UADA 3WCYA 3V4VA 2QADC 3PY9A 4PJCB 1F45A 4AQAB 4JKPL 4QHMA 1F11A 5BUGA 1OF0A 2AVGA 4LHQB 3L3KA 1A2YB 4P9HL 4ORZC 1R3HA 3TNMA 2BW4A 3AXHA 4N85A 1HCVA 4YN3A 2WY3B 3WUWA 4ABUA 3NIDB 1NSNL 3CG8A 3IDUA 4J8RA 1ZHNA 5PCYA 3PIQA 5F3HB 4YZWA 1EGJA 5DDHA 1QVOA 3UTSA 2YOAA 1BYNA 4HIHA 4K5MA 3NACL 4IIQA 4K8RD 4N90E 3V0IA 2Y7SA 3QBTB 3LMJH 2Q7YA 2HKAA 4GFTB 1WTGT 1XH0A 1IBGL 4H20H 1QR4A 1QUNB 1W91A 2WLKA 1QSED 4EZKA 5GGRY 4ZW8A 4J6RL 1KULA 2X2UA 3HUJF 4KMTH 1NCDL 5CGYC 2APFA 1BZ8A 4WU7A 3DX7B 3NUKA 4Y2DA 1KC5H 2ICWA 2NY4D 5DO2C 1BFVH 1U2YA 1PX4A 4BFKA 5IW3A 4ZO6A 3GJFK 4FKHA 3PWLB 1IM9D 3ZDZB 6CGTA 3FAWA 4MA7L 5T3ZL 3X1BA 2Q76A 5FYJD 3ZZLA 1KENL 1U6AH 1RZ7L 1Q0EA 4JM0A 3LEYL 4EIBA 1RL1A 4DZBA 3KL0A 5C1MB 2X4UB 9CGTA 3W0WA 3RFZC 2HTLD 4WGWB 5HY9A 2QHLA 1BX2B 1OB0A 3FFOA 3GMNA 4J39A 3BAXA 3B9AA 5E1AA 4D9RD 5FTNA 2ZAGA 5BRPA 3RZCD 1Z3GH 4OZIA 2VGLM 3ZL4L 3WNMA 4B53A 1LMIA 1U2HA 1WBYA 1VEMA 1DR9A 2AXJA 3DXAA 3IN0A 1AIZA 1F4WH 4BK8A 1N5AA 1UVQA 2X7LA 5F8QC 1YYMH 1RMFH 1BQHG 3BMVA 3F5WB 4Y9CA 5DK3A 2EYSB 5A2KH 4UM9A 4HSAC 1D5MB 1JOIA 3IJ8A 1ZGLM 1S3RA 1NOLA 4JFPB 1KTDB 5LBSH 4NC2B 4YHYC 2W0LA 4O5LL 3MLPA 4N90D 5GSRA 3WN5C 5DLLA 5BRQA 4BRVA 2YD0A 4YSUA 5EPMB 4P46A 1CL7L 2JLPA 3RWJB 5AKVA 4ZFQA 5ECJE 4IS6B 4ZUWB 5IHUL 2WUBL 3RWEB 3E8UL 2V2XA 2OMVB 1QI3A 1OSYA 4HAKA 5E6IA 4W9GC 3BUYA 1KJMA 4IBYA 1NDTA 4NNPH 5T5FH 5F97E 1U3HB 2R29A 4WW1A 1MFBL 2PXYD 5GISL 1JERA 3FBKA 4OTXL 1ZHBB 1N6VA 5DJ8A 2KZ1B 2AQNA 3CSGA 1W15A 2DWTA 3LKQA 1ILSA 5K69A 4MCZA 1Q4NX 1VEOA 5CXPA 5HTSA 1N3NA 5D96C 4ONFL 4C47A 5EOCL 2KPNA 3UPRA 4Y2NA 2FQGA 4QRRB 3QEQE 3T1WA 3Q6GH 4LSPH 1J0ZA 1WVZA 4RMTA 2XTSA 3CFBA 2KLRA 4IK6A 1J8RA 1NL0H 5GRJL 1EBAA 5GM9A 2FX8L 2W9EL 3VI3F 3ULUE 3MKKA 5EBMB 3W81A 3IDIA 4PSPA 3U9UA 3PNWB 1Y4ZA 3UH8A 3RUGA 1JI2A 1BOYA 2B5IB 2ROYA 3N0PB 4LLYB 2A9DA 2BIMA 2ITEA 3K5RA 3FB8A 1PLCA 2C9SA 3W5NA 1S9WB 1GGIH 1GA2A 1S7RA 3GWJA 3HIZA 4WEBH 5F1NA 5GGQL 5ID0A 5IEKB 2OBGA 3INOA 4XNAA 4AC2A 1BEXA 3QG6A 3TO4C 1JZ5A 3NAAL 2OYMA 5J1TC 3WMPA 5CSZB 4UU9A 4GQ9H 2VAAB 1RI8A 2BNRE 3B6SA 3KLHD 35C8L 4KV5E 4MYWB 3FHQA 3MUGB 4B3EA 3N43F 4X99A 2ORBH 1TMOA 1Y0LB 4Y16D 2A74A 2BNQA 4KKPA 4P2YA 3VXUA 3BZDA 2CUIA 4OCXL 2ZJSH 1MPAH 3RVUC 3D8MA 1JZJA 3H9SA 2HTKD 3OGOE 4I89A 3W11D 1FRGL 4YFEA 4RA3A 4F58H 2PTVA 3SODB 2QBWA 5KVGE 1TF4A 3CVHL 3HMXL 2I27N 2J8UA 4MA8H 4H2CA 5DFAA 1NPUA 2ZX5A 2P44B 4L3AA 5F7LB 3KW7A 5AAPA 1KTRL 2IWGA 1NLDL 1AGCB 2XTJE 5INCA 1FFNB 1YEGH 4K7PY 5AW0B 3VH8A 2CLRB 1LMKA 3QEQD 3L4UA 2ZUWA 1JHKH 1HAUA 1YMMA 3HNSL 4PWEA 2GCYA 3B3BA 3KM2A 4HETA 4N68A 3UZEC 3A24A 1YDPB 2DMGA 4OZFA 3ULUD 4KK8C 1S9XB 4PS3A 2QQKH 1HHGA 4LSRH 3MRIA 4G8IA 4PS7A 1S5IL 1U8OA 1WD8A 4JQXA 4FZ8H 1NC2D 3DVGB 5FO2A 1KCVH 4B9FA 2FR4B 1FZJB 1DVZA 1ORSB 5D1QB 5DD3L 5DYFA 2DTMH 2DIEA 3BKML 4XCNB 4DNLA 4HEPA 2MQ0A 5AOLA 2BNRD 4MMZA 1J18A 2FT7A 2DEWX 4PS4H 3GSOA 1MJJB 3G3LA 4Z7OE 1UD8A 3BRGC 4NZRL 3EJYC 3V4PB 4KNSA 3ERXA 4HIQA 2Z7UA 5LJYH 1J5OH 4U3HA 3KBEA 1HCYA 2DQIL 1YNTA 5GRVK 2QADB 4U1SB 2FT8A 4HJGA 2UWEF 3MREB 3SHSA 5IOPA 2VUYA 3UIYA 1L5GA 2QKSA 2WIMA 4KFMA 1RQ5A 1Z9LA 3QC5X 2VDQL 2B8OT 3HRZA 1JZFA 5EZJB 3J8F7 5JIPA 4CVXA 4NUJA 1CU4H 1DN2A 2JJTA 1PS3A 2XTJD 4DP5X 1K4DB 4UOJA 2VLJE 2OYPA 4Y9GA 2IV2X 2FHFA 1WGOA 1E9PB 3MROA 2DQUH 2YD1A 2EIJB 4Y1TA 5C8JB 2DWDA 1U8LA 2EYRA 5D6DA 3QXVA 1RAMA 2B3RA 4PJ8C 1N0XH 4L4TE 4WUUB 5HGBB 1TMQA 2BSTB 2YA2A 4A7GA 1BZ7B 3MJ9L 3CPLB 2IFGA 5CD5D 2W9DH 1CFBA 5CJOH 2XC8A 1CE1L 5DMKB 1ZS8A 1IT9H 5FYKL 4BV1A 