2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YOAJ
molecule tags Cell adhesion
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
5GLYA 1L8FA 1OA7A 1HD5A 3FT9A 1OA9A 4ENGA 2ENGA 4JP6A 4JJOA 1BMWA 3X2KA 3M3GA 4FG4A 4ZM7A 1WHPA 2JNZA 2PICA 2KQAA 3FT1A 4JCWA 2AE0X 3X2MA 5GM9A 2PJJA 2VXQA 2GAEA 1BW3A 5GLXA 3X2OA 1N10A 2BH0A 4FFTA 3ENGA 4AVRA 3SUMA 3SUJA 3X2IA 4JS7A 3SUKA 3CZBA 2G5DA 3D30A 2G6GA 3X2LA 3X2GA 2PI8A 1BW4A 4JP7A 2HCZX 4FERA 1WHOA 4L48A 1WC2A 3SULA 3X2JA 4FG2A 3X2NA 3X2PA 5H4UA 2PNWA 3X2HA
chains in the Genus database with same CATH superfamily
3IMUA 3PWPE 5E6IB 3VX0A 3EUDA 2BP8B 2DAVA 2CG9X 2P5ED 2XV6B 1BREA 4DK5A 3D2UD 4ODVL 3NH7L 2FD6H 3VI4F 1DZ0A 2AQPA 1P1ZA 3FO1B 3KEHA 4ZT1A 1EXUB 1NOLA 1RZFH 2DM2A 3Q2CA 4JRYD 4RQQB 3TBSA 4TVPH 4PJHA 4DZ8B 1ZHNA 2XKNB 4DN4L 3DX7B 4F7CA 3ZKSD 1HHJB 2GITB 5D7LB 4FS0A 5FXCH 1KIUB 4H20H 3FBQA 5ICXA 2O5ZL 5H35A 1TYEB 1AXIB 4K9JA 5MHSE 3HW7A 4NI6A 5GS1A 1URIA 2VN5A 1CF1A 1UKTA 2E9WA 3QXWA 3TH4T 5ISZD 3US9A 2ZUXA 3RUGB 1FVCA 2Q10A 1IQWL 1FGVL 4NX0A 4LE8A 1MY5A 3P9WB 1CXEA 4PJCF 3WIAA 5E6YA 2OR8A 5DZ9A 2V2XB 1DR9A 3V4VA 2J71A 2A9BA 2GK0A 2CPUA 4JQVA 1KT2B 3QWQB 5MP6L 1RZIB 2FL5B 5LGJA 4HJGA 1ZANL 1FZKB 4PRDA 1H3UA 5D8JL 5BMFL 1BYOA 3GHPA 1AXSB 3WKML 3CPUA 4GRLC 5HJDA 2VMCA 4Q8BA 3CTTA 3VQLA 1MRCL 2O6PA 3LRLA 5D2NA 1TQTA 3Q48A 3X3FH 3AQYA 4KY1H 2CRMA 3LDBC 1HKFA 3BRDA 5K69A 4ZW5A 5J6HA 3QQ4A 2UXFA 5F3BA 4M7JH 1EVUA 1FSKC 4M8UA 4TNFA 4AQ8C 1I8KB 2FECI 2DEXX 3DECA 3D3VA 5F9OH 3H9YA 2WBJA 2C7FA 1TTFA 3C5SA 1S9VB 5FECA 1SQMA 2C3VB 2Y2WA 1FFOB 1LO5A 1LNUA 3IMVA 4JAMA 5D9SB 1JXJA 2WWOA 5AVZB 1BQLL 1IAII 3ESOA 1CQKA 4PV8A 4WI0B 4DGIH 5IKCB 3FK3A 4GXVH 1WZ1H 