4FERA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellohexaose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4ferA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4ferA02
2HCZX 3X2GA 1WC2A 3X2HA 1OA7A 3CZBA 3ENGA 4ENGA 3M3GA 2PI8A 3X2LA 2G6GA 3FT9A 3X2KA 1L8FA 2KQAA 4L48A 2ENGA 2VXQA 1OA9A 4JS7A 1N10A 2GAEA 3SUKA 4FG4A 3SUJA 3FT1A 2PNWA 3X2PA 2AE0X 1HD5A 4FFTA 5GLYA 3X2NA 4JCWA 1BMWA 4JP7A 2PJJA 4ZM7A 5H4UA 1BW4A 3D30A 3X2MA 4FERA 3X2OA 2JNZA 1WHPA 4JP6A 1WHOA 4FG2A 2PICA 4JJOA 5GLXA 5GM9A 3SULA 3X2IA 2G5DA 3X2JA 1BW3A 4AVRA 3SUMA 2BH0A
chains in the Genus database with same CATH superfamily
2VZSA 4AE1A 3DSNA 1HWGB 5JR1H 3H9HB 4PV8A 2N4IA 3R19A 4K9EH 3WIHL 5D7JA 2NXZC 3FB5A 3DX3A 4ANWA 1CFVH 3GTGA 4L3EA 1L0YA 2R23A 3KJ4B 3GTQA 3CPLB 1EA9C 2NW3B 4XB7A 2F54E 2I5YH 4AGLA 1IQDA 5KJ4A 1OPOA 1LNUA 2GAZB 2BNUA 4GUCA 4JLRB 5EU6B 4ZMLA 4ZX4A 2BDNL 3DRQB 3CIQA 4IOSD 4MA7H 3N1GC 4E9QA 4KHTH 4TS6A 3ARED 3KCWA 3QXDA 3MV7B 2F54B 1ZXKA 4GMTL 2OW7A 5KS9A 1W0WA 1EBAA 1ZLUK 3GBNH 3PGFH 3SQOH 3FT2A 2BZ7A 2DTSA 3MKGA 5EO9A 3AGVA 2R2HA 4M3JA 2NR6A 3HMWH 4YAQB 4Y2DA 5IBUB 4XR8C 4HIXH 3V5KA 3OWEA 3RVUC 4G5ZL 4ODWA 3NCMA 1VACA 3ECWA 2QQKL 2CA3A 2CLZA 4G6KH 1CYXA 2CKNA 4Y88A 5IESL 2ZUYA 4JPIA 2WSKA 3V79C 3ULVH 3G6DH 5F0LB 3TIDB 1E9QB 2P47B 4XMKL 2AGJH 1T89C 5EU6D 4CGUB 3B7YA 1YLEA 1P7QD 2F5AH 2WQWA 3BEVA 1JUFB 2FD6L 4IJTA 1TVDA 4C56E 2DJUA 3ATBA 3TN0D 4F15B 4NFDA 1CZ8L 2MQ3A 1KFAL 1DQVA 1HWHB 1J1OH 1QI5A 1M7DA 2C4FT 2JF1A 4PJBE 5AOJA 1D5BB 2B1AL 3U4AA 4PJCB 1AYRA 5I8OL 5H35A 3LZLA 4R4FL 3VQMA 4WF7A 4PIRF 2PO6B 1EAPA 4PJ9B 1G0DA 1GRWA 2X7LB 5JHBA 4F7MB 4DAGH 5I1LB 3HC0B 5JW4N 1COBA 1E2WA 4K8RH 5CGTA 3FQUA 3X2MA 2F58L 3L3DA 5D1XE 2MPAH 2NUTB 3GSQA 3QS2A 3NSJA 4JM0A 4OCWH 4G9FE 3BD3A 4NM4H 1JZEA 4LNRA 4PJDA 4ODTH 5KBMA 4EBQH 1OB1B 3EYSL 3NJFA 1JV5A 3RWHA 2VLLB 3POHA 3U7WL 1I8LC 2NY7L 3CDZA 1XF3B 4WU5B 4C54A 1WG3A 2DQEL 5IP4A 4AL8H 2EJ1A 1E50A 4K7FA 4U3XA 2X6AA 3TEZA 1YEKH 3TU6A 3F01A 4M4RA 1SOQA 1KCWA 3PRZA 1T03L 4PN6A 1JGDB 2IDTA 5F72S 4PLKC 3RIFK 5DMJB 2GJ6B 4KDTC 4FERA 3MCLL 1YMHA 4MA1B 5D70L 3EOYG 2DWDB 1DDHB 1XF2A 1Q1JH 4YSUA 1NSNH 2CBPA 2XKUA 4RFEA 4WTZG 5BZXA 3LD8C 3B34A 5I76A 4PVBA 2XZAL 4XZUB 4K9EL 4X6FB 4JFFA 3ZKND 1OZTG 1JWUA 2R51A 3NESA 4IHOA 1LD9B 1C7TA 1E2VA 4BK4A 1NBYA 1YECH 4WDIA 4YUEL 2GTQA 1LE5B 3T77A 1MW2A 2A9BA 2YJLA 5EC2B 2UUDK 1BM3H 2HMIC 3TURA 1M2VB 1NAML 4G6MH 5FYLD 3D3VD 1QACA 3AG3B 3O9WA 5CR8A 3ARPA 3SEPA 3MCG1 3S88H 5CSGA 2VUOA 2BM3A 3CWGA 1S8DA 4X6EA 2DEYX 2F53B 8CGTA 4Z7NE 3V4PH 5F89A 1RPQA 5EA0L 2MQGA 2OMNA 2DQFA 5AAPA 4HF5H 4JM2D 4EDWL 3QARA 1CT8B 3SBWC 3ZTNL 4F20A 2YPLB 4ONHA 5F3BB 3J8F7 3I9GL 3PP3K 4O02A 5CCHE 2AV1A 3STLA 4AK1A 1R6VA 1T83C 3SDDA 2H32H 5T3ZE 2KS0A 3QWRD 1KTDB 2R29A 4GI6A 1U8HB 1A3LH 3ARGC 3H6JA 1Z3RA 4RDBA 3CC5B 3RVVC 1BFOB 5E6ID 2Y0SA 5C7ZA 2WY3B 1I8LA 3RBGA 4BE5A 2EO9A 2Z4TA 4BINA 3CFKA 4G1MA 1OGAB 5FYJE 5DYOB 2ADGB 5F70A 5TFSL 1HILB 2Z64C 3KR3L 1AZNA 4Y7MA 4YFLI 2EXWD 3MODL 3QULA 3SCMD 4OLXL 3CZFB 1F8TH 3UTQA 4AITA 2FIKA 3F6LA 3BW9B 2PCPA 4QRRB 4W4OC 5DRZA 3UADA 3ZVVA 1R33A 5F7MC 4MMYB 2BSEA 3MRBA 4NWUH 5HVWA 5AZEH 2IIJA 2JNZA 5TPWL 2X2YA 3GSRA 4S2SA 2F19H 5HDQH 5BXFB 1A4JA 4H1LA 1RLBA 2APFA 3EADA 4P5KB 4UMGA 5CEXB 2X9XA 2Q3XA 3NIGF 3TFKD 4OLEA 3QC6X 4BCXA 2APSA 3AABA 4F8TA 3EOAB 4JUTA 3HJEA 1AQHA 2QKIA 2A0LC 3L54A 5L7XL 4DO6A 1MNNA 4A7UA 3B9KB 1EXUA 3NT0A 1TJGL 1TYJA 1CQYA 1YNTB 1XL4A 1GC1C 2ED9A 2WZ5A 4DVBB 3W37A 4Z7VB 2Z93A 1RZKH 2VLJE 1FI8C 3QEHB 4N0RA 2E8ZA 1I3UA 2RFXB 1VKXA 2AKRB 2WNXA 1ZPUA 4KK8C 2A69D 3MKKA 4AXWA 4RBPK 5JHLL 3WNJA 3WXWH 5ANME 4GXVL 3RWGB 4XO9A 1FZOB 1R19A 4C4BA 5GS2H 3U2IA 4PWKA 5J5EA 3VFSB 3PHOA 4OT1L 5HPOA 4AQEA 2P80D 1BBDH 1M56B 4GIAA 5J3HC 3LPPA 2CKBA 2A9DA 1DFBH 4NX0A 2P5PA 3U9PH 3W81A 1WZAA 2E27L 4XH2B 4JR9H 4HCGA 3GXTA 4ANUA 1JHLL 4BFFA 1BQRA 4NQCA 2YBGA 5EV7A 1JK8B 1BZOA 5AW5B 3ZT7A 2Q5BA 2HZHA 1AQDB 5E00B 4DETA 1U33A 1T80A 4OB5H 2W65A 4WUUB 4FQHA 1WC2A 2WLIB 1MELA 2I7SA 5DHYB 3QG6B 3TVMA 4FG0A 4H25B 2IALA 4ZUSB 3HZKA 4EDWH 5A2KH 4FP8H 4IBSA 3D09A 5JMRA 1TQSA 2ZKHL 3FXIC 4PYGA 3D9AL 3MRFA 4YK4C 4BZ1A 3APNA 4U1LB 4IBUA 2C45A 5KVEH 3DUHA 4AEIL 4FAAB 1G87A 2WW8A 2DMCA 1Q4NX 2WLYA 3HCVB 2QSCL 5AW8B 1KLFB 2ZOTA 5B7FA 2VLME 4UTAA 3CFEB 5C0AB 1UASA 4HGKC 3RBSA 4ALAL 3CFJA 4ZT1A 3QDAA 3DO3A 4K3DH 4ZSOB 3FHEA 1VJSA 4GBXD 4IOFD 5D9SA 1QZNA 1JXFA 2DB8A 4LF3A 1BYPA 4GY4A 1AO7B 3ET9F 3PQYE 1OAYH 3FCSB 1OTSC 3EBHA 3LZFL 5GZOD 3BO8B 1WWWX 3B9DA 2CIIB 4XOEA 2NDGA 2A6JB 4PWIA 4FLRA 4P5RA 1F5WA 2O5XH 4Y5VC 3RUGB 5D7SH 5H94A 3IDMB 2APVA 2IANA 4ICXA 4QRPA 4YHPB 4K3EH 4ODBD 2R59A 5IVXA 2MCG1 5DEZA 1ACYH 1T0NB 3QNFA 4PW9A 5SX5K 3SE6A 3MLRH 3UCRA 3KPQA 2Y4SA 5FO9A 5ITBH 5KVMC 5IB4B 2WBJB 3KBFA 2EDYA 2L04A 4KROB 1C7SA 1KQGA 2VLRA 3OZLA 1N7MH 3T08A 4LFHD 1HE8A 2FEEI 2YFNA 4JY6A 2NY1C 4PLKD 1V7NH 2ITDB 3A47A 3GZQA 1MJUH 3FPYA 2WQRA 1MFAL 3P77B 4OZGE 1Q9LA 3L95A 4PRHD 3JWOH 2HH0L 4YLQT 2V9RA 1JXJA 4H8WL 2EXWC 4BFKA 5IJVB 3TNMB 1IU1A 2DYSB 