4ERSH 4J12A 3HPLB 2CJSA 1A6AB 3IJYB 4HMDA 1CO1A 3FTUA 4KMLB 4PMEA 4GG8B 1PG7L 2CZNA 1THAA 2EIBA 3ORJA 4X6DE 3F65A 4AVRA 2X10A 3VXRB 3MXWL 1E40A 5DQDL 3S5LG 5FEBA 3Q5OA 4NHUB 2VE6B 5AVQB 3ZL1A 1XGUB 1WWWX 2UWEA 4DK5A 1IM9B 1KIUB 4R8WL 1HQ4A 3QXTA 4F9PC 3GSRA 2OX5A 2F54B 4NJAH 5JIIA 1D7CA 1MW0A 1YYLL 2EDJA 3G04A 4XGZB 3KYKL 3W82A 1TYEB 1K6QH 4GQPH 5BO1L 3VGHA 3OKEA 4KDIA 1MJ7L 4J1UA 3MO1A 3B43A 3QAQA 1URIA 5E08L 2BIIA 3QJFA 3EO9L 4H88H 1P4BH 1CN4A 3QRGH 4HKXA 4JO1L 3U1PA 1WAPA 4JKMA 2WZ6A 1TKWA 4PRHB 1Z9SB 4X50A 1KWGA 1GYCA 2WXRA 4OFIA 2P48B 4M1DH 2Q8BL 4LP4A 1X5YA 5FB8A 5JW4M 3F2LA 5TQ0H 2K7PA 4S1QH 5L4MA 2MKWA 2K78A 5IHZA 4WQOA 4MB3A 1OM9A 4H8WC 3FQ1A 3UBXI 3ILQD 4L4TD 5BV7L 3WN5B 3V9EA 1MFEH 2EUZA 4HC1L 4YBQD 3MLTB 1EJOL 3TBBA 2H0JA 2FD6L 5B1AB 3BGFB 1P4LA 5DSCB 1MFAH 4AH2B 2CLZA 3P3YA 3CDZB 3S0PA 1CURA 3MNVA 3DO7A 4L3ED 3MGAA 2IGTA 1IQWL 2CGYA 3CZKA 2FEEL 3AADB 4HUKB 4I0PA 1MZYA 1ETZA 3E1ZA 4JAMA 2J20A 3SCMA 4JVPA 2J43A 2OR9L 5FGBC 3FUKA 3WXVL 2MPVA 4KY1L 3DGGA 4EIZC 5CJXC 5D96B 4JDTL 2DQ6A 1FN4A 2HP4A 1UXMA 5ACMA 3I75A 4G9FE 4LPYA 1FH5L 4PTTA 2YA1A 4HX1B 5HJ3B 3K6FA 1OZTG 5C7XH 2NX5D 3TZVA 3BZEB 1KEMH 2C4FU 3KEHA 4G42B 2YGQA 6PCYA 2GIYA 1EEYB 1YMHB 1MHEA 2P5EA 3QQDA 5DFTA 5D5ME 4FFWC 2VTFA 2MQCA 1OAZL 4TQEL 5JDJA 3IPBA 4P5TD 2F68X 3D07A 1G9NH 4FI6A 4XO3A 1PLGL 1LP9F 1WZ1L 2Z8SA 1O6SA 4H40A 4NM8L 4TPRL 3D85D 3IDGA 4M6OL 5AWNH 3V6OA 2CO3A 4M02A 2WMPA 1CQYA 4IU3A 5AW6B 4QHUB 1MAKA 1TVBB 5LG6A 1QP1A 4K73A 2LFEA 2D3VA 4D8PA 3IFLL 2G2RB 2ALAA 3GJFH 3SSGA 3ZTJH 4TYUA 1XF2A 1MFMA 3AAZA 1S3KL 3VXPA 4IDLA 4HP5A 3TPUB 4QEGA 1W72A 2Y2TA 3VXMB 5KYYA 4OGAD 3CHXA 4LEXL 2XICA 1FPTL 4EQ2A 3FTZA 1A7QL 5I1IH 2J72A 1OLZA 2FLRT 3GO1L 4E9QA 1YY8A 3C6EA 1AJ7L 1XGYL 3TLRA 2JIMA 5AVYB 3E2HB 1BBJA 4EBQH 3H3KA 3O8XA 3D34A 4PJHE 1L7IL 4Y7MA 3X2HA 1GYWA 2Q87A 1Q9LA 5A2LH 1H5NA 3QPQD 5TGBB 4G9FD 2O5XL 4CW1A 1BQLL 3EGXB 4DPAX 3CJJA 1FORL 2F5AL 1LP9A 4IMKA 3X14B 1KV7A 4G6FD 4JRYB 4N4YB 3NCJH 1J88A 4X0KA 3G6JB 4OFPA 5B8CC 3QNZA 1A0QH 1T66C 2Z3FA 4FNLH 2B2XH 3L5XH 4GFXA 4JRWA 5D8JH 3GMQB 4WU5B 3IDNA 4N2OA 1Z5LA 4HBCH 5C0BE 9PCYA 4ZXBD 4FG4A 4JKNA 4RESB 1F0LA 4F57H 1CFVL 2GJ6E 5EN3A 2IH8A 2HUEA 3BSHA 2OLDA 1KBGL 2Y7QB 4P49A 5DEGB 5CJQH 1AYRA 1N64H 1HYSC 4EI6B 1SLUA 2YGOA 3A6CL 1T22B 3T2PA 3P02A 4B9JA 1DEEA 1E5UI 5D1XA 4KOBA 1ODUA 3AREA 3D3VB 3IRZA 3L3JB 4E41A 5B3JF 2J1XA 4Z78A 3GHEH 3FT9A 1R47A 3ZKQD 2PETA 4J5VA 4B9ZA 4FABH 4YNYB 2H4EA 2UXVA 2JLLA 1TCRB 2CW0D 4CU6A 2LT9A 2XHNA 5EBGA 4AQ1C 3QORB 3ULVC 3C6SA 5E7FA 3MV7A 2WXLA 4LU5H 4PRPB 1ZLWH 1TJGL 3FRPB 1LEKA 3A47A 2FCBA 5DRXB 3U7YH 3P4NA 1HK6A 2WYIA 5JO5B 4H26A 4YEEA 4HFUL 2C8NA 1NBCA 4HS6A 4NGHH 1JCVA 3L1OH 4TNVK 2J56A 4KHXL 5I0DA 2C9XA 1UOLA 3QC8A 2XFXA 3QIBB 4JZNB 3CQQA 1TMCB 4NPKA 3FUHA 1J8HE 1FGVL 4YDIL 4OD1H 4U1HA 1HU8A 1CGUA 1L3NA 1IFRA 5J06A 4RAVB 2GW5A 2IANE 3MTXA 3Q2CA 5JHMA 2VLKB 1Q0YL 2XXGA 3ZPDA 3U7WH 1IKFH 2W92A 3BJ91 4N1CA 4JK0D 2XWEA 2G2PA 3N41F 4MB1A 2KUTA 5ISZB 5I9QC 2DEXX 5SV3A 3KS0J 1MHCA 1FIGL 2FATL 4EUPG 5C0BD 3GC3A 4IIQC 1RHFA 2BMKA 4JHAH 2BSBA 5D7LE 3VE0A 2GJ6D 1T2QH 2EKSA 1EX0A 3IJ7A 4BE5A 4XPAH 2UY6B 4HWBL 1TETH 4X9YA 4KO5A 1CLOL 3ESOA 1AC0A 1WFIA 4D3CH 4EPSA 4HK0A 1HJBC 3NCYS 5G4MA 4M62H 3F04A 3T0EE 1R9FA 1C7TA 1S4IA 2QDVA 5I0YA 4Y2DC 1RIUL 2ICEB 4Z0XB 4OIIL 3MLVL 4Z7QF 2VRQA 4CL7A 5KSUB 4YIQB 4D7ZB 3FQRB 2XWDA 4R97C 1H0DA 5F9DC 4CU8A 3AUVA 1NOFA 3K91A 2G5DA 2WXIA 3HPJB 1LE5B 2FEDD 2UX6A 3LIZH 4CUCA 4WHYH 1UXSA 