4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
2G5DA 2BH0A 2PICA 3ENGA 4JP7A 3SUJA 3CZBA 3X2OA 4FG4A 1WC2A 3SULA 2JNZA 3SUKA 2PNWA 3X2LA 5GLYA 2KQAA 4FERA 5H4UA 3X2JA 1BW4A 3M3GA 4AVRA 2VXQA 1L8FA 2PI8A 3X2KA 4JP6A 4FG2A 5GLXA 1WHPA 4JJOA 5GM9A 1OA7A 3SUMA 1HD5A 2HCZX 3X2GA 4JS7A 3X2PA 3X2NA 1OA9A 2G6GA 4FFTA 4L48A 2AE0X 2PJJA 3X2IA 1BW3A 2ENGA 3FT9A 3X2MA 3FT1A 4JCWA 3X2HA 1WHOA 2GAEA 3D30A 4ENGA 1BMWA 4ZM7A 1N10A
chains in the Genus database with same CATH superfamily
4JHBA 3EUUA 4U1LA 4Z7UA 3OWEA 3QEHB 4ZPVA 3B9AA 5JUEH 3TM6A 1VPOH 3QUZB 3V5HB 5I75C 3KS0H 4AVHA 2ZIDA 3CBRA 5F72S 4W9IC 5K9QG 4F3FA 1Q9OB 2Y5TB 2QVMA 2VDQL 4XPFL 1R1CA 3C5ZD 1VESA 4PWGA 3EO1A 3RY6C 3U46B 3U30B 1R5IB 3O4LD 3V6FB 3F7VB 3VI3B 3OC8A 5LAPA 3SGEH 4S1QH 3HI1B 3UTQB 2FECL 1S7XA 1E32A 4QRRA 3HCVA 3VU2A 5DK0B 1MZYA 3ULUF 1NGWA 3DJRA 1L9NA 3FF7A 1KCUL 2VSDA 1SMYD 4Y4FB 4MJ6B 1BZ9A 1QSFE 1PX3A 2UXTA 2VT0A 4JFZH 1HN1A 4XBPA 4JDTL 1IQWL 1X7SA 2ZG1A 1JDAA 1IEBA 3NGBB 3GUFA 4QYOB 1KWKA 4KJPC 2AI0H 2C3HA 3HNTL 3I6SA 4Q14A 3FQTA 2DIEA 1S7VA 4ZAKB 4JFQB 1HOCA 3GC3A 4GRMB 2VMDA 3BAXA 4Z7WE 4QAWA 3U7YL 4XN1A 2R39A 5C08A 3E9UA 4KJYB 2IH9A 2Y5QA 5F1IA 5AVXB 2R56L 3ZXAC 2L7UA 4EUPG 4BSWA 3BZDA 4OZGE 1VSCA 4HUXB 4GRWH 1CI5A 1X5KA 1ODAA 2OMNA 5ESQA 1XV8A 2J1ZA 4HZLA 1UFGA 5ESVB 4N3UA 2KQAA 1V7MH 3F05A 5T5FL 1GIGH 3CHQA 1DJXA 4WO4D 4NFCA 4JM2D 4PEEA 1UB5A 1FL3A 1R3HB 3L95B 4OLYL 4OW6A 2Y2TA 5DURB 5BZZA 3ZE0B 4XP6L 2BLFA 5ITBH 1QTYT 4Q6KA 1BQHB 4JNXA 1YRKA 4IRSC 1HEZA 4L29B 3O6KH 2EVFA 1Q0EA 5BW7C 4IDLA 4BZ2L 4D0DA 1S7RA 4U1MA 4P46D 1S5HA 1E8XA 4XGZA 3QPQC 4NUJB 4NZUL 4UOQA 4F33A 1ORSA 1XGPB 1CICB 2WGXA 1HHHB 1KENH 2YOCA 4KKAC 3VCLA 4C59B 4H1LH 3M3GA 5EOQL 5AAWC 3NJFA 4POZD 4HKXA 2R1YA 1OHZA 2PTUA 2NVYA 3ARFC 4S1DD 3U4AA 4LGPB 3EOAB 4Y4HC 1JZ7A 3H85A 5D2NA 4X0NA 4Y5XB 3K6FA 4KZDL 5IHHA 2QADD 3I9IA 2NXZB 2YWYA 3BFWA 1GH7A 1BAGA 1ZAGA 4C4BA 5HDLA 2HT3D 4PHXA 5FOJA 4M8QA 1IAOB 4X6DB 3ZX1A 4KRPC 3V5DB 5J3HD 1IAII 4KKPA 1MPAH 2E59A 4ERSL 2CRMA 3DI2B 2DW5A 4KDTC 4PJBF 1SMOA 2IAMD 3CU7A 3O6FC 4P2OD 3L2LA 4BE6A 2GK2A 4IRJB 3RY5A 4PGJA 5EEVA 4JRYE 2JQZA 3OKMB 1FFNB 1TIUA 3OKDA 4AM0B 1OAUL 1GTNA 1OHQA 2ZP8A 4Y16D 2J5LC 3UL4A 4LEEA 2NRDA 3G5YB 4BCYA 2WVSA 4MRCA 1FZJA 3E6HB 1Q4NX 1AHWC 4LCVA 4ELME 3MODH 3CFEA 5F0JB 5KBKA 4UOW1 4E9LA 1OSPH 2CHDA 2QLYA 4QXGH 3V6ZA 1EZLA 3MRGA 4B5ZA 1TYRA 4AXWA 1LO0L 3RVWC 3VX1A 4PRHA 2UZYB 1YAIA 2NY6C 1JV2A 1KTLB 1WD8A 4JB9H 1I4FA 5E9DD 4HD5A 4S0HA 4ZD3L 2VKXA 4HUVA 4N2CA 3EFFB 5EEUA 4WWOA 3PGCA 5MENA 4LEXL 4HWBA 5LWYL 3S34H 4PS7A 4Y4KD 4HLJA 1SOQA 1OY3B 2JKRM 4IHOA 2WXNA 1IKFL 4NO0B 3PL6A 3MV7E 3MRHB 4ZPTA 1KYAA 3QEQE 2PXYA 3US1A 2L8AA 5FYLH 1AHKA 3BHBB 5TK4A 5C07D 1VRSA 4Y1AD 1T7ZA 3FUKA 3V0DA 3BWZA 2R23B 5DS1A 2NZ9D 3DGDA 3K81A 3KPLA 2M2DA 3ZTNH 1L9OA 2JSFA 3SE4C 1YUHA 1HWGB 2F7OA 4AYFB 3VYNA 4UV7H 4ZFFA 2VM4A 3AXHA 4KI1A 3IMVA 3RLSA 5GSVA 1B0WA 3FQUA 5TE6L 3KPRD 2YRPA 5EZOH 2E7CA 4LSTL 1CIDA 2L04A 3OBAA 3KPPB 1TTFA 3CN1A 3B2UC 4PY7A 1EWHA 4GY4A 3DVNA 3KBPA 5F97E 4Z78B 3NSJA 3LQAC 1WF5A 4IIQC 3TF4A 4HVBA 4OF7A 2G0KA 5EUOE 2W80C 3VRLE 2NXYC 5SV3A 1F3DH 4NM8H 1LQSR 3OX8B 3MLTA 2R2BA 5GS0H 1TVHB 2NX5B 1G5AA 1JPSH 4AT6B 1X5AA 1G7JB 5EOCJ 1CGYA 4K7FA 5HYQB 2UY7A 3PFUA 2D73A 1G7HA 3H3PH 3JVGC 3HN5A 4MQXD 2NUTB 4JDEA 2YD8A 1EX0A 1OAZL 2NT1A 2W0PA 2AJSH 3BO8B 5IB1A 4YR6A 4F8OA 1M71A 2HJFB 4LSSH 2GTWA 3MLSL 5EBLB 1A65A 4DCQB 2DMGA 3F3HA 3PJNA 3M1BB 2ARJQ 3HVNA 3GFUA 1CLOH 1HNFA 3QT2A 3FQNA 4QJ3B 4KUZL 2XACC 1JHLL 3BEVA 1ZPUA 3MMEB 4KKLD 1N5AB 3UC0L 1CLZH 3UG3A 1NCBL 4XX5A 2DQUH 3G5ZB 4G2AA 1NMCB 1GYVA 1FN4A 1Q0YH 1N18A 1VACB 3NIGE 4Z7OF 4NWTH 3HZ3A 4RDQG 3WTWA 4Z7NE 3C08L 4R0LA 3FL7A 5C0GA 3QIUB 1PS3A 3I9AA 1MCOL 3PWPE 5DR5L 5C0IA 4JFDE 4R7NA 3TO4D 3HS0A 3WY3A 4DZBA 2B0SL 2D3JA 3WIHH 1TJIL 4AUJA 1NC2D 5DRWB 1CT8B 4LCYA 5I17B 3PDDA 2WN2A 4YWGH 3IT8D 1QFUH 3GRWH 2EYRA 4QRBA 2TRHA 4P5SA 1R4XA 2BIOA 2X3BA 2D31A 3FFCD 3FUFA 4Y9FA 5D1QA 3TCXA 2IADB 1EZVX 4YN3A 2R2HB 3JVFC 2JELL 4QHKJ 4KMTL 4DFIA 4DT2A 4PJ8C 4HW6A 3QUXB 4ZQTA 1DFBL 4QF1A 4GKZB 1RIHH 2FQFA 4E41A 3HNVL 4AENB 1SRDA 4ZW6A 2Y07L 2JB6B 4J23A 2JI2A 3I3BA 5JQ6H 1BWWA 1YYMH 3QCUH 4DK3A 1S9KC 4G8GE 4GI6A 5FYKL 4GRLD 2YSSB 4GRWE 1TXKA 3KW7A 2I69A 3DGGB 1P4BL 4H25B 4PJGA 4YHMH 2IANA 3RNQA 2IGTA 1PFOA 3FTWA 5B8CC 4MA3B 5DLML 5BRZA 1KC5H 2Z31C 5F1KC 3I84A 3O41B 4NZTH 2QVKA 4X7TA 4NRYB 3VACA 5DHVH 4J8RB 5FKAB 4A7TA 3UZEA 4A55A 2VMFA 4HLZG 4N2GA 3TT1H 2CUIA 1MFBL 3FQRA 3NOIA 4GO6B 3JV6B 1K4CA 1JNNH 4LMQI 1ZT4B 4M7ZC 3QFDB 1I8UA 1M6OB 1Q94A 2WCGA 5AEAA 5HYFA 3WJJC 5I1KL 4I48A 2DMRA 1PCXA 3EZJB 3HNSL 1LDSA 1BVOA 2Z8SA 5HDBF 1HESA 4KROC 5CILL 4RWYH 5JW4Q 2UZIH 1FGNL 3Q5TA 5FA4B 4HIQA 1CL7I 1XTLA 3DTXB 1FL6B 2OZ4H 4CMMB 3K6SB 5L8JB 2R4SH 4GB9A 3WNIA 3CVBA 4OCRL 5B7MA 2BHYA 5DEGB 2F8XC 1K72A 2O5NA 1YEKH 4CVZB 5E2UL 3AADB 4FQ1H 3KBEA 3KBHE 1VHPA 3SY6A 1H8NA 1TSRA 3GHBL 4HZAA 1KEMH 1KGXA 4PJHA 1Z9OA 3C60B 3WE6B 3RWDB 5KSBA 1CIUA 3DRQB 1I8MB 3EXJA 1ACXA 