5D1XC 3BT2H 2PICA 3KM1A 2E8ZA 3CDYA 2VDKH 3O8XD 1X5KA 2JK5A 2NSQA 3ISRA 2VDLB 3GS0A 5KSUB 2FQGA 2J8UB 2C3XA 4YUEL 3OKKA 3CFJA 1FL6A 4QRUB 3BHBB 5EU7C 1MRDL 3DTDA 4DUXA 1OCCB 4FXGB 2I32A 4K94H 4KUZH 3TCXA 1J8KA 1TR7A 1O6SB 1QFWL 1ZY9A 3KPNA 3EYSH 4B9YA 5I23A 4JZJC 4UT6L 1HEZB 4KK8D 2I27N 5B21A 4RH4A 1CI5A 4NQSB 3G5VA 4J28A 3RDTB 2WNXA 2WNWA 2H6OA 3L3KB 3D39B 4IGBC 1SGKA 1M42A 5IROD 1ETJA 2E7MA 2QSCL 3EOBB 3K72A 1JGVH 2NXZB 4G1EB 4PJIA 5E2VH 3OHXC 3VFVA 1Z9SA 1WLFA 4FG0A 3WTVA 1S9WB 3HRPA 3ESNA 3K81A 1I7UB 3VI3A 4CJ0A 1UD3A 1IKNC 4ZMXA 2CIKB 4I1NB 1I8MB 4KQ0A 2EC9U 1Q0EA 1TQVA 3ECQA 4ZS6C 2ZJSL 5IHBA 1MG3C 3CX2A 4AUYA 1D2PA 1OGSA 1KYUA 3ESMA 3S35X 1U8CB 3RKPA 4G7VH 3RL2B 4GBXB 5E51A 1EAOA 3R0MA 1MHHA 3TPUA 1IX2A 3SEPA 3EHBC 1S7QA 3HVDA 4LOUD 5JOFB 4GSDH 1IL1A 1JDCA 2V9QA 1WF5A 3CN1A 1FC1A 1HWWA 3WY2A 3CFMA 2DJUA 4YHIA 4BE5A 5EU3A 2B63A 4APQA 2G5BB 5F0MB 4YXLH 1UD5A 4Z3JA 5BRZB 4AXWB 5CEXA 4NEHB 4V1DD 4FTVA 5FW8A 2P52A 3VG0L 1OTUD 1WE5A 5DD3H 5C1BA 5E6IC 5IFAH 3CIAA 1NIAA 1XHHA 2PXYC 4RGMB 3BVDB 3BESR 1G7JA 3VGAB 1Y18A 1B4RA 1EHAA 4L37A 1PLBA 4ZYKB 3TJEL 2IH9A 2BY3A 1ONQB 3G6DL 4QTHA 5AOZA 3WN6A 3FB5A 5ACZA 5L9DL 2VDLL 1FH5H 1UJTA 3GTJA 1OP9A 1HZHL 5KJRL 1MW0A 2EABA 1G1KA 2D7TL 2JLLA 2KPWA 3HZMB 4XT1C 3U1SL 4Y4HD 3AS3A 1E3XA 1ORQB 3FZUD 4KKNA 5ICZB 3FCSB 4Y1SA 4RISL 5D1QE 1V8HA 3RPKA 3BWUF 3T6VA 3NSYA 2VW6A 1SYSA 4XPGL 5KSBE 2R56L 4E9WA 2I5YH 1A4BA 5HGBB 2YGPA 1F4AA 3FQYA 2JKXA 3CQPA 5DO2D 4LHUA 1TJGH 2XACC 2O30A 1YEKL 4CVZA 3IU3A 3RAJL 4K8RD 3P0VH 4NIKB 3MRNB 3SUJA 3BUTA 1AR2A 2XY2A 3IFNH 2FB4H 4B9KC 1XO8A 2GTWA 2CW0D 4L3EE 5E03A 3S96A 1ECYA 2Y3AA 5KJ4A 4IRZL 4G6ML 5C7XL 5A1AA 1ASQA 3VD9A 1UOKA 