4K7PL 4AI7A 4HJEA 4WFFD 5CP3A 1CTNA 4BYHA 4NKQB 2WSDA 5I1LB 4TUJB 4WRLA 5HHVH 2G60L 5EEWA 5JR1H 2BS8A 1B3IA 2AXWA 3NP3A 4I4WB 1QNIA 3U79A 1NTDA 1ES0A 1X5KA 3KBPA 4I0KA 5EOCJ 5JHDE 1R3IL 3DV6A 1KYFA 4LOEA 4XMKH 4HIXH 4F15C 1I4FB 4B41A 1J8HD 2F1BA 2M2DA 3B9EA 1WS7A 3SKJL 4YHOL 5C08B 3FU7A 1J1OL 3BWSA 4NEHB 1WZMA 2IAND 5F0JB 2R4RL 4PRNB 2K9FB 2XQ0A 3CZEA 4NOFA 2YN3A 2XCMC 5EEXA 1QO3B 3MI6A 4OZGB 5I73B 2MTPA 4ZZFA 3UAEA 3IFNL 4L4TB 3SJVD 2A38A 5ENWB 3DMMD 4R4ND 3US9A 1HZHH 3GDCA 3WMQA 2NZ9C 2XWTA 2WXMA 1BJ8A 4JFQA 4JE0A 2O5YL 3T8VA 2A1WL 3DHPA 4P46C 2OMUB 1CD9B 3OF6D 3B9KA 4Z5RA 4N8CL 3UTQA 3K8MA 1BMZA 1QNZH 2KC0A 4AOKB 3BP6A 3F8UB 3OKNA 4IBSA 4L3EB 4OLWH 3LH8A 3T0ED 1G6RA 3ABKB 5E6IC 3C60A 4KKLD 4NRXB 1P5UB 4LXFA 1A3QA 1T7XA 4X8GA 1JXFA 1J48A 3SPVB 4HMCA 2B1OA 2DWEB 1IKOP 3WD5L 1JZ6A 3U7AA 1S2EA 3AZUA 5BZDA 3QCUH 1CFSB 2DZEA 2AI0L 3OGCA 1JWMA 2ERJB 5FA4B 4ZSOA 2J21A 1I3RB 1NKGA 3STZA 4PY8I 4Z0BH 3LKOB 3VI3E 1BF5A 4WTQA 5MEQB 4AX3A 2VKWA 3LJ3A 3WJMB 1JDCA 3RWFB 5JHDD 5JPMA 4Z7AA 4FQ2H 2YPKA 1LD9B 2BM3A 2NX5B 3GXIA 3MUJA 1UUSA 2EXTA 1XEUA 4JHZA 1QLRB 4NUGL 2W5PA 1E30A 1U3NA 1E5CA 1INEL 5E2JA 4X4KA 1MAML 1PZ5B 1N8ZB 4DP1X 5KVDE 2L7JA 3CHQA 4Z3IA 2BJML 4XODA 3SGEI 3AWEA 3GJEB 3MNMA 5IVZB 1JWUA 3EHBC 1KY6A 2W65A 4PYHA 1B6DA 2CCLA 3C5ZA 2EVIA 3AU1A 2CXGA 3IKCA 3VNYA 5EOQL 1NIBA 1MRCH 1ZT4B 3VFNB 1H6FA 3ILDA 1Q9OA 1UG9A 3BN9C 5CNHA 2EILB 2PYEA 4ODWB 5EORH 4BDVB 1Y18A 5E9DA 3FUMA 3V0FA 3FUNA 3MRQA 5KJ4A 5C0RL 4K8RH 4GUPB 5I76B 5HDBF 3W3BA 1VCBC 2XV0A 4FOMA 2HLFC 2X4SA 5E4EB 1INDH 4DETA 1QZNA 5I19H 3BI9X 3SE3A 1QFHA 5I5RA 3X12B 1PYWA 4POZC 2AJYH 3PL6A 5L88H 1FV1A 2F58L 3BGMB 3L7FA 2APWA 3FQTB 1R3JB 4K94H 5DJYA 5KJRL 1A5FH 3RVXD 1OGTA 2EIKB 2YXFA 5JORA 2I60H 3P30L 4QWWC 3SDYL 4XH2A 3CFKB 4PP2A 1ECYA 3RRQA 5IMMA 1DE4A 2VN5A 2FGZA 5B8CB 5LGJA 3SGEH 3KLSA 4JFDE 5FYJH 3TIDB 3INUH 3LXUX 3QUHA 4MD0B 1QSEA 1OP3K 2QKIA 3GRWL 4YGAB 2QT6A 1KT2B 1NANI 2R0WL 4M8QA 1OAUL 3KPRB 2IFFL 5D7HA 4ICWA 1E5VA 3FCSB 2CBQA 4GAJL 1MWOA 4X98A 2DLHA 3LQAC 1FNGB 4FQJL 4JQXC 2ZOTA 3QZWA 4B50A 2PP9A 3WFHB 1IEAA 4U1KB 3I2CL 2HJLB 3BO8B 5I1JH 3D2TA 5JW3H 3L4ZA 5FM8A 5IFAL 1F3DH 1KTKE 1DO6A 4MMZC 4MLIA 3IXAA 1HKFA 3O3UN 4AQ1B 4NO5A 1UWGH 4IBWA 4FFYL 3RNQB 1JZGA 1M05B 2I9LB 3MLZL 4PRBA 4QXWA 3ZGIA 3C8HA 1C7SA 3FC8A 3TT3H 1GZHA 3N55A 2OMWB 4PV1C 3WTYA 4FLRA 3ES6A 4UDUB 1IGML 3FQYA 5DK0A 4R5XA 3RAJL 2EAEA 2VERA 2E74C 2EDFA 3RZCA 2PYFA 1F11B 4QHMB 3ZYIA 5CZKA 3V6FA 5LCVA 4C4KO 5ALBH 1NCAL 3HRZC 3U46A 4DAGH 4L8DA 1R3HB 2NY3C 3TNMB 4XE5B 5DZJA 5ICZA 3ARZA 3BUBA 3NSJA 2JJTC 5L2KE 1AVAA 2X9YA 4D7BA 3GI8L 3KLDA 5KANI 3L08A 4J8RB 5JOFB 1ZHNB 5EDSA 5HDQL 3BD4A 3PIQB 2E76C 1REIA 3OXRA 3VMNA 1IAKA 1QVOB 4JFDD 4HIHB 3VW3H 2AEPL 1A9BA 2EQDA 2BK8A 3FKUS 4IIQB 4XBPA 5D6DC 4ZUTB 4FCAA 4R0LA 1MI5E 3BAWA 4ZTOH 2Q7YB 3RPKA 3WBDA 1M7IA 1FWXA 1H3VA 2DAVA 4YHZH 1EJ6A 2OXHA 3IWUA 3S96A 2EE3A 3HU2A 4JVUA 3BFOA 5IVNA 2ICWB 5JHLL 3BVXA 3FOMB 4NZJA 5GS1A 4O58L 3VGDA 1IKNC 1SYVB 1W80A 3CBRA 2AANA 4OFDA 1GGBL 4GSRA 4X6FA 2OK0H 3DBXB 3HG5A 1IV8A 8FABA 4QT5A 2Q76B 4AGLA 4XMTA 3E9TA 4J3UA 4M00A 3BVTA 4DZBB 4FA7B 3QULA 1VAHA 1KSRA 3RY5A 3W0WB 2B1HL 4JEGB 1KB3A 1LNUA 1NGPH 1ZJBA 2JKIS 1W6LA 4NHCH 4F15B 4L8CA 4HOXA 4NUPA 5IB2B 5K9KB 2J5WA 4K71B 2WOYA 3RIFK 1SQ2N 1B0IA 2HRHA 3KD4A 3DXAB 4HQQL 4YO0B 5L2KD 4HOZA 1SBBA 3V5KA 2O6FA 1F4XL 1YNKH 1YPZF 2YUVA 5B3NA 2X7LB 2EH8H 1W8EA 5A2FA 1I8MA 3HUJB 4UM9B 3S35H 1AIFA 1NCBH 4NZFA 5CN1A 3SJVB 3VXOA 3HB3C 