2ZD0A 2WZAA 1FNGB 3FYEB 4OM1H 1S3KL 5J12C 1LE9B 3B37A 1OAQH 1TLKA 3OLIA 5F9OH 5F71A 5D1ZA 2LU5A 1S7RA 4YK4B 2ALWA 4PWJA 4WI2A 4MJ6A 4WNJA 3PWNA 2QT6A 1UJ3C 3BDXA 1BAGA 1MF2H 3LKRA 3QPQC 1HHGB 4NT6B 1QNZL 3ZZQA 4QR7A 1S7WB 3GK8H 2ZX7A 5I8EA 2ZWYA 4X7TB 4W9JC 3FTGB 4JY4A 4XX5A 3D34A 5K1JA 1QZ1A 2FO1A 3DDFA 4XP4H 5EU4A 3O11A 1H5BC 1A7RL 2WWKT 3LCYA 1AXTL 4ELKA 2ESVE 1GZHC 3ZDWA 5KYNA 1OHQA 5SWSB 4H20L 1HH9A 2GG1A 1IVTA 3A5VA 4HHWA 5I16A 3DVIA 4JQXA 3U25A 1X6LA 4I5BA 3ZK0A 2JJWA 3QJQB 5FR3A 4ES9A 1HXKA 5J1AB 1QQDA 1WFTA 1A02N 5IQ9A 1ED3A 4FS0A 4N90D 4FXKA 1QW9A 2ODHA 3L2NA 4TNVK 5KOMC 1Z6JT 3GXUB 4ZD3H 4X5RA 4Y5VB 3U36A 3QUMA 3L95B 3QQ4A 5I15L 4GG6A 1OCZB 1F42A 2K3HA 2ITDA 3Q0HA 5T1LD 3JV6B 5HHNB 5GS3A 5B1JA 3ZKNC 1D6VH 3BIKB 3I3EA 4UT9H 5D1QD 4Z7OF 3EOBA 3MLVH 5KBLA 4N2HA 4K23H 5C0NC 3RPIB 1QTSA 3JV4A 1OL0A 2H1PL 2WBJC 3IDNA 3AREC 4YHYC 3VX0A 4AYSA 2BMKB 3BUBA 1VERA 3U1SH 2WWKO 3L1OL 5BO1H 3UIZA 4QY8A 2EDDA 2NY1B 4BWWA 3HHSB 4UQIM 3K6OA 1JV2B 2AANA 4KKCD 4YX2L 3EAKA 3VXOB 3BGMA 1CFBA 3BQUB 3EJJX 3RU8L 3HBGA 1CBJA 2ZPKL 2XX0A 5GGVY 5HHVL 3BWUF 2TSBA 3II2A 4N3TA 3U4EA 3ZO9A 2NXZD 4EQ3A 4LNVA 4J2XA 2AMGA 3QAZC 4A7QA 3V0HA 4KDLA 1PNDA 3ZE1E 1URZA 2X5PA 4ZUWA 3HG2A 5LAXA 3VX1A 2YRPA 1JCKA 3UG3A 1YPZB 3N42B 2OMWA 3O81A 3ROOA 1KB9K 3DOSB 2CO4A 1PJ9A 3V7MA 1FCGA 2C9PA 2DKMA 1MLBA 4KNTA 4FKHA 4JO2H 4YDIL 2A9NH 4NZFA 1G7QA 4KKLC 3IR7A 2X2JA 3JWOC 5HXMA 3QFJE 2EE3A 2Q7NA 1A4KA 5T1DH 5KG9A 2DLFH 2B39A 4UUJB 4Q74A 4X98B 2A77L 4LESA 1M4KA 2OTUB 2CHWA 1BF8A 1BVNT 5E8EB 4YZFE 3KLQA 5C2BL 3OKKB 2CGYA 3ZKMC 2WYZA 4L3CB 3Q6FA 4N22A 1NCNA 4IKIA 3VYPA 1V54B 2ARJB 1BD2B 2YD5A 5DLMH 4J2QA 3QQ9C 3QT2A 5K93A 3MRDA 4NQCE 1WS7A 1TF4A 5CZXC 1YYML 3MC0A 3RI5F 2DF3A 3BAYA 4P46D 1F13A 1OLZA 4MNGA 1R3IH 1ERNA 3Q1SL 2E6PA 3CPUA 1S5HA 4HWBL 1P5VB 5C0BB 4V33A 5CZVH 5L88L 3D4CA 4GKSB 4XP1H 3QCUL 2HN7B 3GMPB 3CHQA 1PY0A 1R1CA 4XOBA 7FABL 2EIZB 1XCWA 5INCB 3DXAE 3N43B 5EO0B 1BGXL 1IL1B 1J1PH 3MRGA 3V4LA 3D4ZA 2ZJSH 1N2RB 3LXBA 4NGHH 4K15A 1LP9F 4NZ8A 2RFXA 5ALBL 4HPHA 1E5CA 3RDTC 4KO9A 1G6RH 2IEPA 2OZ4A 3W57A 4Z8FL 4MFHA 3KNBA 3NG5A 4O2CB 1NGPH 3NFSL 3UP6A 2F5BL 2RAMA 1GOGA 4GP5B 3CFBB 1I3RB 1ZHNA 2AEQH 3JQOB 3E1ZA 3UYOD 4BQ9A 4MDIA 4YN3A 1VF5C 4ZS7H 4FZEL 2JTDA 4WWOA 1AR1B 1DL7L 4Y4KD 3HG4A 4RZCB 4Q6IB 5I82A 4KK5C 3TLRA 4O2FA 4OCXH 2HKFH 4KTDL 2BCKB 3Q1EA 3TN0A 1AGCA 3ECUA 4JKWA 2I85A 4OV5A 4G3YH 4HUWA 3DX6A 2GBTA 1MREH 3CX2A 1CLZL 2N56A 2CXKA 4JO2L 4J3XA 4DK6A 4G1MB 4C55A 1TSRA 4UQ3B 5CBAA 1CI5A 5EU6E 1WEJH 4APXA 1EAJA 1RZJL 2YUWA 1GGIH 2C3GA 3MZTA 1KTLA 3NCYS 3QRFM 5JDSA 1BFOA 4C56D 4WEBL 5L9DH 1W8EA 1BF5A 5T1DL 3DV6B 2ZCHL 3H7BA 4N5ED 2JB6A 2YD6A 1CFSB 1MFCL 4F9LA 3V52H 4JANB 3BUYA 3GUTA 4CGTA 3ZQWA 1MCRA 3FU8A 2Q8BL 1CL7I 3QNYA 2BERA 5F3BA 5T5MD 3BD5A 2NY4C 3EO9L 3HE7D 1XIWB 4WWID 4XPGL 1NFIA 1UOVA 4M5YH 4U7MA 1G9MC 3RWIA 1PSKH 3VXQB 2DQFB 4YXHL 2CO6B 3IWUA 2XKNA 4L3FA 2JK5A 5BRPA 4NAMA 5GGTA 5D7LB 1ZHKB 3OR6B 3N0PB 1SN5A 2WLKA 1J18A 4ORGA 4RAUB 4YWGH 3QFJB 5CJOL 1CGUA 4ZG1A 5TH2A 5JHLH 4D0BA 5D7LE 3T0DA 3W3BA 3OPUA 1JHTA 4R7DA 1MVYA 3QPXH 4LLDA 5E6IB 2YU9A 2PR4L 1UZ6E 3TV3L 4BZ1H 1PQHA 3T0BA 5L6YL 5EZOH 3TBYB 3FQTB 5E51A 1P6AB 3KVDD 4HH9B 3V4VB 3W5NA 1MREL 4M43H 4PU2A 4DKAA 1HQRB 2Z9TA 4X7EC 3EH1A 1RHHA 1XBDA 3MJ9A 4O9HL 5FYKU 1MCQA 3GBEA 4RSVA 5B1BB 2GJPA 2GI7A 2OL3B 1CC3A 2YAOA 5ALCH 3V0VB 1QR4A 2QVMA 1LDPH 5DMKB 2HLAA 1RJCA 2F6AA 4N8CL 2ZCHH 1ZT4B 1XZWA 3FJTA 4U05A 1GR7A 3V52L 3BP7B 2J73A 3HZMA 3LEVH 5IEHB 1I82A 3CDZB 3OLGA 1BW4A 2O26U 1A7PL 3QNZB 1LLAA 5AVRB 4NENB 3SGEI 3WEXA 3RWFA 4L0YA 4WTXA 2XQYG 2BSDA 5ACZA 5AFAA 2QTEA 2X1OA 3PDGA 5D1XA 2UXVA 1U95A 4Z3HA 3HBQA 2CE6A 3FZUC 4PJHB 25C8H 1JXKA 4U3HA 1L8FA 3X11A 43CAA 3MAWA 1RUKH 4F92B 1SJHB 4GP4B 3FO9A 1K2DB 3PDOB 3I85A 4NZDA 5E6IA 3LRHA 4ZX5A 2OZNA 2F2HA 5SX4H 5LNDA 4ABUA 5BVPH 4XPFL 3T8XA 3SE8L 4AYMC 5F93C 1ZT1A 2ZWNA 4A1RA 4W4OA 2NDFA 3VUAA 1CR9H 2BP8A 4C8XA 4FXKC 2DIBA 1U30A 2VDNB 5DHEA 1ODAA 1PU0A 4LPUA 5CJ8A 3WTXA 4PGCA 3QUHA 3FC8A 3VW3L 3VXQA 4Q2ZB 3FRPB 3UTOA 2HWZL 4LSSL 3S6CA 1OANA 3JTTA 5GXBB 3QIWD 5KW9H 2KBGA 2H32B 2VITB 2Q7YB 1U0QA 1TJHL 2D7PA 4FTVB 4R9HA 4NP4L 2ATKB 2M26A 2XXFA 4L9LB 5HY9B 1HYRC 4ODWB 2OTPA 4GRLB 2AW2A 1NAMH 2RCSL 4UANA 4APQD 4ZPVB 4LVHC 1P1ZB 3ZR6A 2X53A 5HJBA 5HHQA 1CGSL 5GGVH 4JFTA 5IMOA 5LGJA 1DJIA 5T3XD 1XVSA 2MQ0A 2X4QB 3IMWA 4MCYB 4R2GC 2F54A 2JB5L 4OFVA 2FEEL 3LQAL 4FQPA 5DLLA 5ABZA 3MREA 1CDIA 1FL3B 2DAVA 5F7BA 2KQAA 4NRXA 3ZBMA 3S5YA 3ULVE 4OQ1A 3RZWA 1KDIA 1S3KH 2QFPA 2HT4C 1E28A 3L13A 5I6MA 2CKBH 5D5MB 1BP3B 1X5JA 4MGXA 2CD0A 3CBKB 4R4BB 1KB3A 1ZK5A 4YSRA 3C9NB 4XCNA 4HV8A 3TNNA 5IBLD 5TF1H 1IAOB 3ZYZA 4QMEA 3QP3A 4Q9QL 2PNDA 2MKWA 4XMWA 4KUZH 5BV7B 1J5HA 4Y4FB 1CURA 4CU8A 5L2KB 5EUOE 2Y1AA 1RURH 1KT2A 3QXAB 4LDCA 2UWEF 4M8UA 1UVQA 1A22B 5AG8A 1OW0A 5EOCJ 3PAYA 5JQ6H 1QFWL 4HF5L 2YD1A 3UC2A 5LJYH 2ZUWA 3WKNA 5HY9A 4WI0A 4CNIB 4K3JL 1ZWIA 4HUKB 5EBWB 5I24A 3C8DA 4FTVA 3KLHC 5DJ8A 4GFXA 4RMSA 2VITA 4HCRH 1QLFA 2EVHA 1X5ZA 