4MMYA 4QRSB 3BPCB 4GW4B 1Z5LB 4NQQA 3Q3GB 2V33A 2R92A 3V7AE 3RBSA 2BLFA 1CGXA 4GSXA 3VFOA 2EVHA 1T89C 1SYVA 4D0CB 2DM7A 4NZRL 3S9DB 2ILLA 2ZWLT 4PJXB 1H15A 1T21B 2BY1A 3FHQA 1OHQA 5HHNB 1LO0H 4PJ8D 5HDBB 1H15B 1IM3D 5AAPA 1KN2H 3RHWK 3FQWB 3BO8B 4JDZA 1XVSA 1QHOA 4XCYB 1ADQL 1Y07A 4M00A 1J5OL 4P2RE 1SUHA 4KLNA 1I53A 1UVQA 5EZOL 1FPTH 4J4PA 4QRSA 3BPOB 1X9RA 3HI1B 3J27A 4OLVH 2HRPL 3ZTNH 5IIEB 4H26A 3QIWD 4RBPH 1IM3B 2O6DA 2IV2X 4X6BB 1J9CT 1MELA 2AXFA 5GZOA 3H54A 1SFOA 4IMKC 4YH6A 3AB0B 4KJPC 4OZHF 3HMXL 2J8UE 3AWGA 5BQ7B 5GLFA 1XQ4A 3ABZA 4AL8L 4TSAL 2VLKA 2C4FT 1D3CA 3RURA 1GW0A 5C0IA 2FBOJ 2D7MA 2YRLA 4F7KA 2DM3A 3EBGA 4N2DA 4XB3A 4CVZB 2I60L 4LHUD 1KN4H 2W9EL 4JHWL 2DIEA 1AGBB 4AV4A 3S34L 1C1EL 1MVFA 4ENGA 3WUZA 1SLWA 3ZDZB 4XX1E 3QXTA 3K5SA 3MNZA 3RY6C 5I2IB 2HRGA 4YOKA 1M4KA 3JTBA 4IBZA 1Q9WB 4JDTH 4YBLB 1AJ7L 1TQBC 2GSGA 1HEJC 2EJ1A 1UZ8B 3QQ7A 1E4XH 4OCSL 2QMJA 2GCYA 5DHMC 1ZGLM 3O6FD 5CP7A 4GKOA 3T2QA 3HZMA 1ZGLA 1IEBA 1MIEH 2J55A 5J57B 4L8SB 1IM9D 2D7PA 2OXGB 2KERA 3OPZH 1KLGA 4X98B 1XR9A 3GT6A 4HFWB 3RTQC 4F92B 5FCSH 4M5SA 1GGTA 3C6SA 1G7JB 2YSTA 4IMLB 3CZGA 5I0XA 5I1HL 2OTWA 4NM8H 1VCBC 3MUJA 1T1XA 4F7EA 1TMQA 1NL0H 2YXMA 2WVUA 3R06A 3Q1EA 1MFBH 3H4FA 2XA3A 4M5ZL 2VSCA 2YD8A 4CVWA 3BH9A 3NCJH 3M86A 3T8XB 5A6MA 4IDJL 3SDDD 3VSUA 4APQB 4LLQA 2GW5A 5SWZD 2ZX9A 5DJXB 4F57L 1UYWL 3UP1A 1I7TA 1UXWA 3SY0B 1AGFA 3KL3A 4U0RB 4L8CA 4UQCA 2QADB 2GJJA 2J88H 1NGQH 1HL4A 3PF2A 3NAAL 2YR3A 2H41A 4XP9H 3WY3A 1S9KC 5FO8B 1KBGH 1PEZA 5FM5M 3TEXA 3L13A 3RL2A 2P5WA 4Q9BA 4YE0A 1WBXA 1JSYA 1WRFA 3FQNA 4F1SA 2X4PA 2AJSL 3JWNC 1XTLA 4HU8A 4O2EA 5F9JB 3H7BA 1TETL 3LIZL 4I2XA 3IDYB 1DDHA 3HNSL 3LKOA 1OCWL 4J3TA 