4NRXA 5IV2A 3ULUE 4PS4L 5E1AA 2WZPA 2V6HA 5C0RH 3IDJA 5DGRA 4DP8X 5J8OA 4NO5B 2A9DA 4ANXA 3V4PB 4ZT1A 4WWKC 4PJ5D 3WI9A 5HSFA 3CC5A 4WJG3 4A7QA 2P42B 3MRNA 4KK9D 4XVJH 1BZQK 3RGHA 2ICWI 1A6WH 4NUGH 3O4LA 2RACA 4O02H 3SCMA 3UTZA 5FO7A 3T8MA 4WWID 2OM5A 4P23C 4LF3B 2Y4SA 7FABH 4Z7AA 2PCFB 25C8H 3G3LA 5C6PB 2WHVA 4XC1H 1P0SE 2AJ3B 2ZWNA 4G9FE 1RJYB 3MV7B 4MNQA 1YNTA 3SZKC 3BKML 3X12B 3MRBA 3QI9D 4NAQA 4X8JB 5I8EA 3P77B 5IBTH 4I9XA 5DEFB 1BFVL 3MKGA 4QTHB 3H7LA 4I9WE 1CYXA 1M05A 3HFFA 4PVNA 1XH1A 3CNKA 3M07A 3UYRL 1E5ZA 2DF3A 2V9QA 4NQVA 4F7TA 2DLEA 3FHQA 4DO4A 3KYKH 2OZNA 1T1XA 4TUOB 3ZIYA 5LGJB 1U8OB 5D7IF 5SWSD 1XGQB 2I5YH 2NY4D 3GSNL 5G2NA 3WMQA 1AR1D 3CFBA 4H26A 1WWWX 3MACL 2VQUA 2X4TB 4Y9BA 5C18A 4MX7A 4PRAB 3TBTB 1RFDH 2BSED 1NIEA 2MOQA 2OYMA 2IBGA 2GTZB 5C0BD 1I3VA 1WAEA 5J57B 2D7OA 3WEMA 1R75A 1W0WB 4Z0XA 1KB5B 4LOUD 5IFJA 4NIKB 1UM6H 5CCGE 5EUOB 4KKZA 4UINH 1EMTH 3SYQA 1B4LA 1I7RA 3LNFA 3LDBB 3REVB 3ISRA 2DWXA 4YK4C 1M6UA 4P46A 2XTLA 4D3CH 4AEFA 4LU5H 1GZQA 4LDEB 3GMPB 3NYKA 4X4ME 4F7PA 4DOHE 1IKNC 4GT7A 5T1KB 3PG2A 4LSRL 1K4DB 4DN3L 2PCPB 2Z92B 5M94B 4ZMQA 2LAGB 4KK5D 2XLLA 1PQZB 2G5BA 2CIIA 5A2KH 4J2XA 5JIHA 3QFJE 3S3DB 3GSOA 1D7DA 4HG4J 1YEFL 5F88B 3Q9QA 3ARBA 4YDIH 4B9PA 3ULVD 1ZLUH 4PJBE 1IB5A 1XIWC 3MV11 2XVGA 5FECA 2X6UA 2ZX6A 3NIGB 4HPYL 4JJHA 1DQIA 5JQHC 3EZ8A 1NJ9A 4K3JL 4UCFA 2BMKB 1VAHA 2VLRE 4Z7NB 2CBMA 2FBOJ 3H9ZA 3HG4A 1IFGA 4WV1B 3J8F7 3LRSA 3PWPB 3T4AC 5B3JF 4JFDB 3MXVL 4PRNA 3GK8H 5CP7B 4FNLH 3WJLA 5DHXB 1IM3A 4YLQT 2HTKD 3QRGL 4O58L 2EVJA 3CUPA 4IBQA 2WSKA 5IEKA 3KL5A 3QUHA 4P2OA 3GBNH 4DZ8A 1GCYA 3RI5F 4NZRH 1VENA 4DO5A 3OXRA 3CLFL 3KEDA 3T0ED 4U1SA 1XH3A 2PLTA 2P44B 4JLRB 4MXWL 4B96A 4KNTA 4LGRB 1DSFL 4BA0A 2DQDL 2OL3A 1GHFH 3K4ZA 4HV8B 3TIEA 4XMZA 4ZX5A 4DGWC 3DO7A 2G4EA 2RCSH 2V3FA 2A6DA 2FSEB 1Z66A 4G8GB 2GEEA 3FU6A 3SEPA 3T2QA 4BRJA 1GSMA 4ZUSA 1HI6B 1SMAA 1NWOA 4RDBA 4GRWB 3MGOB 4NENA 5GGRY 1EVTC 1UOLA 3NCCB 4QNPF 2NOYA 3GJFH 5ESAB 3BYTA 3G7TA 5AW5B 1A6VH 4AEIL 4PRBA 2WCSA 4WI0A 1E9QA 1EEZB 1NBYA 2JF1A 5IQMA 4PREA 3S3CB 2DMKA 4ZOBA 3KWUA 5EWIH 2AC0A 3A4AA 4XT1C 4RLDA 3CN3A 4EKJA 1SHSA 3STZA 4KKRA 2WXIA 1NGPH 4KVNL 4TSBL 3I6GB 2ADJB 2EKSB 1E6OH 2ATKA 3K91A 1JG9A 4GH7B 2OXGA 4RGND 1CO1A 4Y1AA 3SGKA 1S9XA 4IKNA 4C4UA 2RFXB 1ZV2A 2VR4A 3FUIA 5CD3B 5C09B 3IAQA 2X6MA 4YO0A 1BW4A 1DQJA 2EYTB 2KZWA 3H9SD 4OGAC 4H1LB 5L0QB 2ZAGA 2UUDH 5K9JL 4I8DA 1RVFH 2W81C 4OCSL 4NI3A 4EDWH 1IBGL 3FONB 4GFTB 2YR3A 2CKNA 4WW2C 1SLVA 3CHOA 2ZP0T 1GOFA 3KPRA 3WS3A 3N9GL 1OP4A 4DEPC 3Q44A 5EPMA 4DK5A 4YNYB 1MFEH 4XP4H 3O3DB 4M56A 3IGKA 2VLKD 3FZUC 4R26L 3O3UN 5E6IA 4HU8A 1D9KC 1I7TB 1NKGA 4GUPA 3WEXB 1E4WL 2R2EB 1JK8B 1UHEA 2BP8B 3WOVA 4YL4A 3L3IA 3PAVA 2WNXA 4ZX3A 5ACZB 1IRAY 3VXUD 1AC0A 2V2TA 1ROWA 3FB7A 4AKOA 3VFUA 3MYJB 3KDPB 3EBIA 4TRPH 4DP1X 2PO6A 1A6AB 3EYQC 5CGTA 4I7ZC 4D0BB 1U93B 1WIOA 1OWWA 4Z7OE 2J6EL 2JXMB 3H6AA 1BEXA 1U8HA 5MHSD 1E9OB 1U58B 3NCBB 4G9FB 2GQHA 1BIHA 1YAZA 2CO4A 3HZKB 1T3FA 5CJBA 4WK0B 2BS8A 1HYRC 2H3NB 1F6AB 3EO9H 2Q87A 1TVBA 3GB7A 4DTGL 2EC9U 3SPIA 5EIIA 5FF6A 3L5JA 15C8L 3P02A 1SFHA 4Y2OB 3WO4C 3WKMH 1I1AD 1KTDA 4WTZA 1YUKB 4L2LA 4DVBA 5JZ7C 3UABA 4YHOL 1HH6B 3CPUA 4IW4C 4HUMB 3BDXA 3R7RA 3PAZA 4ZUUB 4ZSOE 4KJQC 5IJKA 1XB6A 4KHTL 4N6RB 5I15L 5EFIB 1NC2A 3FCGA 4KQ3L 4XMPL 5T1LA 3ZDYB 3DMMA 4D8PA 1BZ7B 3CZFB 3EH1A 2WTRA 3U6XA 4BFGA 1K2DB 1O6SA 1F3DJ 2Z8WC 4KXCA 4XXDB 3WIIH 2F53D 3FFCA 3KW8A 2I9TB 4U1NA 3S8GB 2GUYA 3ESMA 2NNCA 4IJ3B 1AS6A 5DO2C 1FPTL 4TOYL 3MLUL 5T1MB 2DBLL 3VQLA 1R0AH 5F6HJ 3T08A 4AYMC 3EBGA 3SE8L 1T03H 5D1ZD 5GIRA 4F2EA 3CZJA 4JM0A 5IB5B 2C26A 2WQXA 1DQQB 5BZXA 2P5EB 5SWQB 1CD0A 3T6WA 3V6OE 3WUZA 2VXSL 2CJUL 4MZIA 1JWMB 4NNYB 3MV8E 4ZS7H 3PP3H 2P24A 2OW6A 4MDJB 5HDBE 4DOHB 4N6QA 4WJ5A 1KZYA 3V9FA 4AJ0A 1B9KA 3TEXA 3F01A 1KB3A 5ERWA 4XHJC 1D5BB 2YD6A 4PQXA 1LO4L 1QLEB 1JD7A 3O2VH 2OMXB 4X4YB 4PJBB 4N0FB 3STBA 3E8VA 1MF2H 3HU3A 3ILPB 3NZUA 5LBSA 1UYWH 1E27B 1W6LA 3CWGA 1BM7A 1T89A 5EO0B 1BA9A 4IBZA 4PCYA 4AZDA 1IJ9A 2DYSB 4ECNA 1PBYA 3HTLX 1S8DA 3O9WA 2X4UA 5L8LB 2VXQA 2OSWA 4XRCA 4RVBA 4MA8H 2E4FA 4JUSA 4J3BA 1MSPA 5IB2A 4QGYA 1VEMA 2WTPA 1F6FB 3DVGA 2VISA 1AR2A 1NGXA 3CSYA 3NEEA 1EU1A 4YSPA 2W38A 5CU5A 5GSRB 4KK6C 2X05A 5DD5L 4W68A 2QSVA 4GAYA 4FXKA 4YFLF 1UOKA 4N2MA 5TF0A 3GSVA 3OAYK 4HC1A 3BAKA 4WTWA 1AKJD 1QI3A 4UMSA 4XBGA 1TCRB 3OZLA 3DETC 4OAWA 5D7EA 4JMXA 1OAQH 4OJEH 5JOPE 1J0HA 3PWJB 3I3EA 2X1WL 4GMSL 1P7QB 1KBPA 1SJHA 3RVXD 5CLYA 3ECBA 2EDNA 3PDOA 6PCYA 1J05B 3B34A 3ZYZA 3ARRA 4WU5B 3DPBB 3VWKA 5BZDB 1B4RA 3CVDA 1HT6A 4QRQA 3BDYL 4OT1L 1AO7E 2CO6B 7PCYA 1H15B 3RTQD 4M4PA 5JLZB 3FCSA 3PXLA 2CH8A 3AG1B 3KYAA 3O6LL 1KJ2A 3D3VD 4Q4EA 1OZUA 4ICXA 2FIKB 4LFHG 5IKCA 1DQDH 3IXTB 4IOSD 1JYXA 1L6ZA 3IJ8A 1J5OL 4TL4A 2IALB 3GS7A 3QCVL 4IIZA 1KDIA 3FUDA 1P9MC 5EG6C 1PCSA 2B3RA 4MAYA 3INUL 3L3GB 2R4RH 3O0LA 2YKLL 4QY8B 5KEZA 5FTNA 1XR8B 5DHVB 3O6ML 5J1AB 4MJID 4JQVA 3WLWC 3WL9B 2KDYA 1JGIA 4Z3GA 2J4WH 1SJMA 3LV3B 2BOBA 