3VXSA 2HFGH 4KQ0A 4LRIA 5AYQA 3SE9H 3LJ3A 3HN5A 1J86A 3D18A 3Q6GL 3JTBA 2RD0A 4NQDD 3SSGA 4PGCB 5I6LA 2G5DA 3BZEB 4KLNA 2EDRA 2QPSA 3DMMB 4BH7B 3X1NA 1DDTA 1IARB 3VDBA 5EIIB 4WV1C 2Y7SA 2R4RH 3S96A 2HN7A 3GMPA 1IAIM 3P2DA 3UFIA 5JIDA 1AG6A 1OTSD 3NRPA 1TQCB 3E0GA 4FTDA 5GSVB 3FTUA 3MA9H 1G8JA 4JG1H 4AONB 1S5HB 3WLWC 4KV5F 2ATPB 1CD9B 4FNLL 4UAOC 1CDYA 5K59F 3RE0A 4PCKA 2APTA 1AIFB 4NKIH 4L1BA 3U9PL 3H3PH 2WZPA 1U95B 3GGWB 2E27H 3FH5A 4W9ZA 3GSNH 3EJPA 2L0DA 3I75B 1CS6A 2FNBA 4NQDB 3GWJA 5EN2A 4PHXA 1F02I 4AQZA 2ZOLA 43C9A 4IRZL 4E36A 3G6JE 4YSTA 3MNZA 3KLDA 5A2BA 4PH8A 3CVIH 3OKLB 1BZ9B 3FO2B 4HD5A 2FD6H 4HIJB 3KG5A 4NNPL 2ZWSA 4DUXA 2W0FA 3T4AA 2Y3AA 2ZE0A 5AVWB 1XGZA 4S0TD 4WO4D 2JCCF 3KPNA 3PQYD 3IJSB 1HEHC 1DBAH 1UCBH 3DYMA 3FUMA 4M7KL 4XCCH 1VCAA 4MDJB 3KCPA 3EFDH 1IEAB 1HHIA 1GAFH 2WUBL 3DSFH 3GRWL 5LGYA 1MFNA 3QIUD 1W0YT 1HTYA 2X6BA 4HIHA 1BMGA 3T0EE 4QHMA 5CAYB 5EEXA 2E3VA 3IDYC 3L5XH 4XBGA 1JHLH 1XMEB 4MJ5B 2YMOA 2NVXA 3BC9A 1WO2A 2BNQB 1U3ZA 4NO0B 1ZRUA 5FM4A 1A9VA 2GABA 4IQHA 4LLQA 2OR7A 3FQTA 5BRQA 2BNQE 3LIUA 3T3PB 2BNRD 4OKVB 1M53A 4YPJA 1JN6A 1LVEA 4H2AA 2H1PH 4J3OD 4UTAH 2RB8A 2NY0C 4TUJA 1BYOA 5E2UL 1HSAA 1RSYA 2XBZA 4QLRA 3WEMA 5PCYA 1OPGH 3GB7B 1INDL 1SXCA 3N85L 5FYJH 3OSKA 1Z2KA 1JV2A 2X87A 2J8UA 2DQJH 1MY7A 1ZD6A 1ZE3C 1A9BA 3MU3A 3UG5A 4MZ3A 1Q1JL 2XQBL 3ESOA 4AQ1A 1IBGL 3SZKC 1GGBH 3VMNA 4POUB 1XIWA 2R29L 3CHPA 2PJHB 5ELIA 3RPIA 1NZRA 1H19A 2B0SL 4W9IC 1G7MB 1KXQE 4H13C 1H5NA 3UGUA 3IRCA 5C08E 4DERA 1U8QB 1TVBB 3MUGA 3H55A 1GW0A 4MCZB 3P30H 3V55A 1CGWA 4D3CH 3BN9D 5A16A 4YNYA 5B38A 1N7ML 2R1XA 1XSOA 4GMSH 5JQHC 4L5FH 1MUJA 3SDDC 4H7VA 3L17A 3SHSA 4YQXH 2ENQA 1FP5A 1J1PL 3LQMA 2WXFA 4XAWL 3WY1A 4CJ0A 4HA1A 1IKFH 1YPZE 1KMGA 4YDNA 1MHCA 3VFRB 2MFNA 4HALA 2CZNA 3S36L 2QADB 1Q72H 3L6FB 3BAWA 3RAJL 5SWSA 3ML8A 3EO1B 4JFDD 4LU5L 4QCIA 1RKRA 1MCJA 1Y7VA 1X9LA 4OZ4B 5EOQL 4EIUA 1VGEL 4AYID 4FRWA 2WLLA 3CQPA 3AZUA 1WYJA 5LHDA 2ZOOA 4GOSA 2OSWA 1CGYA 3DXAA 1HDMB 2H6PB 5F7NC 3FONA 3IJEB 4WFGE 3RWCB 1KJMB 4EI5A 4U2YA 4AUUA 4V1DD 2ZXBA 3HS0B 3T0XA 5LBSL 4NNYB 1G7PA 2B1HL 2Y7MA 4KTEL 3ZUNC 1I8IB 1IQWL 3KNBB 4YSCA 3FQYA 4MNGE 1PYWA 3VCLA 4JFHD 2WXQA 3WEAA 2E7ZA 5HGDB 1QI4A 1JZJA 2DQUL 4WFHE 3P3YA 5C0BD 1G4RA 3WL9B 5D1ZI 5CHNA 2UZYA 1IX2A 5INCA 1BVLB 2I9TA 2ED6A 4ZMQA 1XGQB 4ERSL 2R93A 1RIHH 1P7QB 3BVTA 4YIQA 4FZ8H 3ULSB 4FABH 2CDFA 1AANA 1REIA 2HT3C 3PPSA 1KACB 1ZGLA 3IN2A 4NKDA 2R0WL 1DUZB 2FT7A 2OSLB 1RPKA 5MEPB 2BIMA 3HE6A 4NNXA 4WUKH 5J13B 2EVFA 3P0YL 3H42L 3EHBD 1DVTA 1AD0A 3B7UX 3RNKB 3PPEA 1WITA 2I24N 3L2LA 2O4EA 4GAJL 4YX2H 3EYFB 5ISZA 1JWSB 1HK6A 4KOBA 1JRHH 3MOBL 1P2CA 3LRKA 3SY0A 2UY7A 4LEBA 1MWAB 1J9SA 4N0FA 1LL1A 2WXHA 1GZHA 4UUJA 4PGDA 3NIFF 3U0PA 2WYIA 4ORZC 1N6VA 1BJ8A 4LAQL 3NACL 2Y1VA 4ZSOA 3ZRSA 4MCZA 1PZDA 5TDNA 1J05B 3D30A 3LNGA 1IM9B 4IKLA 5DD6A 1W16A 1XR9A 5DQJA 4R5VA 4CC1A 3QUXA 4M7JL 3KEHA 2XNAB 1RH8A 5I6XC 3K91A 1UKQA 4MX7B 1Y6NR 1E4XH 4P2QA 1T4KB 2V7NB 4DVRL 5IV2A 3QZWB 4DZ8A 3P40A 2FX7H 4DP4X 1T6BX 4XPBL 2KZ1B 2JTYA 2OQJB 4XXDB 5I74C 3FTZA 3KPPB 4ZNEA 1F90H 4A67A 2JKLA 2A68D 2WAHA 4KK5D 2P3YA 5CGBA 3U4EB 1OSZA 1B6UA 4QXUH 3WIHA 3BGMB 3BQUA 1MRDH 2IAAC 4WUUA 4IBYA 4IIQA 2NNRA 2E7MA 2XPGB 1XR8B 4LARL 3U48A 4YMPA 1CMOA 1RCYA 1JK8A 2CM5A 4Z7WB 1QRNA 3HPJA 4OR1A 2FLBT 1K8DB 1Z5LA 3PWPA 4NQTA 2FVNA 3BD4A 2HRPH 3IDNB 1IT9H 1XF5B 3PLXB 1FF5A 1TZHA 4KTEH 5CXPA 1FZMB 3BKJL 2VQ1A 1TSHA 3UEQA 3DBXB 4LP4A 3PHOB 2QL1A 3JV6A 1O7VA 1TTCA 1RUQH 2Z65C 5CD3B 3HEIB 2MRYA 2NZ9D 2WK2A 5D2LA 5G4NA 3IDXL 4FNUA 4B3VA 1ITBB 4PRIA 3L7EB 5F7EL 5I19L 2YLHA 1FV1A 4LMQI 4JJ5B 4K55A 3VXRD 3ZX1A 2AKRA 1PDKB 5HDRA 4QTIH 1F86A 3NZHL 1RFDH 1OY3B 1VENA 4P2OB 5F8QC 1P7KA 4JFOB 4M7JH 2ZJSL 4FFZA 3T2NL 5T1LB 3OKDA 1XIWC 5E03A 5J6SA 3HE7C 2QDVA 3TBCA 5LGHH 3OWRA 4PRNA 3F85A 4XHJD 3V6FB 5C2BH 2LLGA 1RK1A 2HRHA 5D6DC 3LMJL 1J0YA 1CDGA 4KH9A 1X3DA 5DVOA 2J12B 3FCTB 5AW4B 1R47A 2VUKA 2Z8VC 5AZ2H 5L88H 1AIFA 5LDSA 4L1LA 1JNHA 1U3YA 1PD0A 2ATPA 1NCOA 3QW9A 5C71A 1QVOA 3C5SA 2WXGA 4TUUA 3MTXA 4ZDHB 1F4WL 5DR5L 1JRHI 4I0PA 3N41F 1UD2A 1TZAA 3AT0A 3CH8A 1S7VB 4KK6D 5CNHA 3ZDXE 6CGTA 3T65B 2Y06H 3NCJL 4JUSA 2W07A 2YXFA 4NM8L 2E74C 3FAWA 3VRIA 5CGMA 2EDMA 1YEJH 2B4CH 1AGBA 2I69A 3A4DA 3HI5L 2VDNL 4TSBH 4YH6A 3VXPA 4JNXA 4P4KD 2V8LA 3VFUA 2XN9D 4DUVA 2IMMA 3VU1A 2ETWA 5E1GA 2AJZA 5F3HB 1Q9LB 4CSTA 2FT8A 1KTDA 1KJ2L 3LB6D 2QV2A 5ADOH 2DQHH 5JXEA 4MB1A 1WICA 1QFOA 4LDEB 3SQRA 3MQIA 3WE6A 4N9GA 3JVGC 5EHFA 5DMGD 2VMEA 3BRFA 4OJFH 2J1YA 3QUYB 4TOYH 4Y2LA 5E6RB 4JKKA 2X28A 2RJMA 3VD9A 4DGYL 3EFFA 2YPLA 4YDZA 4I18A 1KGUA 1KBWA 4HSCX 4PRPD 2OK0H 1YNLH 3OMNB 5INDB 4HUCA 5AB9A 2D73A 1PQEA 2WKLA 1QDNA 2IANB 3E9UA 3WI9A 3C5JB 3P3RA 3IJ9A 4K8RL 4KMTH 4I1NB 2DI8A 3RA7H 3IKCB 3L8QA 2JB5H 3EBIA 2E76C 4MKTA 3ENGA 2OMUB 3IDJB 4P2OC 1T1ZA 5CFAA 4TTDD 3TIEA 3HN3A 1DVZA 3S8FB 3PWVA 4MCYA 5HYIA 1WFJA 1DBML 4NZUH 1D6VL 4QYOB 2YEZA 1QBAA 5KYUA 1K85A 1EH9A 4DJMA 4PJXE 5KSVB 2OX5A 5DJAA 1GY1A 4MNHA 5ILTL 2ENSA 3SDAB 4H40A 