4FG0A 1JNNH 1LWRA 2GK2A 1VRSA 4TTDC 5GSRB 4XI5C 4CRZA 1MI5D 2R27A 4M5TA 3CMOH 5H2BA 4N3TA 4AYGA 1FJ1B 4P46B 4Y16A 1JSYA 1FDOA 3NCWA 3D69A 1PEZA 2PWDA 3WEXA 3O3EA 4N2EA 1B9KA 2V2XB 3L3DB 5JIDA 3CD4A 4WJKB 5EZOL 1KN4H 1XF4A 4I1RA 2L04A 3BUYB 1KJMB 3QFJA 4I8DA 4M5ZL 2JIRA 4XXDB 4AKPA 1O0VA 2FUTA 4U1IA 2D0HA 3VD0A 3C5XA 3ULUH 4EO5A 2NNFA 4WW1B 1U91A 4I0PC 3SDCD 1L6XA 1MFCH 2IPKA 3EUUA 4YHLL 1KOAA 2VDLB 2GFBB 2CNYA 3Q5TA 1OA9A 2VDMB 1GYVA 4YDMA 5DJ8B 5HBBA 1Y1WA 1SMYD 2KKQA 1A66A 1E4KA 4DIXA 3X3FH 3LKQB 3SCMC 4JY5H 5JQIB 2F53E 3E8VA 3HR5A 3T3PE 1YPZA 4MCZB 7PAZA 1W9XA 5DXWA 1SM3H 2JI1A 1VFBA 2YAPA 3L2NA 4DMRA 4XN5A 3UPRB 3LKNA 3F7PC 4HKZA 1YEHH 1OT4A 3ATBA 1JHLH 1TO5A 1XXFC 5L2JA 4KJPD 1WS8A 4GAFB 1RUAH 3O3BA 4R7DB 5F9JB 3MJ8A 3TZVC 4XMVA 3BSZL 4WSGA 2EINB 2EKJA 3IDIB 2A9MH 3U9UB 3MVSA 3GMPA 1PYQA 4JG1H 3K2UL 4AJ0A 3OR7B 3HU3A 5F1NB 3V6OC 4HXAH 4CDGC 3QG6B 1HAWA 4S1DD 3KDMA 2WKLA 4H0LC 2H3KA 4UU9B 2BY3A 3B6SB 3UCRA 3LDBB 3QIUA 3IU4H 3D30A 3FQUA 3GI9L 4X99B 3SGJA 2FZ3A 4A55A 3APCA 2YUWA 2A74B 3FZUC 4DP4X 3TEUA 3S37H 3H9SB 4JO2H 1KCKA 4G6KH 5JIMA 2VLME 3WIFB 2H2PD 1M57B 3O6LL 1ASPA 4JM2C 1DLHA 3OKLA 1DFBH 1AO7E 3M17A 3DIFA 2J8UB 2PPAA 5GJSL 4ZI8A 1LEIA 3FT0A 2V9TA 1KTLA 1CXLA 3FHEA 4FYTA 3A4EA 2D4FA 2F53D 2YEQA 2FK9A 2J8HA 4PV9A 3FCGA 4PGCA 3MRMB 2D9CA 4P2OA 3O8XC 1T1YA 5INCB 1MVFA 1CLCA 1YY9C 5L4JA 2GJRA 2DICA 3EDFA 2WLHA 3II1A 3VH8B 5AB0A 1IC5L 4OT1H 3VXQA 3SDDA 3QUKA 2YR3A 4XN2A 3S2CA 3KWWA 1XSKA 1YMMB 3M1BA 4U4IA 4GRLC 2HJKA 2GCYB 2ZZUT 3ESVF 4J28A 2XWXA 4HSQA 4XCFH 3SE4C 1VDGA 2ISDA 5B3JE 1HHGB 2DYSB 4MJ5A 3ZE0E 1QFOA 3EYVA 2W1NA 2YAMA 3MRIB 1G6VK 4G8IB 3N43B 4IDJH 3TTYA 2GSGA 2QR0A 4NN6C 1BXAA 1U8OB 4IBQA 4R7VA 3WY4A 1N7MH 1I9IL 3K6SA 2WXQA 1R5IA 2DQJH 2IPUK 4LLMB 3GBNL 4MVBC 1SOXA 2WJ5A 3RGVD 3C2SA 5D1XC 1URLA 1QDNA 3AREC 5GQBA 2BINA 3MLXL 4MMZB 4EQ3A 4ZQKA 3GSOB 1AR1B 4JKLA 5IFHH 5D9SA 1IB5A 4D9QD 1FIEA 2BC4A 3ARPA 2ESVA 2R0ZH 4MDJA 4X4XB 3AABA 1DJZA 1BV8A 2VLMD 1AS6A 5DYOA 5D7JD 1KCRH 1S7SA 3QWNA 1AO7D 4HJGB 4ZOAA 5IOPB 1DN0A 2ETWA 2K1MA 4OUUB 2ZKHH 4JDEA 3EYQC 3C2AH 4AEEA 5AW8B 1QG3A 5I8KL 4OIAA 1HXMB 1A3RH 2AGJH 2ITCA 2VZ1A 1YNLL 1KLFA 2NY3B 2VLJA 3GYRA 2J12B 4O02A 4QDGA 3HVNA 1E2ZA 4HT1H 4YDNA 4YHKL 2XG4B 4CVXB 3ESNA 4GMSH 2WWKO 5DTFB 1PYUB 4WZ9A 3TTSA 3QXDA 4JANA 3OL2A 1XCWA 3I9GH 4RMVA 3MROB 2FX9L 3ZVVA 3J27A 5DHDA 2IEPA 2EYRB 4ZX6A 3VFVA 2VXQH 5I1HL 2J5LB 5EO0A 4ZW3A 1P4UA 4ODSL 1O7DC 1H8LA 4N5ED 2EIMB 4WENB 4LVHC 2Y22A 1CK0H 3WIHH 5F0MB 4JHWH 1G5AA 1S78C 4G2AA 4UOW0 1KTBA 4L4VE 1Q1JH 4Q6IC 1L0QA 3L3GA 1MWAH 1MNNA 4OVUA 5J0BA 3AWFA 3NJLA 4CSSA 4PB0H 4P4KD 3OKOB 3IXTA 1F6LL 2XVKA 3VXSA 1MAJA 3GZKA 4L23A 4PJ7F 2UWEB 1UEYA 2ATPA 4IHOB 4KY2A 2OMYA 2ZOWA 4MDIB 3MJ7A 2J4WH 1CS6A 3CX2A 1A4KA 1RK7A 5HHOE 4UQ3A 5KG9A 2OX5B 2VUKA 1JGVL 4APXB 2VPWA 1MW1A 2AW2A 3G04B 3WMSA 1E27B 3EOAA 3QCTL 2E7BA 3GK8H 3KWTA 1F8TH 1KDJA 1KJ3L 2X05A 1EHXA 3T2OA 2FECI 4GSQA 5AAMA 2NYKA 3HFFA 1JL8A 3DTXA 4IOIA 1FH2A 1HZKA 1DVTA 4HKXB 3MA9L 1MFVA 3LIUA 2IADA 1TKWB 3ZDWA 2Y7NA 4PIRF 3I6LE 4LSQH 2C3VA 1ND0A 3CFCL 1OP3H 5FB8B 4Q56A 3GHBL 1L8FA 4HWNA 2PWEA 4G8FB 5IHZB 2WNGA 1ZDQA 2AAAA 2WPGA 4XXCA 2WQVA 2I25N 2KLTA 4TMPA 2R7ZA 7CGTA 1OK0A 1D7BA 1PQFA 5C0CE 4JN1H 1YQVH 1OTSD 3TO2A 5H35A 1CBVL 4L4VD 2J1WA 1P4LB 2FX7L 2X6MA 1THCA 3FONA 1GTFA 1A8ZA 1C12A 2PPFA 4BGLA 4YSQA 5GHWL 3B9KC 3MV01 2CLZB 4P23B 3MNVB 3RURA 2A68D 1ROCA 3OJ2C 1GZQA 1H6UA 1KF9B 5FHAL 5ID1A 3AG1B 1NCNA 3UTZA 4MAUH 4MDRA 