3KL0A 4HWZB 2YPVH 1QNZL 4JY6B 4B53A 5EHFA 1HSBA 2YEZA 1MHHB 1JJUA 3M17B 3G6DH 3D39A 5FM5O 5FUCE 5IHZA 3ZZSA 4OUUA 3ARGB 3IDGA 4EF3A 3GLEA 2MPVA 2QKIA 3B2VH 3BOVA 3RKDC 1OCRB 5FYJL 1C5DB 4HX1B 3CZGA 1LO3L 2GI7A 3H6JA 2A1WH 4KY1H 4NNXB 4HMDA 5IWLC 3QJHA 4ELKA 3F00A 3BPLC 3T77A 4DETA 4LCCB 4A2GA 4TV3A 4KY2A 2KMWA 3CFIC 4EVNB 5A2FA 1P4LB 4Z7OB 3MAWA 2Y1ZA 4Q89A 1NAMH 2Y36H 2DQTH 5HI5D 2ZYHA 2PWFA 3F04A 4N20A 5FKPA 1P1VA 2GJPA 3NCJH 5C6TL 1CBVH 1CGXA 4WUKH 1JZ3A 3O4OC 4NKOA 5GZND 4AIXA 2XPGA 5JHDD 1T66C 4U6XB 3BWSA 2WAQA 4QCIB 3B9KB 4O02B 5FYKD 4XNYH 3OPUA 4NSKA 2J1WA 5T33L 3BVVA 3DX7A 4ZSOB 1MCCA 5JTWA 1VFBA 2ZKYA 1DVZA 5TH2A 3X2OA 3SO3C 3SQOH 4AL8L 3WHE0 3QS3A 4G5ZL 2JA6A 4YHIA 1C12A 1JDDA 5KBNC 3EYSH 3AM8A 3OKNA 5BXFA 5CBEA 3IF1B 2WKOF 1GC1H 5BOZG 1EGJA 4QNPE 3H42H 1AVAA 2Z7WA 1N6QL 3L4WA 1JTTA 5I0YA 1YECH 4PLJD 3ESNA 2LT9A 2CE6A 3NJKA 1N0LB 3TEWA 1HCFX 4JL2A 2FH8A 2K8MA 1J18A 4FP8H 4V33A 2PICA 1U21A 3OGCB 1BIIA 1BX2B 2R0LL 3BLKA 1VERA 3TFKD 3Q2VA 2JIRA 4LHUB 1KLUA 3MV8B 5D7JB 3PJLA 5JA9A 3KPSA 3ZDZB 5HDBB 5HHQB 3P3YA 1GAFH 3PHOB 4KDVA 5CCKH 3MJ7A 4XR8C 4WHCA 2VR3A 1F90L 1DBBL 1GS6X 4XWGL 3SZ6A 1OB0A 2E4TA 4YX2L 4JRXB 5IB4B 1AZNA 2GJZB 2ADGB 4OKVB 5GGVL 2WO3B 3GLAA 2AAVA 5GRJH 1PNDA 5F7KC 3B7YA 4EUPH 1QDNA 4AITA 1BQUA 2G3NA 2VR9A 3RYMA 4AYBA 2GITA 3T8VA 4R7DA 3TA3C 3H7BA 4F2MB 1SDDA 5JHAA 3TBWB 1TT6A 5MERA 3C8KA 3ML8A 3ZQXA 3CPLA 1I9RH 1XSOA 4PVBA 2NY3C 4J3VA 3F85A 4C56E 5I19H 4FXGC 4M43L 5I8CA 1DN0A 1EHLH 3J7HA 3NPSB 4QXTA 4WIQA 5AUMA 2VMJA 1X4XA 1XTMA 2C34A 2ENGA 2BJMH 3U25A 1LD9A 2CQVA 3ZDWA 3M86A 5E0FA 1CXLA 3QO0A 2XICA 4LESA 5EUKA 3T4YA 4I77H 1CLYL 1FH5L 2ZUVA 4F8QA 1T5XB 3RY6A 3HS9A 4WTQA 3TX4A 3RIAK 1J1OH 1HXKA 2AGJL 4XBEL 1IGCL 2GJ6E 2OS7A 4IDJH 2QZ5A 1CGVA 5ICXA 3IR5A 1HXYB 4L1HA 2BDNL 5DFVC 4DAGH 2G2RB 1OO2A 2XN2A 5DVMA 2R1WB 1PQHA 5D93B 3QGVA 4U3HA 3FB5B 4DW2L 4EBQL 1M1XB 1R3LB 3HZVB 1Y0LB 1I8IB 1NGZB 1X5YA 1IW7D 3CLEH 4I1RA 2GIYA 4H8VA 3CSBA 4BGDA 4AH2A 1U2HA 4GAAA 2YGPA 2NYYD 3KPNB 2JKIS 1QBLH 3PWNA 4XPTL 3GJFB 2GUOB 1U8CB 4W9HC 3GTTA 1MFUA 4PJ7F 5LXGL 1FLRH 1GOHA 1S9VB 1FVEA 4LLWB 4BZ2A 4WRLA 4RFNB 3IGAB 4GQ9L 2DD8H 3VXSB 2W65B 1YVLA 4DKTA 1OCWH 4YDKL 1WHOA 1JF6A 1QPPA 3QNXB 2R0KL 2VDOL 4HEPA 3ZHLA 5A3ID 3VE0A 1AP2A 4Q0XL 1XF5B 3QXAB 5DGQA 1WCMA 1RZJL 2DOCA 4DP4X 3CXFA 5GRWA 4BHUA 4FLQA 4RDQF 4ODXB 2YHGA 1ZVNA 2FLRT 4A39A 4IRSA 1PMYA 3NIFB 4G6JH 1U3HB 4XVUD 3W2DL 1NWPA 5BW7A 5C92A 2RTTA 3II1A 1CLVA 1ZLEA 4BXSV 2DMBA 2MHAA 3QARA 2XYBA 3BP7B 1AIZA 3MRCB 3O3EB 3P2BA 5E94B 2XJKA 4MJ4A 4AWJC 2H1LM 1OPGH 2A99A 2P8PB 3OAWA 1TEFA 5I16B 5AAWA 2V37A 4FL4C 4OV6F 5CP3A 3LMJL 5E1HB 3QK0A 2DWDA 4N90D 1UVQB 1KWGA 4P5TC 1XXDC 3ETBF 1UKQA 3AQZA 2VDLH 5B1CA 4Y4HA 2WOBA 5D4IA 4BGLA 5LAXB 3GPEA 3FQ1A 5FO2A 5AW3B 4M5YH 2VITA 3BXNB 1E61A 1XSIA 2IPTL 5AQ0A 3ZYJA 3NBNA 3AUVA 1F42A 2GAZB 1FG2A 3RWEB 4MJ5A 1TTCA 1F2XK 3BI9X 1FHNA 3HBPA 3MBWA 3VD4A 3UG4A 1RD6A 4JO2L 1ZWIB 3LKNA 2ERJB 4KDTA 3WNMA 3EG9B 4P9HH 4IKJA 4PRPA 3O6FA 2NW2A 5F9JB 1JHTB 1SF3A 4QTFA 1VFUA 5K9KB 1NQBA 4M9OA 3ZTCC 5E51A 3MOBL 2HLFC 1B0GA 3U2SA 3QJRB 3BH8A 1JS4A 2BY3A 2WUBL 3R06B 4Y2NA 1WAAA 3GSRB 2P7TA 1AHWA 3PY9A 1U8KA 1AOHA 3MA7B 2YPLD 1OANA 3IDNB 2R59A 1SXBA 3IFLH 3TH4T 1WFOA 4K9EC 4ONGL 1WFTA 3PV6B 3BSGA 4ZQKB 4AKQA 4LAQL 5IY5B 1MJ7L 3CVHL 4LPUA 5FHBL 2EDEA 2ZKMX 1XAUA 3EGSA 2VDKH 4HWUA 1NCUA 1K3IA 4CVUA 2OQJA 3RDTB 1OAKH 2XI9A 2DI7A 5E8NB 3FO1B 4C2MA 4EMZA 4ANVA 5CFHA 1J9SA 3S97C 2ITFA 4YUEH 4UZUA 2HJKB 1DANU 4FJZA 4OVUA 2Q6WA 5GHWH 1DVFB 3HG5A 5FO9B 1AIFA 2J2ZA 3FH7A 1TMOA 4K23L 4KGLA 4LIQL 5E5MB 2VO5A 4K9EL 4U1JB 4ACTA 5ISZD 4I4WA 1WS8A 4P0DA 3GT6A 5D9SA 3RIKA 4KTDH 5A43C 3D3VA 2IF7A 4UTAL 2EXSA 3C6LB 3U9UA 1IVLA 2QMKA 3VH8G 1MG2C 4UQ2A 3TFBA 2HVJA 1VKXA 3FRPG 4OJFH 2VRAA 4ZW3A 2CLRA 2KH2B 3TBYA 1QSFD 5HJGA 3S3PA 3ASNB 2C3XA 3AXLA 4KPHH 1HHIB 1YN7A 1IC0A 1RXLA 2CHWA 4S1RH 4LBEA 1LEIB 1TPXC 1LNUB 1N64H 1GMEA 1DQML 4JK0D 1CZ4A 1G9MC 2I7OA 1TYEB 5ICZB 3JSSA 2WINB 4C56B 1TQWA 4ODTL 2H1PH 4KDWA 1EUUA 4CILA 4WEBL 3WDHA 2A9NL 2B2XH 4CVWA 4NCC1 4IIQA 1FYTA 5D6CB 3NTCH 1N59B 2JCCF 1R27A 2JIQA 1KLFB 1N19A 1P53A 2B9AA 1IQDB 2WBJC 3FT4A 3JTSA 3QWOA 2GBUA 4ADIA 4YXHL 4D8OA 1FNAA 2YQGA 2YUZA 1S7TA 2CJ3A 4FQXC 2Z4QA 1QSVA 4OIIH 1NIBA 1X5LA 2ALAA 4BZ1H 2ZOKB 5JNYB 3V0FA 2HYMA 1F1GA 1VA9A 4LLVB 3UIYA 3VGAC 5JOFB 2FX8L 1U42A 3JVGA 4HLZH 4LVHB 1G9ML 1DBML 3GNML 2A7BA 2V2XB 1K6QL 3EDJA 1V3JA 1MI5A 1KEGL 1RH8A 1PG7W 3QRLA 3VFPB 5T3ZL 3OAUL 2ZWYA 1B9ZA 4J8QA 5JORB 4OGQC 2WYIA 4NQCD 1WZLA 4JFUA 1BF2A 5C0CE 1LQBC 3C5JB 4YVUA 2AXHA 5IR1B 2OMTB 2EH8H 5L2JB 4FHBD 5CJXA 3QCTL 5JW4R 1TOXA 4LLYB 1EFXD 2R1XB 4GEIA 4UQ9A 3RRQA 5HYJD 2OXHA 3CZEA 4UWQB 5DSCB 4L9LC 4GQPH 3CFDA 2J8UB 2IDSA 5F0LB 5KG9B 3K72B 4D0CB 1PJWA 2FX9L 5FGBA 5DC0A 5IHLB 3IBOA 4YPGB 2XNAB 5E8OA 3ARQA 5LNDA 3MUJA 1E9PB 2I26N 3DUHA 1DSYA 4G71B 3ME0A 5E00A 4CAGA 4NPKA 4XPHH 4NLHA 1YQVH 2WP3T 2EXYC 5DJYA 2IBZY 1JGLL 4HT1L 4PJ8A 1G7IA 5HGAB 3D69A 1QFWI 1P7BA 5FO8B 3WG7B 