4N2IA 1QRND 1N5YH 5CJ5A 3CVHL 4ERSH 5J11B 1K5NA 3CQFA 3GBML 1NWPA 4QRPB 1Y0LA 3DV4A 2X3CA 5HVHB 2VABB 3C6LB 5TPWH 3VJ6B 3QORC 3WHXA 5D1XD 4OZGA 4Y1AE 3EOBA 3QAZC 3T2LA 3SDDA 4LSPH 4MAUH 1T2QH 2I7SA 4Z7UF 4HKJB 4WCYH 5JHMA 5H4YA 1MI5B 1OIOA 4N2FA 1C5DB 3E6FB 5TGBB 5DDHA 3VGFA 4MD4B 2CCLA 1OF2B 2EIZB 3LH9A 3A6OA 3ATDA 4S1SH 3P4OB 1UD8A 4LGPB 1YAZA 4HCRA 1BZQK 4LB8A 3QI9C 1TJXA 2FAUA 5EA0H 5HVGB 2WBKA 4TSBH 2R9HD 2R2BB 4MCNA 3WD5H 2I07B 3BVXA 5HYEA 2NY3D 2Z3FA 3QDGA 4YX2L 4BIKA 1IAKB 1DQQB 1PG7H 4YFEA 1XGRB 3VD5A 1WAAA 3T6WA 5K59E 4X8GA 2JK5B 5AYTA 5KSUA 3GJFB 3SY6A 3O6FA 1CGVA 1BMZA 2OMUB 1XH1A 1A2YB 4Y4HB 3IDMA 2DBLL 1BQSA 5BZWB 1NLDL 2AITA 4FKHA 5B3JE 3GTLA 1EMTL 5J4MA 2CHDA 4L1SA 4PV8B 4RRPA 5CZXD 3UZVA 5MEQA 3PP3K 4JKWA 4YHNB 1OANA 2XZCH 1QD0A 2R0WL 4MCYB 1AZUA 3TV3L 5DEZA 1E65A 2AVGA 2ZWZA 1W0VA 2C3GA 4XO4A 3CFQA 4P9HC 1T20A 4U1SB 1GH7A 1FZMB 1QYGH 1ZEAL 2VERA 4B9GA 4GKZB 4APXB 4N5EC 4LHUG 1MCKA 2F1EA 5IW6A 1J5DA 2ZTBA 4AX3A 3K5RA 1JD7A 1A64A 3V5KA 2YSSB 4K23H 3VXMB 4L4VD 4OCRH 2VQTA 3C6LD 3LH2H 4WFHD 4WI9A 5SWQB 2X2UA 5AL0A 3WAJA 4ZS7H 4L1DA 2F18A 4PTUA 4BWWA 3GHEL 4WHYG 1ORSB 2PWFA 4ADIA 2FLBT 3F62A 2GJ6A 2VW4A 4BJLA 5D2LB 1GZHC 1HILB 2VDML 3T77B 1KGIA 2J4WL 2XCMC 1JE6A 4B9IA 4HUVB 4LDCA 3JTTB 1KJVA 2YD6A 3ZUNC 4UIMB 1H5BC 1QHQA 4Y4KB 5AVUB 4N22A 4K2UL 4E5XA 5IOPB 5E08H 4QXGL 4MJ2A 3RUGA 1BFVH 4OZHB 3AUWB 5D1QC 2A9NL 5B8CB 5FTNA 1TIUA 3QC6X 2AQSA 1QTPA 4PJGE 2IDUA 4Q6IB 3UFIA 1C7TA 3FZUC 5IM7A 1ODAA 4V2CB 1HL5A 2FJHB 1CGUA 1NC4B 2AI0H 4MMZB 1MPAL 1ZT1A 1E9OB 1V10A 5LGYA 5JHDA 1PX4A 2F54B 5H37H 5D2LE 3NZHH 2F53D 2RA1A 2CPCA 2LE9A 4X8JB 4R90L 1VENA 1CGYA 4NSKB 5FFOA 4DZ8A 7FABL 5GSVB 1KTLB 