1DQMH 2ATKA 2J8OA 3RIKA 4XC1H 1GTFA 1AP2A 2Y5TB 1W6LA 2ZUXA 5E1IA 5CBEB 4LP8A 5E8OB 3IXAB 3S3CB 3UEZA 2LAGB 2V33A 3MLUH 3UYPB 4GW1A 4AM0B 1DBJH 2J1WA 4GRLC 3K2MC 3PHQA 4PJFE 3PWUA 3CFTA 1N67A 3CFNA 4OVUA 3ARBD 1NLDH 4FQCL 1CL7H 4L29A 3NVQA 1RZKC 3OJVC 15C8L 3TVMB 1TCRA 3MRJA 2YPKA 5FOBB 1GCFA 1B0WA 1E27B 2B7DT 3NIDB 4PSRA 5EDXA 4S1QH 4S1SL 2FB4L 4GI9A 3LNDA 1DANT 3HG5A 4JQVA 2X12A 3A24A 5AUMB 5DJYA 3V5HB 3CC1A 4UZUA 2PPAA 3GHEH 4XH2A 3COOA 5C6TH 4A66A 5E08L 3IETB 2ZWKA 2C1PB 3BPCA 3O6FB 3TH3T 5ACZB 2JI1A 4JFEE 1YNTF 1ZMYA 3N06B 1YMMD 2BY2A 3QNZA 1KPVA 4XPFH 3RWGA 2E9IA 4BFGA 4HKZA 2J20A 2CPCA 4EEEA 2BE5D 3PL6C 2OJEB 3S0PA 4PBWD 2OSYA 4D9RE 2JXMA 4TNVF 2BRRL 2AZUA 5CBEA 3ULUH 4PCYA 5FTKA 4TQIA 4FYRA 3JV0A 1UOLA 1E9PB 2D3LA 3PS6A 5IQNA 3WNPA 1OALA 2C8NA 3Q2NA 5DWUL 2KZBA 3CDYA 3RGVD 4AGOA 1I7ZA 2R29H 3DNKA 2EEOB 2UZXB 1J1XH 1TQTA 1X5MA 3T5WA 1HQRA 2YEZB 4QYOA 2VAJA 4KKLD 4PVLA 4A39A 2BP0A 4P9MH 3V4VA 4JHUA 1FO0L 5IMKB 1QABA 3B9AA 2W1NA 4AIEA 1BQLH 4IGBB 4HP5A 3LXAA 3KGTA 2N7AA 5JIIA 1T5XA 2V9TA 2DQMA 3PXLA 3BQUC 3L3OA 3DJRA 2FAUA 4M61A 2JCWA 1VFMA 1RVFH 2WVTA 1RUKL 3Q48A 3RVWD 7PAZA 1YSOA 2AEOA 2HWZH 3FSWA 3QAZB 1XH3A 3CSBA 3ZGHA 2VDKB 2DMRA 1JGUL 3MJ9H 1B6DA 4MMZA 4LCIH 5CM1A 2DY2A 3QNXB 3DO4A 4BZ2H 2V8MA 2JKXA 3FF7A 1L6ZA 3GM0A 5BZWB 1SFHA 2VDQL 3KEDA 1EMTL 4H1LG 1MCBA 5L8JB 1HCVA 1U8HA 3PCYA 4JANA 4AUYA 1F3JA 1SLWA 4RRPM 4RESB 3EZ8A 4NQSA 2ZUVA 4O02B 3STLB 1SXZA 4X4KA 2O5JD 1QFUL 1EGJA 2W9EH 3GJFB 3F7QA 1KFAH 1P4BH 3HR5B 2FBJH 4APXB 1X7SA 1U93A 4GRWE 1JVLA 4XOAA 3QRGL 3ESUF 1C16B 5GS1A 3KBEA 5JOEA 1ZLWH 1GXEA 3VRIB 1RZIA 2J43A 1WDAA 3D4GA 4YSSA 1OGAE 1NGXB 4W6YB 3SE4C 4ZMVA 2ZX8A 5HBBA 1X7QB 5DZOA 2VZ1A 2BCKA 1JZGA 5FDYA 1V3LA 3UAJD 4M61B 5IHZB 5B8CC 1CXLA 2IH9A 1H3UA 1TVHB 4R3SA 3X2KA 4FFVD 3HMWL 1T5XB 1M2VA 1LEGA 3B1UA 4FNTA 3A4AA 2A6KB 2I27N 3Q8FA 1ADWA 1H3VA 2R2BB 5IVXF 4YSQA 4ZI8A 1SOKA 2O61B 4PREB 3WG7B 1FZKA 1PT0A 1WV7T 2JWYA 1E3FA 4F7MA 2C3VB 1WGOA 2FWOB 4L5FE 4OLZH 4F7PB 3LH9A 4YC2B 3NIDE 4JP6A 4CC4A 4TVPD 4A7GF 3OKDB 4KQ3L 3HKZA 3OAZH 3WXWL 1NCIA 4P2OA 2H47C 4P5MB 4TQEH 2BNQD 2V6HA 1OT4A 2V7HB 3IU3B 4H26A 1H3TA 1WSST 4B6ZA 4TPRH 1L9QA 3L7EA 1INQA 3FHAA 3AWEA 3WMSA 1F56A 2NSMA 2VDMH 4I48A 3HVNA 1A7BA 1AZRA 4PG9A 2A0LD 3QDJD 4ZZFA 4XMUA 1N6QL 4AX3A 4OJCA 1YN7A 1A64A 1L0XA 3IPFA 3ETBF 4JPKL 5ECJE 4ELDA 2BLFA 1KULA 2BJML 4XNYH 1SDDA 5CLXA 1GJWA 1J8HD 4LSPH 1H6UA 3CUPA 4JN2A 1P6WA 1PCSA 5I1LA 3CQZA 1PZ3A 1L7TL 2X7LA 2F74A 3N9GH 4GT0A 3P3TA 3VXUD 4BSWB 1GKEA 1T7ZA 1A14L 3VGFA 4JFPB 2E7LC 1G9NH 1AHMA 2XJLA 2OSXA 1ASPA 3K8LA 4M8VA 1R9FA 3K2IA 1DVUA 5K1VA 5E2UH 4AJWA 3D4YA 4B9CA 4N0UE 3CV5A 1SEQH 4OLZL 1WHOA 2PICA 4CU6A 3D48R 2JIXB 5JXAL 5GZOC 1USZA 1TZGL 4JPIB 1L4IA 1X9UA 1NCDH 4ZRGA 4PJXA 3RDTA 1T3FB 2ZCZA 2E4TA 4OI8A 25C8L 3SDAA 1GGBL 1CD1B 2B59B 4UT7L 6FABH 5CSZB 1G7QB 5SWZD 2HYMA 3N1QC 1RJZA 4EKJA 1E32A 4GUQA 2A4ZA 5LWYH 2AQTA 4XX1E 3O4OC 1Q0YH 4HKXB 3DOSA 3ROOB 3T3MB 4WSJA 5BRZE 3LPFA 5CJ5A 1P2CB 2W94A 4KK8D 3C8KA 3ZR5A 4WFGD 1PFOA 1PX8A 3IS0X 1U92A 5EWIH 1R3HB 5FWQA 1JNLL 1G1YA 1ROCA 1RERA 4FLOA 2HMID 1FFPB 1JPEA 3AS3A 1F90L 3PJSA 4BDVA 1CICB 3MYJA 4HJJH 5D7JB 1FO0A 1NBVL 4JO1L 2EKSA 2G2NA 4MXWH 5DRNB 5IB2B 2VXTH 3QR1A 4NZTL 3ZZLA 2YRLA 5EZLA 2KQMA 4LEOA 4MHHI 4P59H 5CLWA 1FAIL 1X9QA 4Y4KB 1NLBH 3IJYB 3ARDC 4XX1G 3LN4A 1FYTE 3TCLA 1S6NA 4J3OH 3VXUB 4N0UA 2CDFB 1MRCH 4XO8A 2NY3D 1KC5H 4HULB 4ZO6A 4NQED 1GH7A 5E8NA 4LPYA 4M4PA 4ZFOA 2H26B 5EEWA 4O51A 4CKQA 4KJPC 5IT2L 2OAAA 2IOIA 3R4DA 4PJ6A 3CDFA 4XNMB 2R69H 2NX5B 1QWHA 4YHNB 3D50A 4N20A 1JTOA 4I2XE 4Y1AD 4ZMTA 2CPUA 3MLVL 7CGTA 4JFDA 5C0RL 1SJXA 3MLXH 4Z3FA 4FLQA 5KSUB 1NJ9A 2W07B 3MRPA 3L3JA 3D33A 1ASQA 5L2JB 1NEZB 3WJLA 5ES4B 1KJMA 3KW7A 4EI5B 1UGNA 4P57B 3I2CL 4B9PA 2XYBA 1GMEA 4JY4B 3NFPB 4XCYA 2IAMA 1QBML 4IJ3B 2ICES 3ZDZF 1KBKA 2W60A 2NTFA 2VGLM 5BCAA 5CU9A 1SBSL 3I6GA 4KKRA 2FJFA 4JM2C 3C5ZB 2DLTA 4HFUH 1AO7D 3DX2A 4Y2NA 1NBVH 3U1SL 1U3HD 1CK0H 3V6FA 1WA2X 5DFVD 1MEXH 1XF4A 2YKKA 3R18A 1YQVH 4NUMA 4XMLL 3OJDB 5DVKA 2HXAA 5ERWB 3NGBB 5D1XC 3Q6GH 5D7IB 3D3VA 3RIFF 4HZ1A 4PCSA 4A7SA 4OLUL 4E41B 5D2LE 4Z3TA 1NTDA 2UY6A 1MUJB 1WZMA 1PCXA 4J3WA 2B1HH 1RZQA 5D7IE 3IMTA 4YNYB 4E9LA 5B38B 4PV9A 3WJJA 3GI8H 4JX0A 1A6TB 5BOZG 3HI5H 4U1IB 1TVBA 1U8QA 3MUGB 3TWYA 5E9DE 1BLNB 4M56A 5C07E 5CILH 4J12A 4G9DB 5LBSH 3ARFA 5TGBB 2VH5L 4LKXB 1XX9C 4DOHB 3HLKA 3BISA 4PJEF 1S7UA 4N68A 4UV7L 2HX9A 4PVMA 1RIHL 3B43A 3DMRA 2WCGA 4JB9H 5IVXB 1ECYA 1TU2B 5IM7A 3PHAA 3V6BR 1TQBB 3P9MB 3GYRA 2O5ZL 3FRUB 3ISYA 2NY6B 4NC2B 4ZS6D 4JDTL 3T3ME 1H0DA 4NN5C 3D39D 4XP5L 4M29A 3D25B 5D6CA 4PRHB 4LAJH 4P3DA 5E8PB 1ET5A 1WT5C 4XP6H 1TXKA 2X4SB 4XODA 4AMKL 2Z0UA 2BP3A 1U8CA 3S37X 4G8IA 3WNNA 5D72H 3ZHDA 5IMMA 1RZ8B 5HHXL 4EI5C 4JKNA 4G9DA 1YEWA 2H8PB 1FL6B 3RHWK 3OSVA 4Y8AA 4AAYA 5EF2A 2WPGA 5CSZA 4FQLH 1MHPH 4QRTB 3WELA 1J05A 4Z7QB 1T3FA 5C0AA 1A6TA 1WCBB 2GY7B 5AEAA 4F37F 4M8RA 2B3RA 1NANI 5CCJA 3UZEA 3H0TB 1GGUA 5HHOE 4ZMNA 2DJSA 2A2QT 4JRXA 4OY9A 3QUKA 