2D4FA 3DOSA 3F7RA 1MJ8L 2XQBH 1G9EA 1J11A 4EKXA 1CXFA 3P11L 1F0LA 1SBBA 1G0YR 4YHPA 3O8XB 3X1GA 3WFEH 3D2UD 3FCTB 3W9EA 2WYHA 2YN5A 3LIZL 1YSOA 3P0VL 4P2YA 1WZAA 2Z31A 1KJ3L 3DIFB 5AZUA 1ZLDA 5TD4A 2A0LC 3GMOB 1NOLA 2NY1D 3HS8A 2LAAA 4QXUL 1I9EA 5JIKA 3VFRB 5AAPA 4GG6A 4IEFB 1IT9L 5KANI 1VGKB 2EVIA 2OK0H 4QRPE 1MLCA 1DUZB 1X44A 1TJHH 4MHHI 3EJYD 1NINA 2J1KA 3NA9L 5DLLA 1QA9A 1JUFB 1MCEA 3HG1D 4G7YH 1JTOA 4UILL 5CINL 1ONQA 2IH3A 5CLWA 4JKMA 4KJWC 4EDXB 1B3JA 3LH8A 1MCBA 3OXSB 1CG9A 1L0XA 1RPKA 4PD4J 4Z95H 2MOVA 4NPYB 1RZFL 1Q9LB 2FD6L 5D55A 2F61A 2FYYA 1E2VA 1NCWL 3H54A 3NRQA 3NZHH 3P4OA 3AS2A 5KN5A 2P26A 2QGBA 1NFDF 1NAMB 3US9A 3OKYA 1NL0H 2VUYA 5DHYB 5TK2A 4DKEH 4M1DH 3N85L 2FLMA 1NFAA 2WLYA 3HC0A 2XN9D 3OKKB 3AY4C 1GGYA 3KCWA 4O4YH 5HHPB 5JHBA 2PP8A 3TVMD 1RHHA 2D0HA 35C8H 3OJDA 1R5WB 4PJ6A 4AZ8B 5IQNA 3OR7B 4Y2DC 1QEXA 4DQOL 3VWJC 3NJNA 4N9GA 2DDQL 3UBHA 4WWKA 1C16A 4LRIC 4NZFA 2ZXQA 3M45A 3HB3C 1M7XA 4WFFD 1E4XL 3PHQB 4LL9A 4M1CD 4EI0A 1IGMH 3GSNA 4O2CA 2QHRH 3KWWA 3GTQA 4P23A 2HPTA 1FHGA 5I1HL 3TZVB 4XZUB 3ZOAA 1D5IL 1P5VA 2DQJL 2E0PA 2HJLA 5KYNA 1A2YA 3WAJA 3H2WA 4PYGA 5BO1L 3B2PA 3AMKA 5MEQA 4PJ7E 1MRFH 3OPZL 3S37H 5I9QC 5FGRA 5CWSB 4ZMXA 4ZTOH 5MEOB 4ACPA 4QHNB 1KJVA 1E2ZA 1AS8A 4TUKL 4TVUA 3QQ9C 4M93B 5DQ9B 1O7SA 3GQFA 4DMRA 2CPCA 2VE6B 1RI8A 3QNYB 1PQEA 2APFA 3WFDH 1J8HE 1CFNA 3FB8B 3IFNH 4HG4K 5DU7A 1T1ZA 3VNYA 3RPBA 4X0KA 5CGYD 2APTA 3CXDL 1PEWA 2HX8A 1CFSB 1QSED 2EDFA 2VMCA 4MB5A 4TNWK 3FOMB 3QISA 1R3JB 1TLKA 4JQXC 4XN2A 2XWBB 2CHNA 3MNVB 4JG1H 1NUGA 1CXIA 2CD0A 3RVUC 3TF7C 2YMXH 3GLZA 4MJ2A 4X9HA 2CXKA 4GW4A 4X80H 4EUPB 3LS4H 4MMXC 3MROB 5F0PB 1YEJL 3MJWA 1JMXA 1JWSB 4M9PA 5EO9A 2VZVA 5H8DA 4JPIB 5CIPA 2GSIB 2WYZA 5HHXL 4YVNA 4JG0L 1UKTA 3WE1A 3SDCD 3VSUA 5BJTA 1SYVB 1KIRA 3DGCR 3HE6D 4LAJH 3KVDD 2MFNA 1OM3L 3GI9H 4HEME 1YPZA 2A6ED 2ATPA 2OKMA 3RZCD 4RFEB 2W88A 3ARDD 1QUNA 3FO2B 4NJ9L 4MD5A 1RQ5A 3GSQB 1DSWA 1U2YA 2O5ZL 2N01B 3A6CH 1MRDL 3GSWB 2AMGA 1PG7L 2BFVL 1SHWA 2VUKA 1S7QB 4NP4L 3BT0A 5F96L 1L6XA 4GAGH 4WU7B 3V4VH 4B50A 5J7CC 1KIQA 2VXTH 2BHFA 1VJSA 1IGFL 4LNVA 3VXTB 3IN0A 4ZXBD 1XIWA 5C0CB 3REWA 4AGNA 3A47A 5DYOA 3OHXC 5IMLB 1S46A 1I1CA 1J9TA 3X2QB 3HBGA 3HI5L 3T4AA 3SDAC 1CGSL 4LCWD 4KXZH 4RZCA 3O11B 3TU6A 2HN7B 2WXMA 4GXFA 2RBLA 3GEWB 4H88H 5TE4L 4Q2ZB 3F2LA 3SE9H 4UU9A 1EK3A 4XAKD 4H8WH 4L8DB 4RGOH 4JZNA 5BV7L 3B5HA 1MCLA 1NM4A 3F6JA 5IJVB 4YFLI 4O9HH 2MCMA 2IAAC 3DHMA 3FSAA 5EN2B 3MGTB 4AYDC 2YPLA 1UGKA 1RU9H 3O2WL 5AZ2H 3QUML 4HISA 4WFHD 3OZKA 3VDAA 3RPIA 4Z76A 2D0GA 5INCA 3V8CA 4JFOB 1SY6H 3R8QA 5DJXB 1AJ7L 2MTPA 1WEJH 1V3LA 2H41A 3MJ9L 4UAOC 3RG1C 3CFKB 5HHOD 3AU1B 4L4VE 2DV6A 3BZFB 4DP5X 1T5WB 3CK0L 1KN4L 4W9JC 2YGNA 43CAA 1RLWA 4HPOH 1YYLH 3ULUD 4J3OC 3ZYIA 4P4KD 4WI7A 3UZQA 3L5WA 4KXAA 3VFMA 3S35H 2Q76B 4AGLA 1O6VA 3G5WA 2O6DA 4J1UB 3BCDA 5E8PB 1T0NB 5ISZA 4NQTA 5F7LB 3NN8A 2ICEA 3G04A 3VYOA 2OMZB 5A2CA 1AGBA 3BKJL 5KTEH 4IS6B 5J6SA 1CUOA 2VDML 2FO1A 5JXEC 1J87A 2H2PC 3BH4A 4IGBB 4IOIA 5CD5D 2JCCE 3HA0A 2YC1A 5IVNA 2WXHA 3K71A 5T5NG 4FJYA 2B14A 2VDLB 1B90A 3OJMB 3NCMA 2GBVA 2QFPA 4WW2A 1RZPA 2QQLH 3UDWC 4PG9B 1MH5A 3K1DA 1LO5A 1YYCA 5EH1A 3SODB 1DE4B 1D9KA 3VG0H 1MCPH 5EEZA 2EZ0D 4PFEA 1IX2A 1YHPA 2XBTA 3CSFA 3FHEA 2OPCA 3B5GA 3R19A 3BW9A 4IU3B 3D50A 2CBQA 1IGTB 1I9JL 3EYUL 4HIHB 3EJQA 4CNIB 4L18A 2P80D 2EDQA 2HKHL 1NUFA 3UTTA 5JPMC 4HS8H 1GGUA 3BP5A 4JHWH 1AE6L 5IGXL 4D94A 2BS71 4A1RA 3OKLA 1PYWB 3RVTC 1M7IB 3MREA 3F12B 4X5PA 4XCCL 2E9GA 4QRAA 2G6GA 4Y5VC 3UJTL 1O6TA 3GSXA 1UJ3C 5I5JA 2HZHA 2R0WL 2FHBA 1F18A 3E6FB 2GAEA 2HLAB 4KNQA 4M6OL 2Z1KA 1GS8A 5H2BA 4PY8I 4K7PL 2F7QA 1E5UI 1JVKA 2EKJA 5IMMA 3GO1H 1D7BA 3AABA 4HA1A 2VN4A 3G5XA 2MQGA 2X09A 3GMMA 3QJTB 4JHAH 1QWNA 2PTTA 4UQBA 4H0LC 3B6SB 4J39A 4AUUA 1J8HB 1LEGB 2FJSA 5DMIH 5FFLA 3MJ6A 4QHUA 1OAYH 4AMKL 4IK7A 3QFJD 3U0PA 4HCRH 4B6ZA 3PNWB 4W4NA 4G42B 4Y19A 4PJ9B 1PQFA 1FJ1A 5DJ8A 2SEBB 1BAFH 2WJ5A 1CFTA 2YZ1A 2BFGA 2J73A 4RSYA 1ND0B 3QJOA 4NQDE 4PIRF 2P1YA 1X9UA 4MTMA 3ZE1E 3NJXA 3LCYA 4AX3A 4WQOA 2EEAA 3EOTH 4F7EA 3PWLA 2VLRD 2RD0A 5GGSA 5E6SB 3KXFB 1YEIH 4FQLL 1J9CT 4KUCF 5BVPH 3HHSB 3DYOA 3SDXA 5KYUB 4ZDHA 1UCTA 3AFLA 4AQEB 2F58H 4OF8A 3SGJC 5C3IA 4CU8A 1B2WL 3QUZC 2KI6A 1WWCA 5HJDA 3EBHA 4IBVA 5GJTL 2QQQA 1JWUB 1CK0H 4QIWA 3SQBA 3WD5L 1KZQA 1G6RL 2CXGA 1I1YA 2UZXA 4CADA 2JIXD 1Z9NA 3IXAA 6PAZA 3DV6B 4D9LL 3U30C 5G4MA 1Y18A 1GGIH 5DC2A 3W0WE 1U91A 3H0GA 3QDJA 4X6CA 1D3CA 4HK3J 4E9QA 3EYFB 3ZQWA 1D6EA 2QSCH 4GW5B 2BNRD 4GKNA 3KR3H 1NDMB 3SBRA 5DD6A 1INEL 1NFDE 4TSAH 4WI5A 2ARJA 4Y4FC 4A7VA 2OSXA 3EH5B 4PHZA 3F84A 3HG1A 2OCJA 2NNAA 3FCUB 3NGBC 4BH8A 4R4FL 1DJGA 4P57B 3RUGA 3QWRD 3FUNA 1ZS8B 1IV8A 4MQ7B 4NHUA 4LSQH 1KXQE 2KYIA 3PAUA 4O00A 4ZAKC 1VEOA 3U1SL 3N1QC 1O0VA 3C2AL 4CUCA 1LE5B 1G0DA 1KCLA 3L81A 4FMKA 3AGVA 4Y89A 5DDHA 1CLCA 4HIEA 3PPEA 3CF2A 2BINA 3P0YL 1PAZA 1RUML 3X2KA 1UXWB 2BNQA 5KYXB 2AK4D 12E8L 2EO9A 2VXUH 2ZG2A 2X6AA 3EFDL 5AVSB 1FL5A 5H94A 1E0OB 2WXLA 5CJ8A 3SBQA 1YEDB 