4Z3HA 1BQ5A 3EOAB 5AKSA 3EBAA 2DIJA 2J6WA 4X6EA 3OWEA 2ZCKH 5JXEA 4OZFB 1H3PL 5E9NA 5F1IB 3W38A 1S5HA 5C0AA 1UACH 3IE4A 1UB5A 1JUFB 1T0MA 2BNUB 2BP8A 3T0WA 4A7QA 4EBQL 2VL5B 5H8DA 2ODHA 1X5YA 3QEQB 1FG9C 4M4RB 1OW0A 4TLKA 3KWUA 1HVXA 3WTTA 1F8TH 5J1AB 2BNQB 1ZC1A 1JPSH 3A21A 4HIXH 1HSBB 2HFEA 2R0LH 1DQDH 5ISZB 4N0CC 3MUY1 3TBBA 4JP7A 4N85A 5ABAA 5E1AA 1PKQE 5B4MD 1ZTXE 1EU1A 3TYFB 3ZSSA 3OM3B 4LCIL 5SX5H 3BUYB 1UH4A 5PCYA 3O3UN 4OZGF 1Q9KB 2EDJA 4GUPA 5EUKB 5I8CA 2F7PA 4WLCA 5DZNA 2VL5A 1F1DA 5EIVA 4LVNB 4NBXB 2W91A 4WSKA 2XBZA 4JN2B 3OSVA 1W6WA 2D7QA 3L3IB 3LPOA 5F1IA 4PCSA 1N5AB 4XR8C 4V1DA 2YGVA 3FBKA 4NS0A 4PWIA 5EOCJ 5G55A 5ABDE 1U8IB 4TVSa 1X5FA 3X17A 1S2EA 1U93B 2ZPKL 3MLZH 4RMQA 2C8NA 1QLRB 3QG7H 3I9GH 1S7TA 3JVFC 3QIWA 4G6JL 3CSBA 1E9OA 1Z9NA 2FSDA 4IKNA 3VCLA 1I3QA 5I19H 1HZKA 2NY6C 3JT0A 3ZK0A 2CU9A 3MMEA 1OP3K 5E4OA 2C4FU 1P7QD 2NZ9D 4XVJH 2MNUA 2MFNA 1OD7A 3LRHA 2HMIC 1OCOB 2UYLB 2CUIA 2W38A 3VH8A 2IBZY 3RWHB 4U1LB 4YBHA 5D7IE 4BH8A 4BKLB 3U30C 1JD9A 1NC2B 4PW4A 3VUAA 2FR4B 3M7OA 2UZIH 3ARBA 1BA9A 2AAVA 1FAIH 3GNMH 4HIHA 4GAJL 1TCRB 4LFHG 3WEBA 4LPTA 5E24E 2B0SH 4Y5YB 1PSKL 5F9OL 4PTUB 4HVBA 4U4BA 3KH3A 4EN3A 1U3HC 1SXZA 3LB6C 1HS6A 3VRJB 1KWKA 1JZ3A 2I25N 3A23A 3MROB 2VRAA 3QO1A 4X7EC 4XXCA 3ZKXB 2W60A 2A77L 3APFA 3KPRB 1GJWA 1JGEA 1Q16A 2C45A 3SE9L 1ZTXL 2IAND 1MVUA 3KGRA 5MHSD 3SCMC 2IAMB 5K1VA 3OAZH 4UILH 1AQDB 1SMOA 3M1BA 2P43B 3EH3B 1UWGL 2C9XA 2Y6SD 3QFJA 3GTNA 4WSJA 3WFDH 4AZ8A 2BFVH 3BE1L 2WSKA 1TSHA 3VRLE 2Q8BL 3LRGA 4QO1B 5CEYB 5C9JA 1JCVA 2PN5A 1DVXA 1AXTL 3SGEI 1U8LA 4GEIA 4NZJA 3S88L 1A2YA 4Y4HA 3CVCA 4JG0L 5FTMA 1MFCH 4F2EA 1P5UA 3V4VL 3VAEA 1RKRA 4K8RC 4FQXB 1FH2A 2FX8L 