4I0PB 3C60C 2PCXA 5CZVH 1USQA 5HHOD 3VFGL 2BHFA 2PR9A 4YBLB 4JAMB 5EZIL 5TQ2L 4WCYL 2EDRA 5DMGD 4RA0C 3OMIB 4OBRA 3SE8H 3UDWC 2WQRA 5DJDA 2ID5A 1D3CA 1YEEH 1B2YA 1AY1L 1KBBA 3DGGB 3H0TB 4KKCD 2IAMD 2LOEA 5DS1A 4Y9EA 2FYVA 3BVNA 4HEMA 4HJIA 3VSTA 2MHAB 3ZO9A 1KCSH 2A77H 5J13B 2VABA 1IGFL 3I75B 2NW3A 2N1KA 1OM3H 2ZG3A 1BWMA 3SDAA 1DQDH 3BKYH 3F7RA 3OPUA 4HJ1A 3TZVB 3I6LD 3GB7B 4QRPB 5HGGS 4AGNA 3CHOA 1NCCH 4BQBA 1LILA 1MHEB 3QQDB 1LWJA 4Y7OC 2EC9U 1F00I 2BP3A 3EH4B 5FUOH 1NCWL 1G9MH 3DNKA 1ADQH 2FNWA 1OA7A 4R2GD 2H0PA 4WK0B 4IBLT 4LVEA 1O6SB 1PZAA 3RVTC 4G71B 2WMPB 4LSSH 2N7SA 3NGBC 4IRJD 1PSKL 4IU3B 2HX8A 4PJAF 3C6LA 3TIEA 4D94A 3C5ZC 4UOQA 1ZY9A 2Q86A 2WXNA 4D8PB 4Y0GA 1V3KA 1DBAH 1FNLA 3W37A 5C6WH 1XF2B 4QXUH 3AAZB 3S3DB 4NWTH 1BZ9B 1OL0A 3QW9A 1QPKA 2MJWA 4M61B 2Z0UA 1W72B 4PCSA 2FJSA 4KZEL 5KYYB 32C2B 5DEFA 4LLVB 3UGUA 4G9DA 2F7PA 4LP5A 1C5DA 4UIMB 4JBSA 1JVKA 3Q8BA 4XNBA 2EUXA 4PJHA 4GUOA 3SE3C 5IROA 2X4NB 4FMKA 4NCDA 4G83A 2DH2A 3PL6C 3B2UC 3O8XB 4YK4C 5D7KE 1Q9LB 2ZUVA 1GSMA 3AGVA 4CW1B 5EUOF 3Q1SL 4N25A 3D7PA 4RZCB 1U92B 2CRIA 3WTXA 1B2WH 4DQOL 1OWWA 1LP9B 2D7QA 4M7KH 4X0KB 3KVQA 2K6YA 3U4BH 1PDKA 2J55A 3QNZB 3ZE2F 1M53A 1O9ZA 3FQWA 5CZXD 3LB6D 1R27A 3MRPB 4K9EH 1FO0H 2QKIC 3NFNB 5BMFL 2HSIA 1KBKA 1CTOA 2H1PL 2JNZA 2Z91B 3FRUA 4KK5C 4PJDF 4C2MA 1D9KD 2PWHA 3DI2B 2NY4C 1CXKA 4XO5A 5CCGE 3MV11 2WIIA 1DEEB 5I26A 5EOTB 1OK8A 3AREB 1ZC1A 4GW5A 1X5FA 1YJDH 5IB1A 3RPIB 1FC2D 1EMTH 1KG0B 3F6IA 3PABA 2C7UA 4DO4A 4GSUA 4Z78B 1BAWA 1GL4B 2ENPA 1WFJA 1W8NA 4PP1D 4JDZA 4B9PA 3C9NB 3L8QA 2GUOA 4FJ6A 5DURB 5CGMA 2XN9E 1KELL 4M43H 4U0QB 3C6SB 3MV7B 4PH8A 3BPCA 3P4NB 2V3FA 4H8WL 1GZHC 4H26B 5EUOA 1OCWH 1UD2A 3E3QC 4GW4A 4HS6B 4WUKH 4H2AA 3LNEA 3O0LA 3RZCC 4M6NL 3UO1L 2YSSA 4G7VH 4HS8L 1U36A 2ZUQC 2E5EA 2EICA 3GZOA 4ODVL 4U1HB 1ZLVH 2EXSA 4H44C 4XVTL 1ETB1 4N9GA 4N0CD 1CDIA 4WJG3 3DMMA 4UT9L 1OAXL 2F15A 1HDMA 5D7LA 1AG0A 1MHCB 4YXKL 1HKLL 4TULH 4P3CL 4XCCH 3CZJA 3VVWA 4ZBJA 2BMKB 4K3HA 3VE0B 2XNAB 2EKSB 4R0LC 3CNKA 2N4IA 5K9JL 2GT9A 4NCC1 4FQLH 3X2GA 3VNZA 1OQXA 5C71A 1KGYE 4UTBL 3X17A 3KW8A 4P4KB 5I17B 2NAPA 4YPGA 3N04A 1RZFH 2XG5A 4FP8H 3MMEA 1PT1A 1UM6L 5GS1C 1BBDL 3HZYA 4FF9A 3JWDH 4U1GC 4D2NA 3RBSA 2VLLA 2OQJB 1H0DB 3GMOA 4IKKA 3MSPA 1ESOA 5AKRA 2IV8A 3JV4A 1DBML 5FF6B 2XN9D 1RHHB 4GUQA 5E2TH 1IBHA 1X5JA 3A3YB 3NESA 1OAKL 1OIOA 3L7EA 5ICYA 2EVJA 3J07A 4X8JA 1AGEB 4JPSA 4MQ7B 5FGCB 5FW7A 5LVEA 1NEZA 2Y2YA 1BOGB 3DV6B 2EUWA 2O5NA 3N41B 4GRWB 2Q9OA 2QVTA 2X0WA 5IQ7H 5KSVA 1U8CA 1LGVA 2XA3A 2G75B 1Y6MR 5IVXF 1K5WA 4P9MH 3FU7B 4W4NA 4JJOA 2O6PA 4QRFA 2A9CA 4WNJA 4ZMLA 1VESA 1GXEA 3MBED 3BWUF 4JFVA 1JVLA 2DYRB 5F3FA 3R7QA 3Q01A 2P43B 1DQMH 2BNUB 5L7XL 1NEPA 3ABMB 4YDJA 5TDPA 1MF2L 1QX1A 4XCYA 4K23H 5TK4A 4Z7QB 2XWTB 4FQPA 5TE6L 1FAIL 4JFQB 2RCSL 2YEZA 1SN5A 3LH9A 4BGDA 4F2ME 1CF8L 4Y16C 3B9KB 4LBEA 3ILEA 3QG7L 1QRNE 3BQUD 4Z5RB 4IBUA 1YG9A 4UQ9A 5L8LB 3UTQB 3BESR 1EXUA 1S5HA 3OKNB 3OZKA 3QZBA 1J8KA 1G6RB 1MXGA 1P6FA 4KZ0A 1B9ZA 4KUZL 4IRZL 2YZ1A 1B0RB 5T1DL 3OKKA 5KVDH 4OB5L 3TIWA 1RVFH 4L0PB 5IVXA 3L5IA 4FQHA 4IKLA 5B1BB 5BZDB 3GBML 3I6GB 5JIHA 3WAJA 3OGCB 1PX3A 2DEYX 1E4KC 4OBSA 2DJMA 1YEJH 3OMNB 4YHMH 5DD1L 4YX2L 1NIFA 2YPLA 4NFBA 5F1KC 3STZB 4B97A 2P8MA 5C6TH 2IPTH 1BWWA 4OLZH 4D0DA 5JPMB 3QXAA 2ZYSA 2CGZA 2DLFL 3APMA 4NO0A 2HMID 1NKOA 1OEZW 1E7UA 1O6TA 3MNWA 4H1LH 4XRCA 1BEYH 3GIZH 5D93C 3O6FD 3VI4E 3DVNA 4FRWA 1H3XA 1RIVL 3KG5A 5MENE 4MZIA 2WC7A 5DVPA 2QVIA 4PJBE 