3OUGA 3KWXA 4TVPD 5ANME 4DNLA 1S78D 5I75B 2R0ZL 2Y2YA 2VM3A 3DC0A 2VIRA 4OI7A 1HH9B 5F8QC 1TR7A 3DDGA 3HC3H 4GKLA 4HKBA 3TCLB 3EOBA 5EC2A 1WIPA 4QOKE 2AJXH 2PR9A 3QHZH 3JXAA 1LTXA 4Y0GA 3V55A 1QG3A 2L7QA 4L4TD 1BLNB 3B2XA 4KKBD 1RSYA 4FQQA 5EORL 4ILDA 1DBJL 2BVPA 3BAYA 1E30A 1CICC 3RU8L 1GPOL 2CKBH 3A67L 3ZKXB 1ES0A 3MRKA 5CAYB 4HEPG 2AV7A 3D18B 5IF0B 4Y88A 3ZRFC 5CS7A 1PZ5A 3MCYA 5HHME 1E42A 3SUJA 2XHNA 2A4ZA 4Y5XC 2L7JA 3KDMB 1HNGA 4LSPH 2VLLB 2NXZC 3V0VA 4F5CE 5KSAD 1PZBA 5FV1L 4GKOA 3D0LA 2JCCB 1ZGLA 5I76A 4O2EA 4JFPB 4MCNA 2F7RA 3WTVA 4R4NC 4X5WA 5IROC 4J12A 1XZ0B 5T3ZD 3OF6D 1OGYA 3L2NA 4AQAB 5J1SC 4OZIF 3BZEA 3VSQA 1A25A 2B16A 2N0KA 1FE8L 3PP4L 3CDYA 3TN0B 1G8JA 3IDMA 3NAAH 4JKPH 1BVLA 3QR0A 3ZYOA 2LU5A 4K2UH 2DQGH 3FF8A 3OKEA 4TLUA 3D33A 4AQ8A 4POYA 1KGYE 5DZPA 5I23A 4XN8A 2EUVA 1FBIL 3F7PC 5INDB 5IWLA 1Y1VA 4OLUH 1LMKA 1ZLSH 3F8UB 2E9BA 1FF5A 4EN3B 4EZMA 4M62H 3ZHKA 3BKYH 3LPOA 3LN5A 2IPUK 4G6KL 4K9JA 3PABA 5DZOA 1T4KB 4RMQA 1RV6X 3KVPA 5HD8D 5D7SH 2NY0B 3FU7A 3VRJB 4FNPA 4PGCB 1Z5LA 4W9LC 4YOKA 1QI5A 4KRNA 2D7PA 2NDFA 4F57L 1WITA 1A14L 2HUHA 3MBED 2OV0A 3BQUB 4ZXBA 2JJSC 2Y7OA 4OD1H 3IMUA 2FHFA 2G9KA 1H8SA 1BZ8A 3V0IA 4HDIB 4L3EA 1XGUB 3L4YA 5AVWB 1TU2A 2FX7L 3IWUA 5AW1B 3LKQB 3B8SA 2H2SC 2PUQT 1MAMH 4PRDA 2WLIA 4MMYA 5I26A 3VYPA 4XAWL 3DIVA 3FTZA 4YXLL 2W95A 3OLDA 4N28A 4J27A 4ODSL 5DS8B 1QYGH 2IOOA 3UJJH 4M61B 5BOPA 3VMOA 3PREA 4P2QE 1H9DA 5I1LB 1H6TA 5D4QA 1KT2B 4LL1A 5KBMA 3ZE1B 1C1EH 4YDLB 3ZKNC 3O3BB 5I18L 4IQHA 5TF1H 1A3ZA 4ZMYA 2AXFA 4G7RB 2K6ZA 4WHTA 1WH0A 1ZVSB 1TNNA 5DWPA 5KZCD 2P43B 4HLEA 5FGSA 5D8JL 4PJHF 4OF5A 5AWNL 1PAMA 2I85A 2CMRL 3QNZA 4JQIH 5CMAA 5MEPB 3ESOA 4N86A 5KSBF 1VZHA 3ATBA 3L5XH 4OJYA 2Z93A 4O5LH 2FTAA 2MNUA 4FQJL 3SGDI 4UF7C 1RUKH 4QHLA 3KH4A 3LEXB 3OVUB 5HHOA 4JKKA 2V7NB 3GJFK 3MOAL 3S5ZA 3X14B 1FQ9C 2VH5L 4DKFL 4XCNB 1NCGA 4G1MA 2ZKWA 5I1GH 2EDKA 2JKXA 5EZPA 3V8OA 3EKCA 4HQQL 4RA3A 4S10A 3ASOB 1SHXA 5AYUH 3IS1X 5HI4C 4FFVC 3KNBA 4TQPA 3G9AB 3RWGB 1REIA 2YAFA 2KLTA 4TLSA 1QEWB 1NFDB 3IKKA 3KAAA 5C08E 5H35A 1EEQA 2CLZB 4XB3A 3WFZA 3AUWB 4N8CL 1Y5IA 2CUHA 3LHPH 1FAKT 3KGUA 3IDIB 1AO7D 3FO0H 4I2XE 1NMCC 5T5ID 1OF2A 1M7UA 2UUDK 2ZX5A 4FXGA 3V4VB 3NFNA 3HUJB 3QIUC 4IOFC 4EZKA 3IU4H 2CWRA 1GKOA 4BRVA 2FQDA 3P9LA 5B21A 3F6IA 3MRIB 4K71B 1MFDH 1UOWA 3LXCA 1HHKB 4P2RA 3V5KB 2GJJA 1JGDB 3MOQA 1A6TA 1DDHA 3Q9PA 4F9LC 5ANMB 2OMUA 2R29L 4HUUB 1EBAA 3OJ2C 4LRNH 3QUXC 1D5MA 4NKMA 2AQRA 2QGDA 3QIBB 1JZ5A 4WK2B 3RWFB 3TEZA 3GUTB 3VXRA 5D1XE 3DUSA 4AOFA 3HMXH 5CUSL 4W6XB 2VDNH 4ALAC 2AJVH 5HPMA 5HY9B 5T3XH 4QOKB 5D2NE 1SM3H 4QJ4B 4WW1B 2GT9B 2GEQA 1XSJA 4TF4A 4ADJA 3BCFA 1PEZA 3MCG1 2DJUA 2LE9A 1PLGH 3X2IA 4NBXB 4GXVH 2X7LB 4LKCA 4WNJA 4HH9B 4MCZB 5EU7E 4WI8A 2L0DA 1AYOA 1T0OA 4HJGA 4XHQA 1AZUA 1BQLH 3RB7A 2VWEE 1EIBA 1NLDH 4X4ZA 1Q72H 3HI6H 1AQKL 5HHMB 5CEZE 5IHUH 1YEHL 5D7LB 2Y6SC 4UM8A 4W9FC 2O5JD 4AVIA 5IVXE 4YHZL 3WSQH 2Z9TA 3QHFH 1MQKH 4GBXD 3NDYE 3CHXA 4MSWA 1QAWA 4YHNB 2QPDB 2JKLA 1M2VB 1SEQH 5E4IA 2Y7MA 4PBDA 4F15B 4JN2B 1ASQA 1ZC1A 1FAIL 4OZFG 1FI8C 4KHXH 1FP5A 2VO8A 5SWZD 4U6HA 5JW4N 4X9GA 1UA7A 4U1IB 3WXWH 4KTGA 3VFWA 4WK4B 2P9RA 3X13B 4FQIL 2B4CC 3S3BB 2C4XA 3QA3A 2MQ3A 5A2BA 3C60C 5MENE 5ADOL 4PR5B 4JW3A 1AQDA 1CYWA 4ODWA 5I6XB 3EADA 1NFIA 3RX7A 3O45B 2Z35B 5F6IC 1KDJA 2D03L 1HXMB 4FFTA 1VZIA 1YNKL 2K6WA 4P5TA 1U3JA 3NIDB 3PP3K 5B8CB 1MVFA 2JIXA 1RUAH 1CTMA 4HJJH 3KPOA 4LLMB 1OGTA 4YE4L 4LSDA 3NG5A 4HS6B 3MV9B 2YGQA 3FC8A 5C8JA 2BOCA 2BNRA 1DBKL 4H7VA 3MRJA 4AMWA 4X99A 2N7AA 3UMTA 1DJYA 2B4CL 2NYKA 1NCOA 4H8QA 4YDJA 4CJ0A 5I1DB 1JNLH 3F7QA 4XI5C 3EDFA 2GKIA 2Q3XA 3IR6A 2CBTA 4E9SA 1KFGA 3D87B 4I18B 3CVHA 3NACH 4X5LA 3QZWG 4KROB 2CRZA 1QOKA 3C9NB 4N1HB 4ODUB 2G75A 5EU6B 3WXVH 4AQ1C 5ID0A 3V4PL 3AQXA 1DFXA 4RX4D 1UUSA 1I9IH 3AW5A 1U4EA 2ESVB 1SMDA 3FMGH 1NCNA 1T0PB 3LN4B 3B3BA 4KU1A 3KLLA 3UADA 5J1TC 3IE4A 3MNMA 1DZ0A 3MHZA 1N2RB 4ETQA 3DA0A 2ZX8A 2EDYA 4P2QB 2FGWH 4Q52A 3N44B 1X7QB 2BC4A 2G60L 4UNTA 3SQRA 1NGYA 4L9DA 4W1TA 3UP6A 2ZUYA 3E1ZA 1INQA 1BSIA 1PL3A 3WUWA 3PHAA 3RX8A 2IDFA 1D2OA 1D5ZB 3V9EA 4OD2A 5C71A 3QAZB 2IOMA 3QIWD 4A7GA 4PW4A 4C4KT 2JI3A 1IBYA 1NMBH 3N1FC 2VZ3A 4OFVA 4UTAA 5I1CL 1WFJA 3I2CL 2ZG3A 2O5YH 3S3SA 2QQNH 4JCLA 5GGUA 1MW1A 1PX4A 5KBDA 4JFEE 4LPTA 2AABL 1GGCL 1LK3L 1G1CA 2PW1A 1X4ZA 4PJEA 4G3YH 1QRNE 3B3IA 5D96B 1IM9B 1OGAA 1BZ9B 3AT0A 2CU9A 3LDBC 5GZOD 1A3QA 4XBPB 2ZOWA 5GPRA 1YG9A 1IEBB 2MCG1 3MUHL 4L4TA 4I0PC 4WY7L 1AD9B 5LGYA 4GPVA 3QYCA 2GTQA 4FTVE 4CDGC 2VN7A 1GZHC 3QDMA 1XX9C 1FFPA 3H4HA 1SQMA 4G9DB 3RA7H 2K0RA 3KPMB 1OTTC 4IMLA 4M3JA 5C08B 2PYED 3FCBA 1YMHB 2P5PA 3IJEB 1MCDA 3LPGA 4PI0A 4OZIE 1NC4A 3LH2L 5F1IB 2IGFH 4NM4H 1A9BA 2HRPL 4EI5D 2OJEB 3S36H 2JMRA 4FA6A 4KQ4L 1YO4A 3UCRA 4I2XB 2OCCB 3P30H 1A7NH 3CX5J 1OARH 1RK0A 5JXAH 3U36B 3VXME 4OCWL 3RGVB 3QRBA 5AW6B 2DICA 4WV1C 2OP4L 5EBMB 4TTGA 2VN6A 4KHXL 4U4IA 4E41E 4G8FB 1IMHC 1P4IH 1IBDA 1KGUA 2WBJA 3L9YA 1VPOL 3QH3A 4NUMA 1HWHB 5JUEL 2NR6D 5J12B 