1OF0A 2BVYA 1KTKE 2AJYH 3EYFA 5ISZB 5JR1L 3OJDA 3X2QB 1FFNA 3RY4A 1PEWA 5DC4B 4AOKB 4NQDA 1GS8A 2MHAA 1H5BA 1HSBB 3HC3L 2CDEB 4FHJA 4PEEA 5DHYA 3SDAC 1I9EA 1OAXH 2LTQC 4AT6A 3CU1A 2D03L 1KN2H 1ZLWK 1IAMA 2W60B 3MRQB 2UZIH 2J4WH 4A2DA 1SZNA 4Y1TA 4ZAKA 2WSPA 3HU2A 3TO4A 5EORH 4NKDB 1QD0A 2IAMB 4XCYB 3VI3A 2PPFA 2ZXWB 1UQSA 4DHLA 3L3HA 5GRJH 3RFZA 5HGBB 4W93A 3LH8A 3BUIA 1IC5H 4R5TA 2X2HA 2DYPD 1NEZA 4RLDA 5ADPH 2Q9OA 3GMNA 5KSBF 3E7JA 5K5YA 4CN6A 1M2OA 5B38G 2BX5A 4JFEA 1UB5A 2VJ0A 1UH4A 4FCHA 4HK3J 4KODA 1ZV2A 2IGLA 3V6ZB 4IBQA 2W95A 3T6WA 1UEMA 3ARBC 4GPVA 1D5MA 4OFDA 3S35X 3BRGC 4J1UA 5JOPE 1UB6B 4RGMC 3ZE1F 3UBHA 4YHIB 2FATL 1JGUH 3FSOA 3MNVB 4PP2B 1LEKB 2CJ3A 3Q2CA 4MVBD 3T8VA 7PCYA 3CQFA 1GGCL 2DWYA 4DVBA 3KXFD 2FUQA 4GRMB 1WAEA 3CSYB 3HS0A 4HJ1A 4N1EA 4WW2B 1J7VR 2IWFA 3OPZL 2HCZX 2W81C 4KKNA 3LN4B 3TCLB 3VXUA 5D7JD 5HHOA 1KJ2H 1CE1L 1BECA 1YJDH 2O5NA 3FONB 3GHBL 3Q2VA 4MNQD 5A3IC 3EOAA 3RVUD 2WB7A 4AYFB 4DZBB 5DDHB 4FYSA 4B3EA 3TVMC 5CJOH 1BHGA 1B0GA 1KEGH 1RMFH 3VYNA 4S2SB 4GSRA 4C4UA 1B0RA 2VDRL 4PJIB 4OZ4A 1JZ3A 4WGKA 1JF5A 3K6NA 3GXIA 1FSKC 3LEYH 2XKSA 3RIAF 4H2CA 4PJIE 4B60A 1WHPA 2G3NA 3VG0H 4LMQE 4A38A 5HDBB 3KJ6H 5A43C 1E5ZA 2W8CA 1WJ3A 4UQBA 4N86A 3MUHL 3TPKA 1VEOA 4KROC 2GEQA 3W0WB 2GVYA 4NXSA 4KRMB 1KG0B 3N0AA 4E5XB 2VW4A 4FOMA 1RJZB 4BZ1L 2WBXA 3K1KC 5TE4H 2W9LA 4K4KA 3A3YB 4URTB 5AB1A 3WFCH 2EYTA 4X4YB 1PBYA 3CZLA 1QSFE 1XSJA 4L23A 2VDQH 5HD8D 2Y6TE 2VZ3A 5C0DA 2WYTA 1FRGL 1YNKH 1G0YR 1ZLDA 4JRWA 4KC3B 2ENYA 3L4CA 3OMZA 4NEHB 2XRAH 4NHUA 4NJ9H 3ZHLA 3UO1H 2ZUQB 4LVHB 4CDHA 1KYUA 3L08A 3LKPA 1TIUA 3QUMH 4NOBA 1NMAL 5BZZA 1A9BB 1BIIB 5HJDA 3WDIA 4BM7A 2WSDA 5KBDA 1XEDA 3P73B 2D03H 3JSSA 1F1DA 5DD1L 3SGKC 4M48H 4UQAA 4TUJB 1TMQA 1WUNT 5KVDL 1HYSD 2F53D 3O9WB 4OFQA 3FQXA 5IJKA 2ZIDA 1SJHA 4HD9A 3ELAT 2L7QA 4EN3A 1NC4A 1K8IA 3VFOA 2AFNA 4WNSA 3UJJH 1FGNH 3IF1B 3ZQXA 3ABMB 1D5XB 3NDYE 2X3AA 3LN5B 1BW8A 2PPDA 2BJMH 4XNYL 4WWKD 5AVYB 4BK5A 1I9IH 5A2AA 2AI0L 2VQUA 3RWJB 1I7ZB 1GGTA 4G6AC 4GRWH 1KEMH 5CUSL 3QCTH 1XF2B 1DQQB 1FNEA 3CH1A 1GS6X 5CIPH 2JIMA 3KCPB 4AL8C 1NLDL 2X4OA 4FQCH 2AXWA 4LIQE 3S8WA 1UXSB 3O6ML 2X4TA 4F2EA 2E7CA 3RUGF 3B2XA 4X6CA 5LB1A 3UPRA 5DFVC 1G7LA 1BZ9A 1T21A 3FO2A 2H6UA 4HIJA 3ZDXB 1L9MA 3MGAA 4G11A 2J44A 3IM1A 4ECNA 3SPCA 2AJVL 4CU7A 1BG1A 3ML1A 4DGWC 5EB9A 4YFLF 2C3VA 3FYIB 2CNYA 2CWRA 4KO6A 3ZKSD 5AKSA 2UX6A 5JA9A 3MSPA 3NSFA 1MHHB 5I6OA 4IBVA 3LEXB 1OSYA 4K94H 3U0TA 1S7SA 3HFFA 2UVFA 5BVPL 4K3GA 1AXIB 2JIOA 4CAGA 3VYOA 3FQUB 2K9FB 3FQXB 5LLIC 5J13C 1JHTB 2ZUTA 4KXZI 1UWEL 4YDJA 1A6VL 4JO4L 1X7QA 2YWYA 3NK3A 3KYNB 3UAEA 1MZYA 5C97A 1IFGA 1NWOA 4CVUA 1KJ2B 3QJUB 3LRSA 4ALAC 5I1IL 4CRYG 3N6YA 2MPVA 5FTNA 4ODTL 4R26L 3UPCA 5JQ6L 5LCVA 5DJ0A 5CSBA 4OGYL 1U93B 5FFLA 3D51A 3PWPE 3OUGA 1YEDA 4OAWB 2OXHA 4OW6A 2Y5TA 4HJJL 1FC1A 5FM5M 4LCCB 4KDTA 5DVPA 1MIEH 1VACB 1OT1A 3B56A 2H9GB 5EPMB 5KSVA 1PSKL 5B7MA 3HE6D 1YEIL 3VFMB 1RZFL 1QSFA 2R92A 5C18A 1PQZB 3RTQD 1EEYA 4GUPA 4QHNA 3I9IA 3N43F 3BT2L 3TM7B 3VGAB 4AYGA 2NNCA 3QYCA 3DRQA 4KZDH 4AH2B 3KBHE 2VJ8A 5AAMA 3ERXA 1MN4A 3F3HA 5K9JL 2NY0B 4OV5B 4JGNA 2VDQB 2X89D 1YEJL 2WOYA 1K4CA 1ZA3A 4GXUM 3MLXL 1MW1A 2R23B 1HESA 4K94C 4OGAD 4W9DC 1V3MA 3WNOA 4G42B 4MJIE 4ZW5A 2QHRH 3HIZA 4GW4B 4RMWA 4GA5A 5ADOL 3WHXA 1DVFD 2BP0B 5C2UB 4EUPA 1IZKA 4BK5C 4PJCE 1T04A 2W38A 2WLJA 3WGVB 3S7GA 1N64H 4NP9A 3O8XD 4Q6YA 3CSYA 4XAKD 2KLSA 2IDUA 3A4EA 4Q4IA 1A6PA 3QDJE 5TK2A 3ZTNH 4O4YH 1E4WL 1SJEA 2LLLA 5TQ0H 1CG9A 1EANA 2XCMC 1IBZA 2AJZB 3MNVA 2EUZA 3Q7JA 1BFSA 2JJSC 2JXMB 4XNDA 1UB6A 3EYVB 3CX5K 3EGDA 3QI9B 4NHCH 3A6BL 2ZSVA 1HXMA 1MY5A 4HCFA 2UV3A 1XL6A 2GBUA 3ARDB 3DHUA 3GSUB 1ZIAA 4JFEB 4WY7H 5EULV 3LRSB 3N3EA 4ZUVB 1UEYA 4ONGL 2ENGA 2GQHA 2BP8B 3H2WA 3V4VL 3T65A 3OF6A 1BVOA 5DK2A 2EUVA 4CMHB 4MS8C 3NSDA 2VISB 4UV4H 4NRYB 3HC2A 2WMPA 5GRVL 4CMMB 1ZGLM 1MF2L 4UOZA 2A73A 2XTSA 3FDWA 2EINB 4QHLA 1YEFL 2ZYRA 4YDLC 3DTDA 1DQML 4AV5A 5AWNL 1DR9A 2B9BA 2OYMA 1MFEH 2WVUA 5EG6C 3VVVA 2YXVA 3DVGA 4POZC 1JERA 5MI0B 1ILSA 3RWFB 4IBWA 1VHPA 4JM4L 1QUNB 1D2PA 2NXZB 2LVCA 4HW6A 5IEHA 3UPRB 2IQAA 3T4YB 1F4YL 5I5JA 1DVFA 5T1KA 4D0DB 3UYPA 1YQVL 4IJ3C 1F58L 3ZDYF 1UH3A 4LRIC 1ZTMA 3JT2A 4BBWA 4XP5H 1WLHA 2YD2A 5JZ7D 4OLWH 3MPCA 3VDCA 4R7XA 1LMIA 2V5SA 4OV6F 3VXRB 3JTSB 4MQXC 1CGSH 3CFCL 2ATAA 4TVSa 3V4PB 4OGQC 4PAZA 4NQVB 2DBLL 3FCGA 1O5DT 1FHNA 4L3ED 5SWSE 5C0AE 2GC4C 4CUCA 1SQ2N 2CCWA 3LN5A 3MUZ1 2CLVB 1F3RB 3SJVD 1L7TH 1U8JB 3N9GL 3O3BA 1ND0A 4NOHA 1P6FA 2X4SA 5LAXB 4FFTA 3NA9H 5KS9F 1NA8A 1H0DB 5I71C 5L2KD 1OCCB 1BJMA 1IZJA 3HFMH 1KNOB 2CRZA 2X0VA 4K2UL 3DJTA 5IBTH 4G8GD 5E4IA 5GRYA 3OKNB 4NQEE 5JXEC 4PRID 4AVKA 3R06A 1ZHKA 3KPPA 1TU2A 4KXDA 5IM7B 3S5LB 3ZZSA 5C07B 4AEFA 4F15C 1MIMH 4NWTH 4B97A 2IG2H 2EXYC 3VA6A 1MCLA 2IGFH 2GHZA 2X40A 3EH4B 5T1MB 4MX7A 4P2QB 1ZXQA 2MOVA 3NEXA 5DMIH 3CFIC 4PJ7A 3TYGH 4ANVA 3MXWH 2EVIA 1A8JH 2CQVA 1JZ6A 2APXA 3G5ZB 2ZSWB 1IM9A 2BS71 2XX1A 4U1GC 3GSOB 4XBEH 2B2XL 5I0YA 1GMIA 4KVNL 1UWXH 1JBJA 4G71B 4P5TB 