2P5WE 1BGXL 1N6UA 1YUHB 2D8KA 2HX7A 2O4EA 1RSYA 1YEIL 3H4FA 3JWOH 3L54A 3GTLA 4WI5A 3KPTA 4UF7C 1JWUB 4YXHL 2W65B 4PHXA 3V4VL 2MNJB 1MJUL 4IRJB 3C5ZB 3LPOA 3AU1B 5H37G 2NW2A 5B4MD 3IKCB 2UXTA 3S3BB 2WBJA 3EGDA 3OHXA 1Q9OB 4P07A 3OJDA 1FHNA 1QRND 4P59L 3U4KA 5HJDA 3O5AA 3G5VB 3IMSA 2PYEB 3QARA 3EOTH 1J05B 4JPKH 1Y18B 3QUXA 3ZUNC 5E9DB 2WSPA 3MRQB 4Z1PA 4XC3L 2YGPA 1J0HA 4XWGH 4OM0H 1SMDA 3PGCA 5E03A 4JRLA 4KWUA 1TITA 4A68A 1XGTA 5DD6A 3ZHKA 1GTNA 1PYWB 4HKBA 1ZLDA 2ZYHA 4JRXA 1RU9L 3DRQA 3PL6B 1FV1B 1GYAA 3P11H 1FL6A 3L7FB 4KTGA 1TJHL 3VACA 2XTJC 3B7UX 4IEFA 5B39G 4MCNA 1OGTB 1A9EA 1NCHA 5IB4A 3U1SL 5JORB 4GLRI 3QQ7A 4X80H 1EXGA 4P2OC 1RP9A 3JQOB 1GC1C 4XH2B 3PJSB 3GDBA 3TEXA 4EN3D 4FADA 4W70A 1DE4B 2LFGA 4M48H 3VA2C 2Y72A 5LGJB 1Y7VA 2NY5C 3K0WA 3SDDC 4C55A 4M6AA 4PREA 4XPBL 2E46A 2JKXA 1KTJA 4GKZA 3ZJAA 3KLKA 3RKPA 2NPLX 4AOFA 1XGRA 1FUNA 1YQ2A 3ZHDA 5I5MA 4WGKA 2QKIB 1OSEA 2P5WD 1A4JB 1M3IA 3TYFA 1E50A 1XMWA 3BZ5A 5EBLA 1M2OA 1ZHLA 3WFEH 4H20L 1D6EB 3T4YA 3ZDYE 4MAZA 4DPCX 3KMDA 3I6KA 4DH2A 4KKZA 1TTCA 5I1EH 3WNPA 3HNTH 2W0FB 1N4XL 3HHMA 4KMTL 5JYLA 2OL3A 3RNKA 5HDBB 5LGYA 1IEAB 1AQMA 2R56H 5GS2D 4RWYH 3QDJE 2JKLA 1QASA 5ANHA 2Z93A 4ALAC 4I3SH 2ZICA 3IXAB 4L05A 4K7FB 2VZTA 3MLWL 3VXNA 1M7DA 4TL5A 4PRBB 1NDMB 4MJIB 4G43A 4R7LA 2DQMA 1U6AL 3BPOC 2YRPA 2A6KA 3ES6B 5DK0B 1E0OB 3FTYA 3RDJA 1A7RH 1KYOK 3QJVB 4NRZB 1JYXA 3UACA 3H7BB 4X83A 1TQVA 3JBG7 3UOAB 4XWOD 2BERA 2NCMA 5D2NB 1E4JA 2KDYA 5L2KA 3QHZH 1DJWA 4DCQA 4NP4H 3F58L 4HWEL 3U46B 1Z3GL 3VQMA 1DBKL 3MLSH 3E6FA 4L8DB 3UTTA 4N6RA 3CGTA 2R69A 3E80A 3MN8A 1QFUL 4K2UH 4IGBA 3S5ZA 4XNUL 3H2QA 2WUCH 4LSTH 2YD9A 3OXRB 5DJ2A 5C0ND 3QIWD 1J1PH 1IAKB 3S5LB 4CGUB 1MI5A 4S0SD 3BE1L 5E2WL 1P1VA 2BY1A 4AZUA 4XBPB 3SBRA 1CMOA 3DOSA 3CDGA 4PJ5D 1D5BB 4R0LB 2VDLL 3GBEA 2VDML 3CZNA 5ESAB 1HXYA 1VLXA 1FZOA 1I3UA 1FFOA 5AUMA 2OXHB 3S96B 1XD0A 2UZPA 2OXGB 5BS0D 2YMXL 2BVEA 1E5BA 4NO3A 5GRYA 5GS1B 3HAEA 4U1GB 4U0RB 4CGTA 3QDJD 4MB5A 4PUBH 5I75C 3KDPB 5D4HA 3APNA 4ZPVA 4E9LA 2K6WA 5GS0C 4QT5B 3UAFA 5IJKA 2A83A 2OZ4H 4BQ9A 2OSLA 5EO9A 4M5YH 2AJ3A 5ADPH 2P47B 3QULB 4RDBA 3X2MA 2DQGH 3VG9B 1LNUB 4KMQA 2EE0A 4LF3A 1Q0XH 3LZFH 3AG3B 5AAMC 2ZYIA 1IGJA 2J44A 3L1FA 4XP5H 3T2NH 4Z3GA 2DDQH 4MXQD 1WZLA 2MPAL 3DVFA 3Q6GL 4TVPL 1DQKA 3QQXA 3B2VH 4QAMB 1CXEA 3FULA 3V5KB 4WO4A 3QFDA 4HALA 2HFGL 4KX7A 2XVGA 4ACPA 3ZKMD 1AIFB 4ZFGH 2V2TA 3QQ3A 3BD3A 5LGKA 3BN3B 1CXIA 5E2VL 2GABA 4XXCC 4WEBL 3VWJD 4HPOL 5GGSA 5H2BB 3KPSE 2W80C 1TQSA 1SRDA 3MACH 5D7IF 5AW3B 4PHZA 3D69B 3BQUB 2KDGA 3WAKA 2ZQKA 3O3EB 4OCRH 1HHHB 4TOYL 5E0FA 3KVDD 3UC0L 2QV2A 3SEPA 4M93C 3QFJB 3GKZA 1CZ5A 3GSUA 4CSZA 2P80A 4G8EA 1RZ8A 2DQFA 2H9GB 2ZJSL 3A0OA 1MPAL 3KGTA 1A7PL 3MCKA 1X5HA 4BFNA 1U91B 2CMRH 2PWGA 4OM1H 4MMXC 3BLBA 2AJXH 4R84A 3AG2B 5KSAD 4PN6A 3VM7A 4F58L 2IPKB 4X7FC 1QYGL 4OIFA 5FGSA 2WAHA 2J6EH 5E94A 5J6GA 3JTTA 4MA8L 4AENA 4OV5A 3QI9D 1KEGL 1ONQA 1PZBA 4YLBA 3HR5B 1PG7W 1YPZB 3HN8A 1HQRA 1VFBB 3ZDXE 1JPTH 1M9SA 2WLIA 4HGMA 3LQZA 4OSUH 4YGVA 3V0WH 3LRMA 5FUZH 3LKNB 4AMWA 5D93B 2QQLH 3LZRA 5L2JB 3SDAC 3PWVB 3O3BB 4GQQA 3MJ8B 2CBTA 2CCVA 3QCVL 4U6HA 2NUPB 5HYJA 3T08A 2R7EA 4D0CB 1T6BX 4NZUH 2KERA 2ZUUA 2QV4A 4PBDA 3GMPB 5DZPA 4HZAA 4LSRL 2FWSA 4XPFL 4F5CE 1KWKA 4P5SA 1Z2KA 3EFDH 3RDTA 1HOCA 2PP7A 2BIOA 2HWZH 2AVFA 4UNVA 1T0OA 3PDGA 2X6UA 3BMWA 2WVTA 5DMJB 4NKMA 2W91A 3KDMB 3KPSD 1RZJH 5ITBH 2ADGA 3C6LC 2WKGA 3QIUB 3RWGA 3H7LA 5J8OA 2EXYD 3FQUB 4JKWA 4TRPH 1AD0A 1LO5B 2FZ3B 