1FYTE 1R3LB 4IRSD 4G1MA 1OAZH 4PPTA 4HIIA 2BDNL 3B9AA 4V2BA 1WHPA 1Y6MR 4BYHA 1T1ZB 2B8OT 4LIQE 3WJMB 3MRHB 2H45A 2A6HD 3CC1A 3GSUA 5AYUL 5JW3H 3HBGA 1RU9H 4ZUUB 4G9FA 1KPUB 1RL1A 5DT1L 5CF3A 3TZVC 3QYMA 1MCRA 3S3PA 3L95A 4PH8A 5DD1H 2IIJA 4U1NB 5C0JB 4APQD 4XC3H 3KJ4B 1P84K 3WHXB 2H1PL 4ODHH 4PYGA 5DS1A 2V7NB 3O6LH 1F97A 2FBRA 3OQRA 1JXGA 1CBJA 3JSSA 1XH0A 3OC8A 3TCTA 3NJIA 2WZPD 3VQMA 3E8VA 1XWVA 4B9ZA 1G7IA 5D1QB 1J9QA 2YJLA 3WE6B 1JPTL 1ZLSH 3EXJA 3U9UB 3QEQA 5AOJA 3VFTA 1AGFB 4KKLD 4B0MM 3K1DA 3RGBA 4XOAA 3OXSA 4RWHA 2IWKA 2LW3A 3GM0A 3NACH 4WJ5B 1DBAL 3NSXA 5E4AA 4PJAA 1R3IL 1ZVNA 2WVTA 3POHA 3CSTA 1U8OB 1SMAA 3BH9B 1Q9OA 4KXDA 4B5ZA 4GQQA 5LGHH 3KL0A 2EC9T 3U6XA 1KEML 4O02H 1KTLA 3E3QC 5CD3B 1JHLL 1X4XA 3D08A 5I76A 4MRCA 1G7HA 2WWMD 4U1JB 3IMWA 5DVOA 2J1XA 3MUZ1 4Z7VF 2VIRA 5BUPA 3ULVL 2X05A 4BRVA 1K4DB 4MB3A 2K6YA 4OJFH 4HQQL 5E2JA 5TQ2L 4M1GH 4PJAF 4DPBX 4YXHL 2CHWA 4JZNB 4JGNA 2QHLA 1RZJC 1UKSA 1BSIA 3EJUA 1JNNH 3LEXB 3LKNB 4G9FE 5I30L 5E8DH 3KPNB 4J6RH 3S5YA 2CM6A 3MR9B 3O8XA 5K9QG 2DWEB 2YD0A 5FYKH 5CP7B 5FCUH 4EIZC 4RRPG 3RTQD 1EFXD 3P3RA 4NPKA 4DOHE 1YEWA 2WXIA 3D07A 1UZ8A 3EUUA 1J11A 3DRTA 5AAWC 3EO0B 4N9GA 1IC0A 1YPZA 1J8HB 2IV9A 2ZCLL 3LXCA 3OQ3B 3BN3B 4QHNA 4AL8C 4JFOA 2PR4H 1HCFX 1AAJA 4E5XG 1MCFA 1DVYA 5F7YC 4HXBH 4H8WH 2D7NA 4KRLB 3BPLB 5D1QD 2HLAB 5CU9A 4XOBA 3GMNA 1PZUB 3MN8A 4WUUE 4L4TD 1RURH 5DHVA 3LSOB 3NGBB 2O5NA 3CFNA 4KMQA 1EJOH 3SO3C 3TP4A 3VXMA 4L29B 3WCYA 4Y2LA 1BAGA 3OAUH 1INQB 1B0RA 1UA6L 4LL9A 5CJQL 2WXOA 4OTXL 5IIEA 2BIPA 4BZ2L 3N44F 1R24B 3B2PA 3EOTH 1JWUB 3RPIB 3MLTB 1X7QA 4M3HA 4ESKA 1WDAA 2PP9A 3U36B 2P48B 2MPVA 4C8XA 3J07A 4CW1A 1QP1A 4TS6A 5ACMA 1AR1D 