2EAEA 2GC4C 3X2HA 1NTDA 2AQNA 1WC7B 1QP1A 4FQXA 4U1MB 4Q9QL 2R15A 4JDZB 2CR6A 1PIFA 3SHSA 2IANE 4I13B 2NPLX 1ORSB 1MHEA 4ZFZB 5BRZE 4FOMA 1PZSA 1ZGLM 3AREB 4S1QL 5JW4M 1MNUH 1NLBH 2H8PA 2QR0B 2W60B 5J6GB 2FIRT 32C2A 3D34A 5D1XB 2UXGA 5D7HA 5IUSA 1TWFA 3P0GB 1AZBA 4P07A 4CGUB 5D5MB 4S0TD 4QHPA 1CU4H 2GC7C 4ZFGH 3SDDD 3CMOH 2Q20A 4JFZL 4M6MH 3Q48A 3QPXH 3BEWA 2WQWA 3GMQA 2B39A 3BPOC 3PWUB 4MB4A 3WY2A 4R8WH 5I73B 5DUMH 4M8QB 5I6MA 2AI0L 1IVTA 4UDTB 5TDPB 1KV7A 2Q86A 3JWDL 1KPVA 3SIKA 2FBJH 3Q05A 2PPFA 3AAZB 2HG0A 1A4JB 3L4ZA 4YDMA 1PLCA 4L9LA 1TETH 2P4AB 2JJTA 3Q2WA 1L4IA 4Q9BA 5IVXB 3DX6B 3TVMB 1YC7A 1GZPA 4OCMC 2BSBA 1CE1H 4UM9A 5ICUA 3EJCA 1SBSH 3CIQA 3MLVH 2BCKA 2WLLB 1HILB 2G3MA 4PD4K 4PJHE 1V7ML 5CLTA 2CKBB 1FZJB 1GIGL 5L0QC 5KSBE 5KS9A 1WA0X 3CFEB 4J3TA 5LNGA 5FC9A 5DMKA 3MRPA 43C9B 5ITBL 1HFUA 5IW6B 3MRGB 2XFXA 3CDZB 1FNGB 1PZDA 2BRQA 4LLDB 1QBAA 5K39A 2DLFH 3O6KL 3VI4F 2XWXA 4N8VA 2I32A 3O4LE 4NN5C 2H6PA 2OMWA 1N3NB 3ECUA 2WQ8A 1WIUA 1R5VB 4XTRD 3RL1B 3EJZC 4PRID 1OCZB 3T8XA 1F1AA 3KLHD 1KENL 4JFFA 4XOAA 2C3VB 5FXCH 2YBRA 2PXYB 3AT8A 3W11D 3ECWA 1EHXA 4FULA 1OTUD 3DURA 5I6OA 1PD6A 2JJVA 2IPKA 4XXWC 4PW3A 1H5BC 4V2CB 3P73A 5T1DH 4F27A 4N0YH 1YY9C 2XX1A 1OTSC 1TZAA 1YY8B 4PP1C 3V0GA 2XWDA 1MPAL 2CDFB 1RY7B 5ECJE 4RAUA 3BAEH 1HQRB 5C9JA 5DJ6A 4F2FA 3MUY1 4LDOB 3F7YB 3PGFH 1MCRA 1A6PA 2CDEA 1XL6A 3AY4A 1JYWA 4AYEC 1J0ZA 4F24A 4S2SA 1MJJB 2OTWB 3AROA 4GP8B 2R2BB 3MODL 4OZ4A 4FG6C 5FLVA 4Y2DA 1OSPL 3VWJA 3ABMB 2GABA 1CGWA 4QXGL 4TNVK 3GXDA 4U6YA 2F54A 4LRIA 5EIVA 2UY7B 1FZKA 1TJGH 3I6KB 4XNAA 1L0YA 5FOBB 2O72A 4IJ3C 4JB9L 2LQRA 1F3JA 2VL5B 1PZCA 3SOBH 5IMKB 1J10A 1HAWA 2X70A 2DM2A 3RJOA 4JFEB 3FQWB 3S34L 4OFIA 4FZ8H 3GM8A 1QRNB 4A6YB 1ZV9A 1G7PB 3Q3GA 4L3CA 1PVHA 1XGRB 4QO1A 3T2LA 6FABH 3Q43A 4MZRA 3TV3H 2IXQA 5FYLL 1EDQA 3IBEA 2A74A 1MFAH 1OAXH 4A2EA 1BREA 4FTVB 5LGHH 2H32A 2YLKA 3LX9A 4X5QA 4OZHF 3BVDB 3UO8B 3MVSA 3ZTNL 1O7VA 5I74B 3WFHA 4R7NB 2D2CC 3CAFA 1LWHA 1TTGA 3MLWH 5GS0C 3WO4B 4OZIB 1E50A 2A4EA 1C5CH 2JK5A 4HKZA 4UV7L 3VU1A 7CGTA 3ULVF 1JN6A 2X40A 1OT2A 1V27A 4OJDH 5C0JB 3WLBA 4JQXA 1SF5A 4GBXA 5EZOL 2RA1A 5EZLA 3VXMB 4UYQA 5AG9A 1AGEA 3ATAA 4L37A 5AVYB 1KF9B 3EO0B 1MAKA 1TTUA 2FNBA 2EE9A 1PZUB 4HIXH 4IRJD 4YDVB 4MS8D 1N26A 4E41B 3HE7D 5AAMC 4MMXA 3TEUA 3TXAA 4NQEA 5LNEA 5SWZA 4N3TA 2B1HH 4NM8L 2HTLC 2Q7YB 1MVYA 3N1GC 2YQ3A 2DY2A 4BDVB 1DVQA 5TGBA 4C58B 5GS0L 3M7OA 1CE6A 2LR4A 1ED3A 2Y06H 1U8MB 4K07A 5E4EB 1JPSL 4KTYA 5E9DE 2B9BA 5EF3A 4UT6H 3MNWB 4BFJA 2IANB 2O5XH 4FX5A 1U4FA 4CW1B 1N5YH 5F0MB 1IBBA 1C08B 3T2PA 5CNHA 1JZIA 4RH4A 4XODA 2TSAA 4FQ2H 1JYVA 2D8KA 3WTSA 1WCQA 1HS6A 1J8RA 4MXVE 4LSSL 5AOLA 1AY1H 1ID2A 1MN4A 4Q74A 1CLOL 1K4CB 2ZXWB 5C07E 1BGXH 1DQVA 5B39G 4Y1AE 2CUMA 3MDJA 1CLZL 4NO0D 5HBBA 4TMPA 4NLAA 2DQUL 4ZTEA 4MNHB 3SOTA 3WS6C 3OHXA 4RISH 1WC2A 2ZQKA 1Q0YL 3C6SB 3GXMA 3M7FB 3QORD 2VN5A 4NWTL 3BRGC 4CBZA 4OY9A 2IDCA 1GYCA 3SDAA 2A83B 1EZSA 3MCKB 5KYWA 2VDNB 5F89B 3U0TA 1UURA 3WIHL 3KPRE 3E38A 3TNNA 3MJ9A 2W0FB 1KPUA 4ABUA 5A2JH 3DVFA 2W9EH 3QXTA 4YWGL 5TDOA 3EW3B 3GRWL 1S2EA 1YMMA 3CDGA 3SKUD 3TBVA 1QR4A 5F7EH 3FTYA 4PJHB 4XMLH 5KSBB 5IK3B 3HC4H 1BQKA 3MJ8A 4PJFA 1IEAB 5IV2B 2PETA 4NS0A 2LTQB 4HULB 3MGAA 1RIHL 1ECZA 1JFQH 3MCLH 4WUUD 3T6XA 3DI3B 4HK0A 4I87A 5KVDE 1YYML 3QCUL 4M29A 4PIBA 5BOJA 3MKKA 3C5ZB 3FBKA 1SYSA 2VN3A 4H8HA 2FJGA 3ALPA 2C3WA 2OTPA 3ARGC 3KH3A 2NX5D 4Z1PA 5KVFH 1URLA 3U82B 4YHML 4U3SA 4TPRH 2IDTA 5F1OB 1Y6KR 5ABAA 3TPUA 3TNMB 1NIAA 5HGBA 4GP5B 1KC5L 3MRBB 4ENEC 4BXVA 2TRYA 1A7RH 4K5NA 4JRWA 4LCCC 3QC5X 3TT1L 4S1SH 4OSUH 3SJVB 5C0FB 1JNNL 3DRTB 1UB6A 2ZICA 5GRVK 1WTGT 3IJSA 5EBGA 2EYSA 4F7TB 4OVVA 2KS0A 2X44D 1RMFH 1CR5A 4RWYL 2UZIL 3QDGA 1YDPA 1ZLVH 3CFBB 4H26B 4HPHA 1SOKA 4H2AA 4QHMA 5C6WH 2IEPA 4ZUVB 4WI3A 5JXEA 5EBWB 3P40A 1JK9B 2OZ4L 1W72A 3FQXA 4EI5A 2R4SL 3OR6B 3RL2A 2WTOA 4JGUA 1DP0A 1YEKL 2JIOA 2OMVB 3B9KC 4Y9GA 3FFCE 3UDWA 1LEKB 4FQ1L 3GIVB 3AVEA 4FYRA 5IG7A 1KQGA 4X8GA 1YJDH 4HFWA 4WO4B 4WKZA 3VH8B 4QMEA 3FRPB 4JM2B 2YBGA 2ZYIA 2R7EA 2KDGA 1KEML 3NESA 3G6AA 2HUEA 1E28B 2Z7ZA 1JRHH 2YAHA 4XH2B 2J8HA 3FK3A 4TQ8A 3R4DA 4NKQB 1U8PB 1OXYA 3VFSA 5C0RL 4JFTA 3VX0A 1H0DA 1J1PH 4HHGA 3UTSA 4UTBH 3WN5B 2DL2A 1G4RA 3B9DA 4OLXH 5JPMA 4NRZA 4XVJL 4JG9A 1A6WL 4NUGL 5A16B 4O02L 3V7AG 1C7SA 4GA6A 1TNMA 1KG0A 25C8L 2NLJA 5FAAA 3SE6A 4BUGA 4XC1L 4DGVH 1UJ3A 3QG7H 3UAEA 2EVGA 3TV8A 5IBTL 4FQHA 3V6OC 2QADB 3DX9A 2H3XC 3PQYA 4AONB 2A77H 3CFQA 5EEYA 4OBSA 4ZMNA 1SVCP 4PUBL 3PJSB 3HZYA 2I9LB 4OJAA 1NJ9B 3X3GH 5HGHB 5I2IB 3KYKL 3BGMA 4E36A 4QWWD 4OB5H 2I5YL 4RAVA 1E67A 2WBWB 4EIUA 3RDJA 3KYMA 1FVCA 1UH2A 2BY1A 2IAMB 3UGXA 1OW0C 1MQ8A 3J2PA 4A37A 1RFDL 4G72B 3L1GA 1G6RA 3VI4E 4U1SB 5J5EA 3AXIA 4Y16B 1TZHA 1TEYA 3LJ3A 4LKXB 1MCSA 4DP6X 3HKZA 3VM7A 1USQA 2ITCB 4JO1H 4X4XA 2WCPA 3MA9H 3H9YA 1QI4A 1UM6L 3NPSC 1AGDA 4UINL 1FNSH 1EMTL 4PJ5E 4YHYB 3QEHA 3SGJA 1WAAF 1S9WB 1ZA3B 2F15A 2E6QA 1A47A 1G6VK 2HWZH 2V7HB 3QUZA 1U2CA 3LRKA 5E9DB 2BX5A 