1KZQA 4ZOCA 2QSCH 1AC6A 3S5LG 5E9DA 2XN9A 4HU8A 3UGEA 1N19A 3E9TA 3HB3B 1FDOA 1DJYA 2UY6B 1VFBB 3KPOA 3ZE1B 1P69B 3WMQA 1ED3B 4LSVH 1QLEB 2JCCE 3R0MA 2OBGA 3Q13A 2VN5A 4KNUA 1QSVA 1TLMA 3B2UC 2VIRB 2ESVD 4XVSH 3OHXA 1MAKA 4ZXBB 3D3VE 5KVFH 1S9VB 1ZK9A 2VDOL 1YCSA 1OCOB 4NZTH 3RFZC 3O11B 5KBPA 4O2FB 2IFFH 3IGFA 3CVCA 4RDQF 3GTKA 4OGXH 1QVOB 4U7KA 1PZAA 4ERSH 5ID1A 4G8FB 1E65A 5EU3B 4HYTB 3ZQ9A 4JZJC 2YUJA 1C12A 1JNLH 4M02A 4Z7WF 2EQDA 4HUVB 3CVIL 3QI9D 4PJFF 1JRHL 4QXTA 3LZNA 2IAND 2AEWA 4GBXA 4LCYB 5GSRA 5BW7A 4MJ6B 4XTRC 4OD3H 5D2NC 1H3GA 3SE9L 4BQBA 1VGKA 4S1DD 5KSUA 3CXDH 3ENEA 2WBWB 4ETQB 5I71B 1LE9A 4PJ5B 5ADPL 4UF7C 1A1MA 5IMLA 2MNWA 4AV4A 4MQTB 5C0FB 4L9LC 5HGDA 2HTLD 2GY5A 5PAZA 4JQVC 1AGEA 3B5HA 4LASL 2IAMC 1K9TA 3MCKA 1P84J 3ETTA 2QMKA 2CJTA 4M3HA 1EZSA 1FFOA 1X5LA 4ZFOB 4WV1A 1QA9B 1M6UA 4IU3B 4O00A 5E9NA 5ALBH 1ES0B 4OU3A 4K73A 3O2VH 4XN1A 3GSWA 3NA9L 4PB0H 4ZX6A 3FMGH 5F6IB 1BCIA 2WBJA 4MLIA 1U8MB 4GKNA 4WFFE 4FNQA 3DXAD 4HK0B 5EZLB 4BHUI 2EECA 5L8KB 4TVPL 1UOKA 3POCA 1SYSB 4ZAKB 2KDYA 4FFZL 3DHJA 5IFHL 1QNZH 4KJQC 1CICA 4Q6KA 5AW1B 5SWQB 3G9VA 3ULUC 3GK8L 4Y4HC 1S9YB 4IM8A 5HI3C 1XAUA 1ZVSA 2I9LA 3IRZA 4N2IA 3QJSB 2GI0A 4OLUH 4P2RB 4KX8A 4JB9L 4I3RL 3KE0A 1IEHA 1OSEA 3IFNH 1MCIA 1O75A 2XG5A 5CZVL 1WA1X 2YC1A 3ZLQC 4JQXC 3QUKB 1IGTA 1P4IL 4N2KA 1FDLH 4WCYH 5JOFA 2D8KA 2UUDH 5E8EA 3L4VA 1J0JA 3B9EA 3JXAA 4A2LA 1L0PA 1UENA 1W6WA 2J2ZA 5E4AA 3H0TA 1FH5L 4LSRH 5I9QB 3P30L 1OM3L 3QJRB 5CILL 1QW8A 3ARGA 2QHLA 4ZAKD 3QUXB 2IADA 3FN0L 4DO4A 3L4YA 5DS2A 4NGHL 1DUYB 1VFUA 4D9QD 3K0WA 5IR1A 2RHEA 1I1AB 4K8RC 2MNUA 2H8PA 3PYCA 2EXSA 1Y6MR 3TA3D 3IAPA 5E5UB 2NYYC 2FT6A 3DK2A 3G3LA 1RHFA 5K33A 3DA0A 5HDBE 4N8PA 3VD4A 1IGTB 1OAUL 3PWLA 3DI2B 4KPHL 4A2FA 3L9EA 3CE1A 4M6ML 4AKQA 2NPLX 3GSVA 3P0VH 2WANA 3WCYA 1DMSA 4F57H 1C8PA 5T33L 3NH7L 4HWEL 4J3BA 2D7TH 1HSAB 3AXIA 2P8MB 3VXOA 2UVEA 5EEYA 3E8VA 2OJZL 2J6EH 1JN6B 1ZVNA 1IBFA 3RLSA 5FM5O 3EH3B 3WTSA 1D5IH 2JCCB 4IRJC 3V6OE 1DCEA 1I4FA 4YGVB 1BOYA 5GJTH 2E59A 2ZF8A 2O6EA 3AFLA 5F6IC 2XQYA 4HPYH 5TGBA 5GRXG 3D5OF 2X1QA 1QLEL 3KXFE 3OXSA 3WN6A 4PG9B 1HZHH 2QPEB 3HRPA 4FJZA 3S34H 1UXMA 4AQOA 1EO8L 2UZYB 1CFTA 1CIUA 1GZQB 1V7MH 1E6OL 5HYFA 1WS8A 3BFWA 3OG4B 4NAQA 5KSBB 5AL8A 4Y16B 3CLEL 1A1MB 1RIVH 4KAQH 5KANI 4GKZB 1G9HA 3OV6A 1VIWA 1HL5A 4Y4FD 4JFYA 5FA3B 1JZ8A 2VPZA 3F62A 4X8GA 4ZK8A 2F08A 3CX5J 1LJMA 4WI6A 3NABL 2AV7B 5J4MA 5HJ3A 4KVPA 4DO5A 4NO2B 4C57C 1EXGA 4DP5X 5EU4B 3S3DB 1O6TA 4HUVA 3C60B 2B77A 2YOAA 5SV4A 4DGUA 3CJJA 2YWZA 1NUNB 4X7TA 3ZHFA 2KI6A 4TSCL 2P24B 5ID1B 4JMNA 3PGDA 4OJFL 4XVOA 4CRZA 4R3SB 5BXFA 4NM8H 2YZ8A 4CSPA 4KJYB 3PAVA 4FJ6A 4OD2A 5BQ7B 3LKRB 3SGKA 2MSPA 4LIQH 5AG9A 2Z4QA 4MDRA 3OKYA 2QJDA 4H8QA 3FO1A 1MOEA 2FYYA 4M43L 3GBLA 5C3IA 3KVQA 1OGAA 5GPRA 1ADQH 3CFKB 2WWOA 4OZGA 1FNGA 4KWUA 4AVHA 4EI6A 4OSUL 4GAGH 4EN3C 2G3XA 5H4ZA 1AFVH 5CN2A 2XG4A 3DROB 4M1GL 5DJ8B 4PTTB 1TWGA 1UADC 5IREA 3GBDA 5EBWA 1WFUA 5E8NB 2HFTA 4YHKH 1YEHH 4U2ZA 4P2CG 4XMVA 4LQ1A 5L8LB 2WINA 1EO7A 4PR5A 4Z7QF 4Z8FH 4RRPA 4F93B 1EJOH 4PHZA 3BIBX 1UVQB 5IB4A 4FQIH 1FG2A 3IJYA 2VZTA 3NFSH 4OI9A 2GJZB 1X5XA 4PJ7B 1G9NC 4Y4FA 5D7KD 4RFNC 2CW0D 5T1MA 4MD4A 5C92A 1S2EA 1XTMA 2Y2TA 3MYJB 5A2IH 5BZDB 3W9EA 1NM9A 4QRPB 4PG2A 2V5MA 2F7IA 3VQ1C 1G1OA 1EZVX 1AVAA 5F7UA 3H9SE 2V5TA 5D1ZD 1D7FA 1TQUA 3AWFA 4OLXH 5I1JL 2BZCA 3QCUH 1M05A 3V0AC 3GO1L 2B3IA 5KANG 4TULH 1U2HA 2X4QA 4U49A 4B9JA 2WBKA 4M48L 1JYNA 3MJ6A 1G5GA 4Y4KC 2VPWA 1CLZH 4LEXH 2KLTA 4IHOB 1EAQA 5HVFB 2QADC 1DQDH 3VACA 3S35H 5I76B 5FKAB 1BPVA 2CAKA 5KN5B 1PPIA 1FGNL 2FLRT 2YA1A 3QUML 3ZTCC 3HMXH 1G1KA 3A22A 5ICUA 3F6IA 4Z0BL 4HIHB 1MFEL 1YMHB 3I6SA 2BK8A 1PQFA 1XGPB 5C0EB 3GTNA 4XWGH 2ICEC 2R2CA 2P44B 3L81A 4LLYA 3KXFB 1KPVB 1KPRA 4ZQKB 1ZSDB 1QTYT 3AM8C 3WBDA 3RX5A 3ULUD 1FGVH 2WO2B 2WXIA 3PDDA 5D70H 4KZCA 4HT1L 4BSWA 4I0PC 3ULUL 2HAZA 1OB1A 3T8XB 1AACA 1J5CA 5E0FA 4FQHB 4JAMB 3NCCB 2A6IB 4F7TA 2EVJA 3V0IA 4JN2B 4P07A 4WK4B 3ZKXB 1G6RB 4MZIA 5AUMA 3V5HA 3ZMRA 5F7HA 5BUPA 4JS7A 3ALXA 3QUZA 4LCWD 1DO6A 1P5UC 4AVIA 1GZPA 5ANMA 4JRYD 4P4RA 1A25A 1KENH 4ZUVA 4TQ8A 3WTWA 1NDMA 2FQDA 2VKWA 3LDBB 4YC2C 3ZXAC 3UOAB 4F27A 3PHQB 3QC5X 4XVTH 3FAXA 1DQJA 1NPUA 1BFVH 2V7HA 3K3QA 4AW7A 4KKAC 2FR4B 4I7ZC 2DRUA 3CHSA 5B3SB 4S1DC 4P5MA 4H8VA 1KTJA 2DM3A 4LKCA 4PJFA 3BWAB 1PD1A 1JGLH 1TJIH 3QHZH 4CKVX 5LNGA 2Z35A 4AL8L 1IGCL 5DFWH 3LKOB 4HCRL 2Q6WA 2D31A 1ZHBA 1BQLL 4DWHA 1A47A 1EMTH 3LTVA 4LQFH 3NSYA 4Y2DB 1FIGH 2AHIA 2FQEA 4IRSD 2WLHA 4OCWL 3C8HA 4Z3EA 3CSTA 1RUPH 4XN7A 1OA7A 2VDLH 5KS9B 1IAOA 1LO0L 2CMRL 4HV8B 4WVRA 2E2IA 3TNNB 2DTMH 5F9WC 5C08A 1EHKB 2AEPL 3Q44A 1LNUB 2GAZA 2VXQA 4GAYA 3MLWL 2CIKA 4KFZC 4IS6A 4MMYA 1E28B 3T0EB 1LO3L 1QG3A 4FX5A 3AY2A 4HSAC 4JDVA 1CVRA 1HX0A 3CZFA 2YD7A 4MXVF 1NGYA 1C16A 1BF2A 3I9GH 1MDAA 5LCVH 2EIJB 4WHYG 3ISRA 5TF0A 4NWUL 3VM7A 2JKIS 3VU2A 2DQHL 1KENL 3FCBA 5DJZA 1T89A 5DHVA 1OARH 3SBPA 1BX2B 4CVZA 4HISA 4DFHA 3QNYB 3QUYA 2A6HD 2XTLA 2Y24A 3O2WL 3V9CA 3NMEA 4GRLA 3X3FL 1QWNA 