3W2DL 4RGMC 1F6AA 3VGAC 5B39A 3ZL2A 1D6EA 3F5WA 4OBSA 4YHNA 2X6BA 2CALA 3QXAB 3HOGA 2AK4E 3BH4A 3QXAA 1KTCA 1F0LA 1CDGA 3F5WB 1XL4A 1BIHA 3CV5A 1NCCL 2GG1A 3N1MC 2JQZA 3SDCB 4WV1B 5F6IC 2Y2TA 1XGRA 4RRPM 4KX9A 4UWQB 1FC2D 3GBEA 3ARGA 1KXVC 4BZYA 2MQGA 3T4YA 5KVFE 2E7LA 3ZDYF 2O93L 1NAMH 4QGYA 1VFBB 3PP3H 1IAIH 2NY3C 3IFPB 1DUZB 3FHEA 4JFUA 1AJ7H 1HQ4B 1CTMA 3TTYA 1IGML 4R7DA 1RUQL 1OSEA 3NCWA 2N3JA 3C5JA 4KV5F 1KQGA 1D6VH 3H9ZA 4JFFE 4QRRD 3TVMA 5IMKB 3WSQL 1JTOA 2EDOA 2HKHL 4AQAA 1T4WA 6TAAA 4X6DF 2X1XR 1T1WB 1MZYA 5HDLA 4MMXB 2H9GB 2JA6A 5CZRA 3WEAA 4IOIB 3ES6A 4HOWA 2DQEL 2WK2A 4OUOA 5I9QB 3ZHKA 2KBGA 5GGUA 3MLSH 3LNFA 5ESVB 3FTXA 4KTEL 2OL3B 1MFNA 5C0BA 1WBXB 5CD5D 4FA7B 3GBNH 2WPGA 1CBVL 1AD0B 4I18B 1GW6A 2HWZH 3NCXA 3MJ7A 4IDJH 3HBZA 3ZRFC 1F02I 5FTJA 3GMOB 4LNVA 1JHKH 1FVEA 1ONQA 3KCWA 1QZNA 4POYA 1PS3A 2OI9C 2O1AA 1QA9B 1HCZA 2XWEA 4LCCA 2OBGA 1GGCH 1KTJA 3FAXA 4PHZA 4J2QA 3KL5A 1R3KA 4UYQA 4ZMOA 3ZSTA 1F1AA 1G7QB 1ZVYA 3ME0B 4ZAKB 5TE6L 4Z7QB 3MJGX 1A6UL 1P5UC 1U3HD 4XVSH 3RFRA 2MCPH 4FG4A 4MLSA 4YHIB 1FCGA 1H5NA 1R0AH 3VVVA 4P3DA 2EXWC 4U6VH 3IRZA 2HZHA 2V5TA 4P2QA 3V0JA 1J0ZA 4JQIH 4AK2A 1MF2L 4X98A 1QFHA 1B9KA 4ZSOE 5F70A 2Z31C 1QKZL 1AD0A 1EO7A 5D1QA 4ZTOH 1N4XL 4YDJA 4PLNC 2X6AA 4YGVB 5HI5C 3KLKA 4IHOB 1A7PH 4FULA 3LRSA 2CXGA 3LQZA 4G11A 1FAKT 1DJSA 3FH7A 1S7WB 1QUNA 1V3KA 2A74C 1LD9A 1BD2A 1NKRA 4WFED 3ZHNA 3FO9B 1NCWH 4X0KA 3MNZB 1OGTB 3W5MA 4XE0A 1FHGA 3RUGE 3L7EB 4NWTL 1HNFA 2P4AB 3NCFB 1B0GB 4QXTA 4XBPB 5F7BA 1U8PA 3L3KA 2JKSA 4Y4FD 5FEBA 3C5JB 3HAEA 5D7EA 2G3XA 5DTFA 2OYPA 1HAUA 3W3BA 1HQ4A 4C56E 3S37L 4QRPD 1OWRM 2AXGB 5HY9B 3ESVF 1VFBA 3KPOA 4G8AC 1EO5A 2Z93B 1E9QA 4HHAB 1WWAX 