3V5HA 2WMPB 2CUAA 4BFOA 2YSTA 4D3CL 1X5MA 4LU5L 5HGDB 5DJZB 1Q9OA 4Y4KB 5IVZB 4JGJA 5KVEH 4DQAA 2Z65C 1T83C 5E70A 4HAGA 3TP4A 3U46A 3V6FA 1R5IA 4PCSA 3EYVA 3F7VA 5CGBA 2NUPB 2XRAH 3VI3A 3UTQA 3ZKSD 3HI1A 3ARWA 3V6BR 4ENGA 2OW7A 2YRLA 5C07B 5B38G 3AB0B 2GCYA 4MXQC 5AZEH 1KNOA 4HUKB 1H0HA 4XWOC 1F4YH 1ZHKB 2XV3A 3IGFA 5IP4A 4Y4FA 3N5AA 1PKQE 4MJ6A 3TLRA 4L4VD 5SWSE 4QYOA 2C3GA 1BBDH 1KCWA 3H3BC 1FFOB 5E6RB 3A21A 3TC9A 5J06A 1FZOA 1U9KA 5DRXB 2YJLA 4ZW7A 3GK8L 5F3HB 4FNLL 5D71H 4ZAKA 3TA3B 4BFBD 3QG6B 1ETZB 2JA7A 4GRMA 4GSQA 1RZIB 4YHKH 4AE1A 2WWKT 5D2LE 4K8RL 3GBNL 3D39E 4KJYA 4NNPH 1F02I 1XF3B 4NZRL 4GUPB 4RFNC 1IFHH 2E56A 4HUXA 3C12A 1U6AH 3LPFA 1IC5H 4OH2A 3U4BH 1JF1B 5ESVA 1Y4ZA 3L3IB 1GHFL 1XF1A 3L95A 4AV5A 1HQ4B 2RCSL 2QTVA 3QUYC 5BS0D 1ZGLP 1LO0H 1PU0A 3GZQA 5FUCC 1BQHA 2X9XA 1JCKA 4LNRA 3TBCA 1A7PH 4L29A 5IIEB 1U3HC 1DANT 4FCAA 4G11A 3WKPA 2YXFA 1F2QA 3CSTA 4OZHE 2OMYB 1OWRM 2B1OA 2BVYA 4WLCA 2BERA 5EEWA 1MKFA 2VGLM 4NUJA 5EWIL 2EE6A 2DJMA 2WW8A 3W3BA 1NCCH 1XGPA 2WQAA 5I0XA 1R34A 1CICA 1NGPL 1HHHA 3EHBD 1TVBB 4KO7A 3ULVE 1UCBH 1E6OL 3VD7A 1SEBB 3S5LA 3CIAA 5IM7B 3PHSA 3EOAA 2O30A 1XCWA 3X2NA 5KVFE 1Z9MA 4Y5XA 2YXMA 3FQ4A 1UASA 4YAQA 2XY1A 3Q8BA 3AG3B 3MLXH 3TO4B 3C5XA 3CVIH 3NZSA 3WNJA 4ZM7A 1O9ZA 2PPEA 4X7CC 5E2TH 2CG9X 1IAOA 1RVFL 2WTRB 3SPJA 3V5DA 1MWOA 4EDWL 1RZ8B 4KBPA 4EAEA 5IROA 4ZZFA 4FA8A 3FFCB 2R93A 3T0EE 2ERJC 4X42A 3UPRB 1MFEL 4XP4L 3J27A 5GGTH 5B1JC 4IRJA 5KBPA 4BIKA 3OKMA 2K78A 1FFNA 4AM0A 1X5JA 4ABWA 1KCRH 3G5YA 3MLZH 3D85B 4Z3FA 3E6HA 4GRLB 1ICTA 3ZKMD 4DIXA 1DVSA 3BH9B 4JKNA 3H2QA 1EEYB 2IBZX 4LVOB 5C0ND 3LQZB 2QVIA 4TRPL 2F08A 4HD9A 1DLFH 5EPPA 3P2TA 2UZYA 1CTNA 1KTLA 5CEYB 2BXZA 3ZGHA 3RDTC 4J5VA 2E2IA 3DARA 5ERWB 2D3NA 1PIGA 2APBA 4E42B 1IO4C 5L4MA 1FZMB 1W72H 3QYMA 2H0FA 1Z9SB 3WNNA 4RGNE 2F5AH 4NO0A 2OJZH 2R2CA 4ZBJA 2DJ4A 3MRHA 4GG6F 3EO9L 1KTKE 3OQ3B 1BYNA 2JJSA 5E2JA 1DVFC 4Z3TA 1WZKA 3WKML 4APQC 3BHBA 1WFIA 4P9MH 3Q5OA 1NBVH 3H9SE 2AVFA 3BWUC 4PJIF 4Y8DC 2R23A 3W0WD 3WUWG 1U0QA 2C9AA 5DR5H 4KTEH 3C6LC 5C09D 4JO3H 3ILQC 1R17A 2HFFB 4M4RA 4NC1E 3UAJC 1V7NH 4NAJA 5L4JA 1RZGB 2ZOTA 4H4NA 4AYFA 3TIDA 2FWUA 2YMTA 2AITA 1Z9PA 3WMPA 2DWEB 1WLFA 4OM1H 2VLKE 3N40F 4W9EC 3VI4B 3NP4A 1L9RA 4PGEB 4ANWA 5KJRH 3WIIL 5CCJA 2WXFA 1VFAB 2O26U 3KPPA 2FH6A 2WZAA 4OAWB 4Z78A 2J21A 4FQPA 4NQSA 5KUMA 3FS9A 1R0AL 1XCQB 1P1ZB 4PJ5B 4LPYA 1T03L 5DYIA 2PPAA 3WFCH 1CMOA 2HT2D 2WO4A 1B4JH 3NJIA 3KGTA 4Q4IA 3L9RA 3TO2B 3TONA 3OX8A 3OKOB 1RJLA 3OSKA 1TVHA 3LZQA 2EO1A 4FFZH 2HT4C 2NX5A 2XZAH 1M2OA 4AT6A 5AW9B 1HL5A 4ZS7L 1IAIH 1G7JA 3L13A 3S4SG 5HYQA 2NZIA 5CR8A 4GNKB 4G43B 3QI9B 3FCSB 2DM7A 2NUTA 5KSUB 1KJ2B 3BO8A 1CZ8H 2HJFA 2BSSB 4N5ED 4BK4A 5EBLA 4DCQA 4LDLB 3M1BA 3U0WH 3O2VL 4G6FD 1MF2L 1PKQB 3IMTA 5LGKA 3MMEA 1N5AA 5GISH 1UA3A 5IB3B 1CFVH 4FFWC 4HP5A 5SWSB 3EGXB 1UYWL 3WFBL 5KVEE 2NY4B 2R29A 1AR1B 3G5ZA 1UQSB 1FGNH 4JFYB 4OGXH 3S88H 3NJGA 1GOGA 2BOBB 1NCDH 3LN9A 4MA8L 1S4IA 1T1YB 4UT7H 5C0BB 1G7QB 2F53E 5D2LB 2ZWLT 5EDSA 4CKQA 5DRWA 1CT8A 2AV1B 5I17A 1PPIA 1UWXH 1BYPA 4XVOA 5FYLD 4EOWH 3NSYA 2JJWA 3SBPA 3D4GA 4XPAH 2ZCKH 1WD9A 4RGMB 4HIJA 1C7TA 4FHJA 3QXDB 2YGVA 2IADA 2AW2A 2R2HA 1XXFC 3CN2A 1IJNA 1JD9A 3QUXA 4MVBD 1EAQA 5F93C 1HZKA 4Z7QF 4GKZA 2OTUB 1OAQL 4L5FH 4AENA 3VO0A 3G5VB 2JB6A 3PDGA 4ZOAA 4MJHA 3ESUF 5DWUH 1HSAB 3IDXH 3VGAB 2CGZA 3UBXI 1OT1A 1CYGA 2P5ED 2IIJA 2YSSA 4P3DB 3O8XC 4OZHB 1A6UH 3DGGA 3IAGC 5IREA 4H25A 1YPZF 4Q58C 1A9EB 4NEHB 3FPXA 5EO1B 1MEXH 4FQCH 4NKOB 1ZJBA 3I85A 2ED9A 2Y3NA 1KIUB 3O41A 4BQCA 1ZDSA 4JGMA 4NRYA 2FR4B 4J8RA 5FKAA 3EIFA 3QO1B 2J72A 1DQDL 3TJEH 4GS7B 3JV6A 1JGVH 1ZT4A 2RJMA 3QFDA 1M6OA 1DQTA 4HOWA 5IMOB 4JP7A 5DK2B 3VVWA 5HVHB 4R90H 1Q9KB 4H0IA 3E3QE 4HJ0D 3ZTJG 1A4BA 2R4RL 1SJXA 5FA4A 5FHAH 1L0PA 1PYQA 3DTXA 3QQ3B 4BWTA 1FL6A 1WAAE 4N26A 4TULH 3K6SA 1UG9A 4XP9H 2YPVL 3T0EB 2YAEA 3NABH 5DEGA 1ZJAA 3TBSB 4CVZA 1KYFA 1F8TH 5E08H 2PJHB 3GHEH 4NC2B 3G6DL 4PWJA 2AF2A 3VRIB 4BELD 5CZKA 4B97A 2DZEA 2V5TA 2Q8AH 3B2VL 1S9YB 3UJIH 1WDAA 4WI2A 4ONHB 4F92B 3C60A 3WE6A 2WQRA 2A1WL 3RWDA 4BH7B 1I8MA 3DRQA 4KY1L 3AMLA 5JYLA 3BD4A 3RURA 4OM0H 3V4PA 2E7DA 1IIKA 4H2CA 4KNUA 4L8BB 2G9HB 4YGVB 4ZZKA 3JBG7 5AALA 3RBSA 4P59H 3MU3A 1NAML 1KB9J 2Y36L 2EE3A 2WWMD 2Y7QB 2DQTL 4R97B 1QD0A 2R8SH 4JL1A 5SX5H 1EJOH 4OFKA 3D3VE 2DIJA 5JIMA 5B7EA 3TZVC 3TIWA 2PCFA 3NCJL 4M3HA 2X4NB 4QRRD 4G1EB 1CBVL 4JGNA 2AJ3A 1EH9A 4WUKL 1RJYA 3MV7A 3X12A 4IKIA 4DO6A 4X8JA 3P77A 1CQKA 2Y69B 1H3WM 3GKWH 3JV4B 4W9CC 1FUNA 1T20B 3H9SB 4HPYH 2J7LA 4XNYL 3KZ8A 3DUUB 1KPRA 1QLRB 1FCGA 3LNGA 5ABDE 4TUOA 1S7SB 3SQOL 5LGJA 4IBSA 4DVRH 1XGQA 2VW6A 3ZR5A 3VMNA 4ABQA 4HCFA 1E18A 4JCWA 3EYSL 1DQLH 3SYPA 2VLKB 4Z18A 4PRAA 4CJ1A 1NAKH 4WW2F 1GC1L 1DCLA 4HUWB 3U7WH 8CGTA 3CX5K 6CGTA 4OQTH 3QULB 1YECL 3VTTA 4MXWH 5F3BB 4W4OC 5CLXA 5FIEA 2IMNA 2E7LC 1W0WA 3WAKA 2X5PA 3VXUB 4FP8L 1R9TA 4A7UA 2XWJB 5BS0A 1EZUA 8PAZA 3DV4B 3DECA 3D4YA 3X2MA 2XSKA 3DJTA 2X2HA 1CL7H 3REVA 4L05A 4K4KA 1J8SA 1T1WB 