2QEJA 3TTYA 2WINB 2WBJD 1F3JB 5F7WC 2H9GA 5EPMA 2X4UB 3DV6A 3H7BB 5EZPA 2G60H 2JIQA 4LCCA 4F33B 5F3HA 3KR3H 3EUDA 4E2OA 1AHKA 1X5AA 2MOQA 3MRNB 4OAWA 5IB5B 5BZWA 3VGEA 5T5NF 4CVZB 3H9YA 5KTEH 3WS6C 5DJZB 4O02H 5CLZA 4MMZB 1MI5E 5KWYC 4CL7A 1PVHA 3LDBC 3LHPL 4F8LA 5GS0L 2X6CA 2BDNH 1MWAH 4MA7L 5FGCE 2BFGA 2Z4QB 3RNQB 3LRMA 1S7VA 1KOAA 3T0EA 1CDBA 3CD4A 3HI1A 3CZKA 4GIOA 4QT5B 2JELH 4D8OA 5AKRA 4A2MA 3BESR 4ZDHA 4AQ8C 4MS6A 1JXDA 4R8WL 3SYOA 4HU2A 1NANH 5AVSB 4X9FA 3C5XA 43CAB 4NUJA 3OXRA 3V8CA 4H8HA 4WDIB 4DK5A 5KVGL 1MHHA 2VC2H 3ROLB 4I2XB 1Q9KB 1GC1L 1EUUA 4FQQA 4PJ8B 3D2TA 3DI3B 4X6FA 5AAWC 3PABB 2X4RB 3MRLB 1YZZA 1ZHBB 4HWBA 4RFEB 4P9HL 2BCMA 1Z9MA 2D31B 4HEMA 3GUFA 4HIIA 5KW9L 1AR1C 3DRTA 4JFVA 3WN5C 3TV8A 1NMAH 1TJHH 1U8IA 4G6FD 4GA6A 1MJ7L 1W15A 5JIHA 3IN0A 3LSOA 1Q8MA 1BIHA 2Q2LA 3P3UA 4QOKB 3KHQA 4A6YH 3LXCA 1KGCD 3SKOA 5FGRA 4XXCA 1KWKA 4LLVB 1DMRA 2JJTA 4G9FA 4S1SH 2ENJA 1UWGH 2P5ED 3MA7B 1NKGA 3PP4L 4PRIE 2VL5B 5T1KD 3FKUS 4GAFB 3Q8CA 1WPCA 1A7OL 2J1XA 3W9DA 3DVFA 2P5WD 5CLTA 3NRFA 1D5XA 2QQNL 3JYCA 4WGWB 2PCFB 3PWPB 3DLQR 4JFQB 1X5KA 1NC4B 4YR6B 2GTZB 4MNGB 4W9GC 2PW1A 3MCYA 4FTVE 1G6RA 1MPAL 2ADJA 1JPSL 5D55A 5D8JL 4GRWF 5GLFA 2R0KH 2YPKB 5FOBA 5GLYA 3FFCD 2XSKA 3MRDB 2NY4B 3MRKA 1Z5HA 3T2PA 3VTTA 1GJUA 4C56A 3KPSD 4WUUE 1QNIA 2O30A 2LU3A 1F11B 3EJZC 3HG3A 5I1GL 3KXFA 1E4JA 3O2WH 2E9WA 1E61A 3CZNA 5SX4I 3UL4A 3FFDA 3KWXA 4ZNEE 2EACA 3R0NA 4G2AA 3V6OA 3E6FA 4JG9A 3HNVH 3R7RA 4L8BB 4Z7OE 5MP6H 5C0DB 2HTKC 5IR1B 4BQ6A 3M07A 4AEIH 4GUOA 2EEBA 3I02B 4Z77B 5DRXA 1G9ML 1U8OA 3B1TA 3C6LD 4I85A 3RILA 2FJHB 3SGEH 4BGLA 4AG4H 4R7LA 1DEEB 5IBLC 1YUHB 3PFQA 1HZHL 1UWGL 2NY5C 3FT2B 4B9IA 3UC0H 4Y9EA 4ENZA 2NT1A 1NBZA 1X5FA 5C1BA 2P28B 1M05B 3HRZB 2YMXH 2YPLD 3I2CH 2KYIA 3ATEA 1MIML 2VR3A 4FMKA 4HDIA 5C09A 1F4XL 4J3OF 2I9LB 3CLEH 3IKCA 4P2RA 1AGCB 3DX4A 2E8YA 4WQOA 1PZBA 3L5JA 4LSVL 4XVJH 3TN0B 3QQNA 5F9OL 3O3UN 4KY2A 1NINA 2DQCL 4KO8A 5JXED 3P0VL 4G8AC 5EU7E 3QG7L 4AENB 1GC1H 4AZDA 4DKEL 3V0DA 2OSLA 5I1AA 3NH7H 4L2LA 3NPZB 4QF1A 4HWEH 3O6FC 3LAFA 1H3WM 4YO0B 2JKJA 5F9AC 1J0KA 4YFDB 5AYUL 5GS2D 4GAJH 1P1VA 3FUJA 2X6UA 1S5IL 1FG2B 3IAQA 2PW2B 5HHOB 1MJUL 1KIRB 1NCCL 4WW2A 1ZHNB 2WXLA 1A6UH 5GJTL 1U3JA 4Q58C 2L3BA 3AY4A 1QA9A 4IU3A 4JFZH 1G84A 1YNJD 1HJCA 4ZOEA 5C9JB 3W38A 2BNRA 1MDTA 4YHIA 3MODH 3L3KA 1UA7A 3U4BL 3GSXB 4UCFA 4EI6B 3HZYA 3VXPB 3VXNB 2LQRA 3F8UB 1C5BH 1T0OA 2EIBA 3JWNH 4M62H 3WDJA 4I5BB 4JJHA 2YSSA 5FUCC 4L18A 1KGWA 4D7ZB 4CS0A 4DGVL 4XPHL 3RWCA 4K5LA 1WCQA 3ULVF 3H56A 4KJYA 5JPNA 5I1AB 1OOAA 4BFBD 4OF0A 4POZD 4U0RB 1HWWA 1PAMA 3QQ8A 4LOEA 3PGDB 2CK2A 2FBOJ 2JLLA 4YE4H 5GZNC 3N85H 1SN2A 2GJRA 1MRDL 5TQ0L 3VXRE 4AT6B 3TFKC 1N8ZA 3SDCB 2EKJA 2VLJA 4AJVA 5CEZE 4YS4A 2ZXAA 5D96B 4G5AA 4XRCA 1LWRA 4H8WH 5C0JA 1N5YH 3L5IA 3Q6FB 4L3CA 4B96A 2EC9U 3BPLB 4DT2A 1RUML 1V27A 4IMKA 3JWDC 1SHMA 3T3PE 4Y16A 2EDEA 2P5WB 3SCMC 2OTUA 4NERA 4F37K 1N10A 2OJ1A 3VXTA 4Q97A 2AABL 2HKHH 4FYQA 4LCCC 1NEZG 4F9PA 1BYNA 1TJMA 4TL5A 5DFTA 3WV0A 1AFVL 1RFDL 2VQ1B 3BAEH 5CGYD 1YG9A 4AEHL 3VD1A 3RRQA 4WW2C 3DTXA 1RZ8A 3EJUA 2DW5A 2V4LA 4AOFA 3M86A 4U6YB 3T71A 2IH1B 1UT1A 1D5RA 1QRNB 3HPJB 2JCCA 4GSUA 3WENA 1AH1A 1E4KC 1XZ0B 4FULA 5D7HA 1A1NB 2CR3A 2F8XC 4K23L 3FQ1A 1OB0A 2K3TA 1BAWA 2J8UB 4JRFA 2YOCA 1OE1A 1CO1A 1OE3A 2E47A 2XN9E 5H94B 4HC1H 1UD6A 5IWLC 2VDKL 5C3TA 4TKWA 5JW4M 1AR2A 2OKMA 2Z3FA 4UOW0 1P84K 4ZD3L 1FA4A 2J8UF 4G70B 4PJAF 4BE6A 3L5HA 1A1OB 1PIGA 5IW6B 4JPVH 3KYKL 3LIZL 3VSQA 1BEYH 3WNIA 1URIA 1T4KA 2V7NA 1U8LA 2CO3A 4OCSL 5A2FA 5JMOC 2OJZH 2XNAA 4J6RH 4J3TA 2HP4A 5D9SB 2BNQA 2BHFA 4JQIH 2D7MA 2YGOA 4F7EB 3U1PA 2BWQA 3WHE0 2Q10A 1RZ7H 4QXGL 4D0CB 2IADB 5I1EH 3IMRA 1CCZA 2F54D 4Y5VA 3MLZL 2VUMA 5ABAA 3VWKA 4YVNA 3VSTA 2R8SL 2P7TA 1XHHA 4H5SA 9PCYA 3IJSA 4HXBL 4U1LA 2WWMC 2IQAB 2OFQA 4WSKA 3D05A 3WIFA 4APQA 3WKYA 3VB8A 4OUUB 1KELH 2A6DA 1NAKH 4G7YH 1KZYA 5I16B 1UD3A 1JGEA 1NC2B 2E9BA 2FGWH 2CRMA 2DMBA 2NY2B 4K7PH 3ULVC 2AQQA 1P5UA 1K6QH 3M1CA 4UNUA 2W65B 2XTJD 4Y5XC 4HC1A 2CBTA 3NPSC 2L7EA 2M1KA 2ROXA 3BKYH 4HT1H 4R7VA 2W9DL 1ORSB 4D8PA 2XJKA 1BA9A 3KYOB 3ECBA 4KJWD 4P57A 4FI7A 5JPNB 2V9QA 2ZWLT 3CAFA 2PR9A 1YEEH 2LFGA 1B4LA 2DQIL 3PNWB 2R9HC 4N2AA 4ES8A 3FTYA 3L3JB 3RL1B 1S7RB 4DNLA 3U83A 2PP7A 4F5CA 4ESKA 5CHNB 2C34A 4HPYL 4HIXL 4AXWB 5GIRA 3ALWA 1WIOA 4GJTB 2XIIA 4MAYD 4E42B 3GPEA 3KPLB 3SD5A 3G5XA 4R6UA 1JNNL 5I0DA 2P8LA 3VCLB 4HIQA 4MA8H 3LXUX 2FEDC 4QRRD 2AEQL 4MNQA 3TF7C 1X44A 2BVUA 2CK0H 4ODVH 1JCVA 1ZWIB 2XZCH 1F97A 1RI8A 1U8PA 2EE2A 4RMQA 2VLRB 1UUSA 1YPZF 2J7LA 5EF3A 4MQ7A 4NC1E 1DL7H 1RIUH 2PW2A 3TVMD 1CE6B 4IU2A 2VW6A 3VFRA 4DESA 2WQAA 3QYMA 4RGNB 2QGCA 3ZDZB 3HW7A 3BDYH 1TETH 5KYYA 4GW4A 4K7PL 1T0NA 2QR0A 3LNIA 3ZDYE 5KVDH 2HX8A 4P99A 4BZ2A 2C9AA 1FFPA 1NCTA 4Z0XA 2LU7A 4ZQTA 2XTJB 1UJTA 1NCGA 2DQDH 2FIKB 2UYLB 4Z7UA 1HKLH 3QJVB 1HYSC 1U92B 3NZ8A 1MWAL 1CZ4A 1OGYA 3HRZA 3OMAB 4HXAH 3ES6A 4NI6A 1Z1WA 2P48B 5HYQA 1IAII 2QZ5A 1FPTL 3DX9A 3QA3B 4AJ0A 1EEYB 5JW4Q 1U6AL 2CLRA 4JFHE 5I1JH 