4PRIE 1QFWI 1D5RA 4PW3A 5FFOA 4LO9A 3F6JA 1BHGA 3FW6A 1AS7A 1IE5A 1NAMH 3QA3A 1H0HA 5AZ2H 3EYOA 3TBTA 1R0AH 3KXFD 3CQPA 4JY6A 4M4PA 3OKLB 3OWRA 3M17B 3DIFB 2WKOA 3GPEA 3CFEA 1H9DA 1CICD 1KTLB 1OPOA 1E43A 4NDMA 5IROC 4JCMA 5AYUL 3O45A 1UM4H 4R96B 3WY2A 4CSTA 4PGCB 3CHRA 5EZLA 5FA3A 4PJ9D 2B4CH 3MNZA 1T1YB 1OP4A 3V52H 1NMBH 1QATA 2ZWKA 3CXDH 1ZRUA 3VXQB 3SDDB 4S1RL 1ZK5A 4MAYA 4P57A 3QDGE 3H3BC 4N0UB 4PJDE 2DQUL 1TVHB 3HG0A 4GSXA 2HJKB 4EZJA 3QJHA 4U49A 5F6IB 1R46A 4LVNC 2IF7A 4PLKD 3CFDB 5KW9H 5IG7B 2R2EA 4MJ5B 5FDWA 3EYVB 2W9DL 5GZNA 3W2DH 4RRPM 2QR0B 4ONHA 4XPHL 3RX8A 3B83A 5C0JA 4J7RA 1LM8V 1R5IB 3SYOA 2Y0SA 1IC0A 4J3OG 2ZUTA 1AKJA 4JJHA 3GTGA 2Q0ZX 2A9NL 4FFTA 4XHQA 2GBUA 4NJ9H 5F7DA 4RISH 4LLWA 2FEDC 5EWIL 4FAAB 3BW9A 2YWYA 4I77H 2NLJB 2FWUA 3E1F1 4PRID 5D9SB 2BC4B 1R3LB 4YL4A 2ESVB 3MRJA 5KZCD 3QH3A 4RNRA 4MDJB 1DUZB 4K9EC 3KHOA 2GJJA 3R1GL 1XWVA 2BFGA 4NZ8A 5DYOB 1F97A 1L3WA 4HV8A 3VD1A 1ICTA 3SY6A 4N24A 4Z3FA 1TJIL 4K5PA 2CLVA 1DN0B 3BAIA 4NS0A 2FH8A 4JDEB 4XVSH 3P73A 2BS71 4F7CA 1OOAA 1E61A 3S3SA 2FLMA 3MAWA 2AK1H 4Z7UE 3RTQA 2I9TA 3SD2A 3SY0A 4HZLA 1KJVB 2VR5A 3QXDB 5F6HI 4QRQB 4GXUM 4M1DL 3EGSA 4HJ0D 1WCBA 4MS8D 3QDGD 1MNUH 2VERN 4JREC 3DMMC 3DI3B 5EO0B 3HNVL 2LR4A 4PJ5B 1N26A 3RWCA 2CK2A 1IRAY 2VW7A 3OPZL 4XMXA 5D2LF 3C09B 4WSKA 2WK2A 5KYWB 2NY0C 4L29A 1M6OB 4I18A 4NBZB 3L3GB 2HH0H 3T0EC 5E99H 4JQIH 3S2AA 3WGUB 1O7SA 5BS0B 1NAKH 2CE6A 1OARH 3IXTB 3SDXF 3TBYA 1PNCA 5I75B 4Q0XH 3VXSB 3ZRCC 2V37A 3TC9A 4G6AD 12E8L 2OMYB 3F12A 1RURH 3MJ7B 3OMZA 2GHWB 2G5BB 3ZTEA 4DKFH 5HHME 1SDDA 5KG9B 6TAAA 3US0A 2E3VA 3LKPB 4EOWH 4Z6AT 4KXDA 4IOSA 4RX4D 2O61A 3EOAB 4PGBB 1KFAL 1EU1A 1A6VH 4GXUN 5GGTA 4HUVA 3ROLA 1R1CA 5I18H 4BKSC 3ARFA 3IAPA 4KC3B 4UBDC 1R17A 1BP3B 3DTXB 2VDPH 1UHDA 1U21A 2IADB 4PJXE 1A65A 2DY2A 4U3SA 1I8LA 2K45A 2Q8AH 5AD0A 3RKDC 2C3VB 3KHQA 5I8OL 3QPXH 1ND0B 2FJGA 2ZPKH 3LX9A 4PD4J 4TSAL 1F58H 4PJGE 3H56A 4KX9A 1W72L 5KBLA 1A8JH 2R0LH 2QDWA 5C0CA 1F3JA 1EJ8A 3SDXA 4CVZA 4YS4A 1G7JA 2VJ0A 5IMLA 1N5YH 5KOVC 3KCWA 4PJ7B 4M03A 3SGDI 2YHGA 4HCIA 3T3ME 4N2FA 3TO2B 1MJ8H 5H35B 3TV3H 4PWFA 5SWQB 4TNWF 1CQKA 1JF6A 3FONB 3J2PA 3PWUB 4ZS6D 1V7NH 3W9EB 1WA2X 4XOCA 4ZO7A 5F3BA 4ZO9A 3LS4H 5ID1B 3C8KA 3UTZB 5T33L 4N2BA 2WOBA 1KJ2B 4CMHB 5IB3A 1QKZH 1J86A 2WD0A 3THML 1XIWD 1K9TA 3QI9B 3VYNA 4LL1A 5DJDB 3RVXC 5L9DH 4CC0A 3H9ZA 2R8SL 2V45A 3BVNB 4MB4A 1Y1DA 1ERNA 2CPUA 4ZAKB 1G0YR 3BWUC 2ICWJ 2NW3B 4BSVA 2IC2A 2GHZA 2XKNA 4OCYL 3V5HA 4HGWA 1HILA 4QGYA 3TFBA 4B9YA 5BVPH 4XBGA 4ABWA 3CLFH 1CLZH 2XQBH 1QBMH 5I28A 3BUIA 3DX0A 4GAGH 2YAOA 1CE6A 3P9LA 3SGDH 4U2YA 2VZUA 4L4JA 4M6MH 2ADYA 5KVFE 4OKDA 1JTTA 5D70H 3B1TA 5DUPH 4BINA 2AK4D 3QEUB 1NGZA 3BKJH 3TIEB 5LNEA 1H15A 1VFMA 5KUKA 2Q86B 5BZWB 1J8SA 2VQUA 2JQMA 4BHUI 1XT5A 5EUKB 1E28A 3OHXC 4XMPL 4CKVX 1NCIA 1SXZA 5JIQA 6FABH 5DRWA 2ZCKL 2K3TA 3P2TA 3FYEB 3WFBL 4NBXB 4WSJA 1NMAH 4PVBA 3KXFB 4JKKA 4HC1A 5ALCL 3P4OB 4G9DB 3U7YL 2QSTA 3GBLA 4GAYA 2XVBA 2AKRA 3EJRA 3KR3L 4NGHL 1PTZA 2XXFA 3FQ4A 3K8LA 4U3XA 1WBXA 3TWYA 3D39E 4OLXH 1PJWA 4NQCB 1FYHB 1QSFE 1QWNA 3VB8A 4FNUA 5IB5A 3E6HA 2XWZA 3KPPA 2C5DC 3T65A 3WTSA 1SGKA 3CIQA 3SBWA 1GOGA 4F7EB 5E2UH 2WANA 3GXUB 5K93A 1GJWA 3LKRA 4QHLA 3TURA 4B60A 2MCPL 1IGTA 3T1FA 3VFUA 4I3GA 2EDBA 5T5ID 5F7NC 1VZIA 4FZEH 3U7WL 4F2FA 1YC7A 4LVNB 4TSBH 4LHUD 4PJAB 3FQWB 1VSCA 3IMRA 3GRGA 4ZMYA 4N2DA 3T6WA 1P69B 3D1MC 3EJQA 2ZCZA 3VFOA 3GSQA 1T2QL 1NGQL 2XJKA 4FHJA 2CDEA 4RVBA 5DJ0A 1WZAA 2WNKA 