1R3KB 3X1EA 2CW0D 1GAFL 3GMPA 2XIIA 5CCKL 1W80A 3C8HA 5T1KA 1GZHA 3PGDB 2B5IB 1K4DA 2IOIA 2PCPA 2Z92A 4CSSA 1OLLA 5GRJL 1OQXA 2VXVL 5I9QB 3QS2A 5JHDE 1PQZA 1KGCD 1U36A 1I1AB 5FYKE 2YRBA 5GGSY 4NN7B 5F88A 2CO7B 2X1PA 4KI5D 4GIPD 4OLWH 3ATEA 2AE0X 1RJZB 5BZWB 1I9RL 4F9PC 2A2QT 3LB6C 4H20H 4EZLA 2BMKA 5I19L 3FU8A 3NJJA 3DX0A 4WV1A 3MXWH 1E6JH 3GTMA 3IETB 3PWPA 4JFDA 4YFEA 1EHLL 4HJUA 2F53B 1RURH 5GS1B 1T21B 3GEFA 4L1BA 4UAHA 2BJML 1JZ6A 3S98A 1BZEA 4KH2A 3CXHJ 4ICWA 4MA1B 1MWAH 1ACYH 5DEJA 4I77L 2PYFB 3D5OF 4KUCD 5D1ZB 5FR3A 3GYRA 4JLRA 5E0QA 4I0KA 4CSPA 5JW5B 1A22B 1HU8A 3Q6GH 2XWRA 4I5BB 2HVBA 1T6WA 1J1OL 4CSTA 5I0WA 3SDXF 1L5GB 1OOAA 5KANG 2OSYA 4IDJL 3ES6B 4ZFOL 3U7AA 5HYSG 4GG6E 3MRFB 2FSEA 4G8GA 3VGEA 4MHHG 4PRHD 1HI6A 4DAGL 3MGOA 3V7MA 1WZ1H 3QR2A 5ESAA 3V95A 4PJIE 5D7JD 3VQMA 2NY2D 5DI8B 4L3FA 1IE5A 3BN9C 4CC0A 1FG2B 1EEZA 4OCYH 3BUYB 2X0WA 2X6BA 3CLEL 3BFQG 3T5WA 2KPNA 1EJ8A 4JN1H 4X6CF 4L5FE 3PL6D 5EOCH 1FCCA 4I1PA 4JDVA 3I6GA 2ADJA 4JRXD 2EKSA 1QBLL 2BIIA 1QBMH 4RMTA 1XR9B 1FLRL 2NW2B 4E9VA 2MQCA 5ACLA 2ZE0A 4HC1L 4N2NA 2RFXA 5HVWA 2OR9H 1KULA 2DD8L 3DIDA 4KO8A 4KZ0A 2XFGB 3WTUA 3LZFH 4OF0A 4LARH 3DXAB 5C09A 5CD3A 1OCWL 1BVNT 3RUGF 2EYTA 2R69H 4H1LA 3CH8A 3GJEB 1SXZA 4OFYD 2WO2B 2UXFA 1LO2H 5AL8A 3FONA 4A67A 2DKUA 2YIHA 1QHQA 4ALAH 4NXKA 1AKJB 2K1MA 3MFFB 1Q38A 2J8OA 4YNYA 4G6JL 1MHPH 3TTSA 4DN4H 4LHQB 3GDCA 5KUKA 1I7TA 1V3KA 5CJOH 5CJ5A 2WPGA 5HP5A 2VR6A 3WEXA 3H53A 1F58H 1JK8A 5BPPA 2BP8A 2H26B 1WRFA 1OPGL 3ZJAA 2DH3A 3L7FA 5ACZA 4FNTA 5JPNB 2DTMH 1DVYA 1E90A 2MPAH 4K8RD 3HRZB 3MYJA 2VDLL 3GMRB 3RTQB 4XXWA 2KQMA 1GW6A 1A6AA 1G7LB 3C8DA 1NSNH 4D0BA 1U93A 3D3VB 4M5YL 5FV2A 1JSYA 2ZT9C 5IQ9A 2JXMA 4OBRA 1QPXA 2ZF9A 4WFGD 2Y25A 5IQLA 1E9OA 1U58A 5J11B 4P5KB 4G9FA 1A5FH 5L2KD 3A22A 1SN2A 1OSYA 1U95B 2RALA 3HZKA 3VDCA 2Y5EA 5DYGA 2H3NA 1GA2A 4K5MA 1F6AA 3K4AA 1OT4A 4GI9A 2FSDA 5I6KA 4P9HL 4Y2OA 1MDAA 3UTPE 4L8SC 3BSZA 4JKLA 4MJIB 1HH6A 2O1AA 4OLZH 2RGSA 2HMIC 1TFPA 3VXSD 1ZTMA 4ZUUA 3K2MC 2AJUH 2PWDA 4N6RA 5EFIA 4Z7QE 3HAEG 1A21A 3FT4B 2C45A 4PJ9C 1AZRA 2HSIA 3CZFA 1FDLH 4BJLA 3IFLL 5DMGC 4RRPA 1K2DA 2XY2A 2Z7YA 3P4MA 2BVOB 1CFQB 4XXDA 4W9KC 2I9TA 5D1QD 4BKTC 4BHUI 3OJVC 1ZA6B 4QUOA 2VDKL 3VSTA 1YPZE 1DBAH 5LBGA 3OG6B 2HVKB 2NY5H 3QJUB 2E8ZA 2KPWA 1OAKL 5CZXC 1MCQA 5T1MA 2X4OB 3HBZA 1GGTA 2YD4A 3QC6X 4N90E 4GMSH 3DDFA 2XV6B 2DQHH 3DBSA 4ORGB 4YUEL 5IB5A 1CXHA 1DQQA 2P5EA 5IBUG 5SWQA 4H44C 5JQIB 2AANA 1SXAA 3K7UA 4DGUA 1U41A 3LEYH 2XWTB 4NNYA 2OA9A 4FC3E 4XZ4A 5GRVL 4Z3EA 4X4MA 1Y7VA 2ZOLB 2Q5BA 4MDJA 2QSQA 2EDDA 3LZLA 4ZUTB 1KCKA 5BRZD 4LMQE 1XFPA 4KTDL 5JHDB 3NZ8B 1CF8H 1HKLH 1LDPH 2VABB 2UX7A 1R24B 3T9WA 1RK1B 1S3SA 1BCIA 3HLAB 1D5BA 2X4RB 3GD1C 1CDHA 1PFCA 4FF9A 2DQFB 4AW4A 4B9JA 1RZ7H 2IWKA 2OMXA 4OJFL 3O5AA 4X4YA 3N06B 4N0FA 2DQCH 3ML9A 5GGVY 4LE8A 2B8OT 4AY0A 3ILPA 1D5RA 4S1RL 5E2VH 2RQEA 4HBCH 5IBLC 1N64L 1E27A 3POCA 3TJHC 1KB5H 3LZOA 5EO0A 4P5MB 1WFUA 2VUMA 3L1OH 1JVOA 4QIRA 1I3RB 2H1PL 3ZUCA 2YPLE 2B2XL 5AAMA 4FNSA 5AVVB 2BP5M 3QJXA 3U1QA 3NTCL 1WBZB 2VJ0A 4ZS6C 4R2GC 1KN2H 4U1HB 3H3KA 2VLMD 1X4YA 3MUGB 1BG1A 1ZTXH 1E8WA 2L7EA 1E8ZA 3S48A 4OIIL 5J9PB 2YWZA 1BJMA 4UOZA 3FTGB 4BZ1L 4OZFB 2PWHA 1XEDA 5DK3A 2VQTA 3U4EB 4DPRA 4PAZA 1NCTA 3UBGA 1D6VH 1TCRA 3WIHA 2WZPD 4GG6B 4PP2B 5L4FA 3PWJA 4MAZA 4YSOA 4NO2A 1P7QA 3S6CA 3GRWA 1WLHA 5ISZE 3DO3A 1J05A 1TCMA 1LP9B 5A40E 1T5KA 4PJIB 3SCMD 4G83A 4Z77B 4HCGA 2PPDA 3DPBA 5BZDA 1E4HA 3OMZA 5B4MD 3T0VA 2Y1YA 2EH8L 2CO6A 1CG9B 4N0CD 5ID1B 1H15A 1QACA 2J71A 3A4EA 3GMLB 4MNQD 4HKJB 5DVLA 5T8IA 3ZKXC 5FB8B 4XN7A 1XF2B 4ZMOA 2FIKA 3IXTA 2QQKH 4AJWA 5C9KA 2VPZA 1NFKA 4HAFA 2IALA 2ZAHA 3LZRA 3RBGA 3HC0B 2DS4A 3KGSA 4HGMA 3AWFA 3QDAA 5FW6A 5C70A 2QPEB 4PTTA 4UT9H 4BYHA 3L3GA 4XPHL 2HX7A 4Z8FH 3QZWB 1YQVL 1UWEH 3K2UH 5IW3A 5T1JA 1SIWA 4QY8A 2FWOB 1XR8A 1AQ8A 1GY2A 2GY7B 5DHVA 5DHEA 5J1AA 5CJQH 3G6JA 3SY0B 3WL9A 3FOLB 2XT1B 4CN4A 3LV3A 4U7MA 1TQCB 1I3GH 1Z3GH 4JY6A 1V55B 4OCNC 2XQBL 9CGTA 3US0A 2EUZA 1F1DA 1MHHA 5DYFA 3HU2A 3M17A 2DEXX 4I89A 3TN0C 4KXZI 2A69D 4UQEA 3ARGA 3HIZA 3U83A 3WFEL 5DUBB 3Q06A 2ZWSA 2R83A 1C5DA 2OZ4A 3S5LG 3ZTDC 4HX1A 3ZE2F 3D25A 1G43A 1FC1A 1Z1WA 4NNXA 5MEQB 5EZJB 3EUDA 5DA4A 4LCCA 5DVNA 4EN3C 4NQCE 2WXKA 2OK0L 4NHCH 4OIAA 1TJHL 3M8OH 4EVNA 1JV5A 3CZNA 1PY9A 1P4LA 5B1AB 3DSNB 5FM8A 5CLZA 2ZP9A 4G7YL 2NY0C 1NEUA 5HYJE 5C7XH 3IM1A 1U92B 5KAQF 1UACH 1TF4A 2AAAA 5LXVA 4X0KB 2Z0BA 3NUKA 4Z95L 3WEAA 4B9IA 4GQQA 2G2NA 3ARBD 3BQUC 1SJEB 5E4AA 2VLJB 2AJZA 5JYMA 2A6JB 3K8KA 3NZHL 4NBYB 4QCIA 1NL0L 1ASPA 4JUTA 4O02A 3CDCA 4JZOB 4NZ8A 4Q9CA 1TJXA 4LVNB 3STLB 4DKEL 4URKA 1CWVA 4M1DL 4EIBA 3GS4A 1IGIH 1URZA 1LXMA 4ZSOA 1WAPA 2VPXA 2JNZA 4Z7QB 4O4YL 3ULUH 1UXSB 4LHJB 3ARYA 3SDXE 1IM3D 3DOHA 3IFOB 5T5MD 35C8L 5ADPH 2YS4A 2WKGA 3IF1A 1JI2A 1NKRA 5FW7A 5BJTB 4YDLC 2YKKA 3S36X 3TASA 3KWVA 5J6HB 4KKCD 3LSOA 3VG9B 3CBJB 4FADA 3VB9A 4FEMA 3L1FA 3OMIB 2V17H 3UZVB 1IGML 3NT0A 2QHRL 1N0LA 5IESH 1W8NA 1DVUA 3QZMA 3RP1A 5CU9A