2XN9B 4EDXB 3UJIH 3EYQC 4B9ZA 3FKIA 1BVNP 3VFMA 5K9QI 2X1WL 5DRXB 4DKDC 4Z77A 5DZAA 4I88A 4C47A 2B59A 1MCOH 3CFJB 4ZMZA 1OSPH 3CG8A 1ILUA 3ZOAA 3VTMA 1A0QL 3CN4A 4FFWC 5DK0A 2OL3H 1E7VA 4WI3A 4ELMB 1KGJA 3QJOA 4G1EA 3JTTB 1EGJL 1QBLH 2AXFA 3T4AC 1D9KB 2CUMA 4DKFH 1OA9A 1PY4A 5DHXB 1NQBA 1I8KA 4XCEA 3NJLA 5DZJA 2BSBA 4I89A 4NQQA 4EUPG 1FNLA 4X6EB 4GG6E 4H25A 2W9DH 4ZUSA 3VH8G 1EU1A 2X70A 4Y5XA 5AVVB 2D9CA 3FT3B 2NNFA 1S4IA 2LV4A 4NM4L 4EBQL 5KYXB 1ZLVH 5ACLA 5EUOF 4OKVA 5BOJA 2UWEE 4YR6A 1SDDB 2Z31A 5D1QC 2NXYB 5H37G 5CINH 4PJHA 3LY6A 1O6SA 2CLVA 2N0MA 1MI5B 2VQ4A 2PTUA 5D1XB 4ZFGL 2Q86A 2WKGA 4MJ5A 2X0UA 3BAJA 2BY3A 2JQZA 4BSVB 2ORBH 1FPTH 4G59C 4KX7A 1DBMH 3JTSA 3S3SA 4AQAA 4X5LA 4YLCA 5IWLA 2AJXL 2X9YA 3UZEC 1DDHA 1INQB 4X6CB 2XY1A 1YLBB 1GGCH 1DN0B 1UXSA 4QI3A 4IRZH 4ZBJA 1SNRA 1NUGA 1OQOA 5C0CE 1DVFB 3GLDA 4ZS6C 5HHMD 3NCBB 3HC3H 1U8IB 5JUEH 3FU3A 5KAQG 1M1XA 3CVDA 3KDMA 4Z6AT 5C0CB 1J8HB 1YNTA 2COQA 4N2NA 1WWCA 3DSFL 3B9KA 5E4OA 3RHWF 5EZIH 1PKQB 4HEME 3U9UA 1E5UI 4PGJA 4NO3B 2ITEA 1UXWB 2J5LB 2Y6SC 5GISL 1N4XH 1HAWA 4G43B 4UQCA 3L1GA 1RZFH 2MEJB 4P5KA 4QHKI 5DVNA 5I73B 2VMFA 1VPOL 4X80H 1OCRB 2VISA 3KJ6L 2TRYA 5EBLB 3GPSA 3S96B 4GMTH 4DP0X 4XNAA 4TMPA 3GMMB 1OP3H 4L05A 1HIMH 3QORA 3NJMA 4GNKB 3TZVA 5D7LA 1NFDB 4QAWA 4RGNE 1HILA 3BEVB 3SBWA 1S78C 3WKML 3KWTA 3BFOA 1QHOA 1CLYL 3IRPX 4U1NB 1NFIB 5DS8A 2XV3A 1MI5D 3VXSB 4QRPE 4M7ZC 5ITFA 2F5BH 1QLFB 4IIQC 3GJFA 4ENED 2AITA 5J9PB 1HN1A 2RCSH 1CQKA 3BUYB 2R15A 5E94B 1VZIA 4BGDA 1L7IL 4HLJA 4Z7NF 2XPZA 2XZZA 1G7JA 5E23A 1I7RA 1FNFA 3D0VA 2B0SH 4YAQA 3PF2A 1OM9A 5MEQB 3FT4A 2EP6A 4PJ5D 3U30C 3QWZA 1CT8A 4O58L 2AE0X 3OZ9H 4K3HA 1MCSA 3WFZA 3RGVA 1KWGA 3UTSA 4Z5RB 1FUNA 4AKOA 4FQJH 4OFIA 3KZ8A 4DIXA 1E6JH 1NMCC 2G2RB 3TO2B 3BJ91 4Y4HA 2JKWA 3UTTD 3TCTA 5GS0H 5C08B 3L3OB 4L1TA 4XVUD 3AS1A 3M8OH 3HJ0A 5IMOB 5LGJB 2GFBA 3VE0B 1A2YA 3O2DA 1JI2A 2FO4A 4K5NA 4X6BA 4G8EB 1YNKL 3EH5B 4IKJA 4K07A 4PS8A 4EZMA 4JREC 3F58L 4NHCL 4GP8B 5IB3A 2FCBA 1H8NA 3MLYH 1NCHA 5G5DB 4LCUB 1YEDB 3AQZA 3FB8B 2LE9A 3GEWB 4UQDA 1RU9H 2X6MA 5I1CH 4MBRA 4FTVD 1DQIA 2AJ3B 3QEQD 4P06A 4HJTA 2AXGA 2WLZA 3IDGB 1XF3A 3LKNA 3UROR 4KZEL 1U41A 4UV4L 1IC7H 1DBAL 1UCBL 3VXUE 4JN1L 3JWNG 4YL4A 3K0YA 4S0SD 3X1EA 2EYRA 3D7PA 2BVPA 2PJJA 3O6FA 3RWHB 3LZFH 4OFKA 1C5BL 2XHNA 5CJXA 3MV9D 1E30A 4JL2A 1U3HC 2FJSA 3ZRCC 5DJYB 3P4OB 5JHDB 3BAEL 3BKCH 4BXVA 5J3HD 5I8KL 3KLAA 5HHPA 5I1IH 4UT6H 4PWGA 4EOWL 1ZA6A 3Q5OA 5ENWB 2CDEA 1T1YB 3MMEA 1EAPB 4PJ9A 3VTAA 2KLRA 4Z18A 4I18C 4N8CH 1E7UA 3QEQA 5H2BB 5IOPA 1NL0H 4LHUD 3F7RA 3PV6A 4HWZA 4NENA 3WEXB 2NZ1A 2VABB 1FAIH 2ARJA 2PXYD 3EFDL 4QTFA 4DN3L 3ESMA 1G7LB 4LLYB 3PWUB 3JWNE 2GITB 4QWWC 2X4TB 3VQLA 4LLUA 4M3KB 2B2XH 5JORA 3U9WA 3TIDA 3U6XS 1XGPA 5C0EA 1H9DA 3Q5TA 1UT9A 1DQQA 1FNEB 4ICWA 3GMQA 4XNZB 2W9EL 3OTTA 3SDCC 2V2TA 1IFHL 1DTUA 5KN5A 4PJCF 5KZCD 2UXGA 3QFDB 4Z23A 1ZEAL 4JVWA 4YHLL 3CLWA 4ZUTB 3AU0A 3DGCR 1ETZA 1F00I 2Q7AA 3LKSB 5FUZH 1DANU 2NY3C 3EFOB 2BHYA 1UWEH 4OBSA 3TBYA 2WLMA 3SCMB 2KI8A 1SQMA 2WTRA 4ODXB 3D1MC 2YD3A 3I6KB 4PRHA 3RZCC 1YO4A 3QZOA 3QXDB 1JFHA 3QDGB 4G7VH 4N0YL 2XZQL 3SGDI 2AQ3A 3AITA 3KGUA 3IDJA 5EF0A 1UM6H 5E5MB 3PGCB 4MJ2A 5J1SC 2KH2B 3BSZH 4QOKD 3GINA 5D5MF 4WW1A 3OR6A 2WAQA 3L3IB 3HHSA 2D2OA 4N2CA 3A23A 3ILPB 3P4MB 3I50H 5F9JA 3RWIB 1WC7B 3R7QA 1DBKH 5FECA 2GJZA 3II3A 5I1GH 4LARH 2VR9A 3MRIB 4B27A 4YXKL 4RZKA 3TPUB 3LKQA 2H4EA 3BIKA 3BRDA 1TR7A 2XC8A 5HHNA 2Q76B 2X9WA 4RVBA 4X4YA 1IRAY 4MS8D 3TBSB 1AZZC 2PTTB 3EXJA 1OAQL 3BMVA 5B22A 1MJJB 2XG4B 3DROA 5DZPA 1KG0A 4WY7L 3ZE2B 4FFVC 4UTAL 5I17B 1AKPA 1UXLA 3C5ZD 2HT2C 3MRMB 5LQBL 5CBAB 2VUYA 4H44C 2G30A 2P49B 3QEUA 3D3VB 4JFFE 4YGAB 3CVBA 1CTNA 2M83A 1T2QL 3RFRA 1SFOA 3T0WA 5DUMH 2F19L 2XWTA 2SODB 3DX6B 3E6HB 1XF4B 3PL6B 1F4AA 1EZLA 5T5FL 1B0RB 1OARL 1BMZA 2HG5A 4HMCA 2IOMA 1EEZA 3M17A 3ZKXC 1WBYB 1RZPA 1UCTA 3HPLB 1Z32X 4ONFL 3T6QC 4ADGA 4F8QA 1WBZB 4UBDD 3Q05A 2HA1A 3QXTA 4OD3L 1D7CA 4L0PB 2DQCH 3NBNA 4LHQB 4X5XA 5D93B 1CDCA 5KBKA 2XWCA 1RQ5A 5HPMA 2CA4A 4EXPX 5IK3A 5E9DD 4QRUB 1T22B 3WAJA 1S7TA 1ZDQA 2CJUH 4LASH 1K4DA 4JFYB 4O2CA 4X4ZA 1DSFL 1LEKA 1BZQK 2HRLA 4J3UA 4BFIB 5MENA 1SMDA 4KRLB 4LDLB 5ICZA 2G9KA 4F7KA 3D52A 3I6LE 1PMYA 3OAWA 1J8SA 3MRGB 2OM5A 4RMUA 4YHLH 1CFTB 1GZQA 1VEMA 3C09C 4L1DA 5BNXD 3RVWC 5LWYL 2DLFL 3QWOA 4WWKB 3STZA 1MLCB 2O6FA 1CFNB 2XFGB 3P11H 5ISZD 3ZU8A 1X5GA 2YAPA 5A2JH 4J4PD 3FULA 5B7EA 1IGMH 1FZMA 2DEXX 2ZG1A 5GGSB 3VFGH 5FAAA 5F1OB 4F80A 1TZHB 1UD4A 4U1JA 3UXFA 1YHPA 1KSRA 3EG9A 3EYUH 4GKLA 4R5XA 1TWHA 2CGRL 3SPVA 4AGNA 5IJBC 3BAIA 1XR8A 3ZIMA 5FF6B 4NXKA 5F9WB 2ICCA 3QK0A 3DOHA 5D71H 1FORL 1H5BB 2K4AA 5IVXE 3UBXI 2A6JA 1FFNB 3GSVB 5GGQH 4FQXA 4X4XB 2FHCA 5SWZB 3BO8A 5J7CC 3SB3A 2XN1A 3C75A 3FCSA 1H0HA 5I0ZA 1FYTA 3EDKA 1ZV9A 1AO7A 4HKXA 3STBA 3TWCL 3OX8A 2NY5L 2R7EB 1FIEA 1WZ1L 4FZ8L 4KHTL 3NSCA 3MBWA 3MOBH 1HFUA 2XVKA 1XR9B 3Q3GB 5DQJB 1NM4A 1E6OH 3X13A 3AY4C 4MKMA 4QRTA 5F2FA 3FQWB 4H88L 1RY7B 1J9RA 1U8NA 4OQTL 2RALA 5FA4A 4ZFGH