1ZSDA 1YVLA 1TETL 3QZPA 2X4PA 3ETSA 3IDMA 4D3CL 2WN3A 4HPYL 2VXSH 4JDVA 4UV4L 4GW5B 2VDKB 4UINH 5IOKA 4ZOCA 3QJRB 2M1KA 3HE6A 2XZCH 3JWNG 3K1KC 3AB0C 1MW3A 4WHCA 5BQ7A 4CILA 2WO4A 1Q72L 4FERA 4JDZB 2A69D 3ETTA 4XVJH 5KZCB 1FNHA 3N1MC 25C8L 2FBJH 1EO8H 3VDCA 2WLZA 5T5MD 4FI7A 5TPWL 1R3KA 2QSCH 4DGWC 3BPCB 4Q2ZA 4ZD3H 5B6CA 2VQ1A 3COOA 3DHUA 3LNFA 5EUOB 1XF1A 1JP5A 5HHVL 5C07B 5JR1L 4GW4B 5K9QG 4FQ1H 3D9AH 2W81C 3MUY1 3D39D 5KS9E 4NXSA 1RERA 2YSSB 4E9RA 4L2LA 3CFIC 1JIBA 5PAZA 3ZE2B 5AYQA 3DMRA 4OJAA 4PRAA 4W9FC 4K4KA 3BH9A 4L5FE 1DLFH 4LAQL 4DVBA 2NY6C 1DJHA 2VJXA 5J5EA 4TLUA 4N9GB 1P2CA 3EZ8A 5ESQA 4YJZL 1RFDH 1PD1A 4AL8C 4IGBC 3F7VA 1X9RA 3GD1C 2TRHA 4CN4A 4AYFA 1NDGB 2BSSA 1HDMB 2NXZC 3VD9A 3KNBA 2ZIDA 4FQQA 1DQVA 1SVZA 5CP7A 3LKSA 1HZHL 1C9SA 3ILPA 2F0CA 1LEGB 4PSRA 4KROD 2NY0B 1VZGA 5KYUB 5H4YA 3DWTA 2OCFD 4H8VA 4MA1B 3NK4A 1CD1A 4V2CB 2GT9B 4A7SA 3IE9A 4KJQC 1QTSA 1PX8A 3U30C 3ZE1F 1EZLA 3QDHA 4GMTL 4OGXH 4OLWL 2VN4A 1E42A 2XG5B 1WYJA 3WJLA 4AM0Q 3MMEB 3BP7A 1BIIA 3G6AA 5DWUL 3HZYB 3SDCC 1NCUA 1T0MA 4KVCL 3GMOB 3FH7A 3ZTDC 1FYTE 1VGEL 3TWCL 2E7CA 1N59A 2Z8RA 3JSSA 4KRPD 5GS3A 1RUKH 1BVNT 1KB5A 4G8GE 5IJKC 4U6VH 1S8DA 4BUQA 5ICYB 3VQLA 3Q43A 4ORGA 4N8VA 1GY2A 5GRUH 4LARL 4PJFF 3VFPB 1NEZB 2NXYC 1GHFH 4E9SA 4KJPC 5CKGA 3UTPE 2WZAA 1U8CB 2BOLA 4RMQA 1RULH 1VHPA 2DQCH 3PDDA 3HRPA 1T0NA 3PQYA 4WWKD 3SO3C 3OAWA 2Q1EA 4OI8A 3ARQA 4A2FA 1JV2A 2BCKA 5F1SA 4KAQH 2VW6A 3EOBB 1JK8B 1CGWA 1WISA 4WO4C 5D7IE 2CD0A 1U42A 5ABAA 5AL0A 2MTAA 2CR3A 3SPGA 2X6AA 4YDJB 5TDPB 2Y1VA 3QJQB 4XCYB 3BKCL 4S1DC 3K6NA 1QRNA 1JK9B 2CBPA 4UCFA 2G5UA 1J9QA 1N2RA 2YEZB 1MEXH 3HZKA 1UQSA 1VPOH 4R90L 4U1LA 3V10A 4FXTA 2HAZA 1ILUA 1B4LA 4Y5XB 3QDME 3WL9A 1ZCRA 5JXED 4U7MA 1MHPL 1DL7L 1L9NA 2K4AA 2W60A 3BUDA 3UMNA 1EXUB 3DROB 3DIVA 5I1AA 4HUUA 3MPCA 1E4XI 1JN6B 2VXTH 1QBAA 3L9RA 4PJFA 4AEIL 3OKKB 3HG3A 1ULVA 4UT7H 3G5ZA 1FYTD 1LQSR 2R1WA 3FF8A 3S36L 3HFMH 2G2NA 5IVXB 4FQHB 5EU6A 3D6GA 1IC7L 4G8GD 5F70A 3VRJA 2AJYL 5L88L 3QP3A 4N1HB 2DBJA 3UTOA 2AJVL 1R9TA 2YPLB 3OB0K 2IIJA 2P8MB 2WVVA 5GS2H 2R92A 5GSVA 3O6ML 2DYPD 2E9BA 2BDNL 3HCVB 3HEIB 1SJXA 4FDWA 3UJJL 2D7TH 2CJUH 1PQEA 4NO0B 3KCPA 4MHHI 4X7TA 3MNWB 5HHXL 4XRCB 4Y4KD 5CINH 3ZKSD 5T3ZD 1P1ZA 3MUHL 5AL8A 2AZAA 4Y1AA 2QVMA 2NYAA 2AJUL 4B27A 3I9IA 1YEWA 5LDUA 3LEXA 1HCFX 1E4WL 1ZIBA 3MLYH 1Q9WB 3NQIA 1A6WL 1SEBA 3KGSA 2GB2A 3QK0A 4PW9A 3MV8B 1JGDA 4ODHL 4Z76B 4JPWH 4J3OF 1E2WA 4EUPH 3EZJB 4AAYA 1XHHA 2AK4B 3RG1C 2PW2A 2YC1B 3RDTC 3RGVC 1JGIA 5D1ZD 4DKEL 2NW2B 4E9VA 2X41A 4QTHA 3CQZA 2RALA 2WBJB 4UZGA 2FIKA 5FKAB 5CEZE 3EGDB 3LRLA 3OHXB 3QDMD 1DSFH 3OJDB 3JYBA 2XPZA 2X2JA 4LLAA 2JA6A 4R7NB 4MXWH 1XH3B 4DPBX 3QUXB 3IS0X 2JVUA 1KUMA 3D52A 4LPUA 5IMKB 5C09E 1MW2A 5F96H 5D7JC 1JBJA 3ABGA 1XL4A 2PCPB 3PGCB 4S1SH 1IIKA 1TQTA 4TUKH 5FFGA 2HT3D 4YFLI 3BYTA 5DD6B 1AMXA 4DWHA 2R93A 1NFDE 4HKBB 5FX3A 3ZXAC 4JRXB 1R5WB 3DRQB 2F8IA 2SEBA 1FE8H 5ERWA 4E36A 1I8AA 3PF2A 4UIKH 2Y7LA 5DLMH 1A9EB 5IB4B 4QRTA 2XZZA 1TSHA 3QUZD 3BAEH 5D6CA 3STLB 2GPZA 1FC1A 4Z8FL 2EH7L 3WKMH 4MAYC 3WYRA 3DLQR 3KYOA 4K0OA 5FO7B 1XAUA 4GKZB 4FQCL 4H13C 1EFXD 1XGRB 4KQ3H 1OGPA 1JZ2A 1XF5A 3QJXA 3F85A 1FGNH 2AF2A 3FT3A 2B3IA 3OAYK 1A7OH 5EBLB 3GEFA 1ZHLB 5GZNC 3T4YB 2VT0A 3DPBA 5I5IA 3I6KB 4OUOA 4XP9H 1RJCA 3ABLB 2HLAB 3KYMB 3MOAH 3QDJA 1NIEA 1A3LL 4AG4H 1P4IL 1PW3A 5CEZD 3E9UA 3BZFA 1UD5A 2Z93B 2A6IA 3IF1B 5EMYA 4I3RL 3VXNB 3ASOB 3P3RA 1M7DB 1LHZA 1DDHA 2V9UA 3FTXA 5C09D 3S4SA 4G43B 2H1LM