4AZDA 1H3XA 1KB9J 1QTSA 2GJ6E 2HT2D 3D87B 1PMYA 1UKQA 3KBFA 3LS4L 3LZFH 4JM2A 4P5KB 3FUEA 5AKVA 3BQUB 3HHMA 4Y2OA 5F8QC 3DHPA 4PFEA 3HI1A 2QPFA 1YC7A 3LRMA 5LG6A 3EGDA 2FJFB 2YRZA 1OSPH 3VB9A 1D9KC 4KO9A 1B2WH 4FQ1H 1I9EA 2Y07L 3X13A 4UAOB 3PABB 4GW1A 1KELH 4F8OA 1KJMB 4JE4B 4NQVA 3KCPB 4LDOB 4KI5E 4XB8A 4EJ1C 3L1GA 3VFSA 1U3JA 1XT5A 1MWOA 2JCCE 3OKDA 1U8LB 4HJ1A 5KBLA 5C9JB 1JVLA 2PP7A 2QPSA 3BKMH 3L5WA 3D2TA 5L4FA 4PGCA 3ZKNC 4F9PA 4I3SH 4CW1B 4Y1AD 3S0PA 3I6LD 4PJFF 1MHEA 1QBBA 4FI8A 3WLWD 4A2GA 4BFOA 3HC3L 1TVHA 3MRQA 5FK9A 1NGPL 1I8KA 4KVPA 2ORBL 3DOIA 3BWUC 4MAYC 4NQXA 4XMUA 2CAKA 3QQ4B 2EE9A 1J1XL 2F19H 4DKEL 1N3NB 1TO5A 1XF3B 3BD5A 2PYFB 1W0YT 3CU1A 3C75A 4KU1A 4WIQA 2EECA 1MAJA 1NAKH 2WXRA 3A47A 3LPWA 3BEVA 3K6DA 4H5SB 4LP8A 3CBRA 3B3IB 3FQUA 2WBJC 3IE9A 4AVKA 1WUNT 4Y5YA 3SOTA 1SY6H 3ILPA 5BO1H 1IFHL 4X4MA 4L4VE 4NN7C 4QHNB 1J8HA 5FIEA 3V0WH 3S2CA 2XWTA 4UNIA 4YAQB 3UEZA 3V95A 1EHNA 2V2XA 3QK0A 1JZ2A 2NSXA 2YKLL 2R59A 3WKNA 5I1KH 2F53E 2Z35B 3LV3B 2EEDA 3IR6A 5KS9F 4K8RH 1IGTA 1JJUA 3WFHA 1ZTMA 5I8EA 4KHTL 2XWZA 3FB5B 1BZDA 5E5RB 5HD8D 3U7WL 5AVYB 4QTHB 2J5LC 1GOHA 1BYNA 4L8SC 3IDNA 2WOBA 5D6CB 1S7TB 4XNYL 2YMOA 4L1HA 4Q58C 1CL7H 4Z76B 3FT2A 4JNXA 1G9EA 4QMEA 3HKFA 4I13B 1G7LA 4FTVB 3OHXB 5L8LB 1Q9OB 4AXWA 4F7PB 4IGBA 2EDLA 5FHBL 3ZTCC 4P46D 1KQFA 2XRAH 1OM3L 2CMRH 5HGAA 1ZVSB 3S36H 1TWGA 1ZRUA 3SJVD 5GHWL 1PQFA 2C1PB 1RIUH 3G6DH 1YNJD 1YN7B 1ZA6A 3DPDA 2ZSWB 3QULA 5DJ2B 1G9MH 1UB6A 1XX9C 4ELMF 3UBFA 2YWYA 2B14A 1BQHA 1BFOB 3GKZA 4QGTA 4TM9A 4XNXH 4XMPH 1CMOA 3T8MA 4KHXL 4TQ8A 4MXWL 2BSBA 4Y9BA 1OE1A 4LCVA 2PPEA 3QJRB 5HHVH 3EYVB 3U9PH 3O2VH 5C7ZA 5I6MA 2B9AA 1BJ1H 3NG5A 2HCZX 2R56H 5B3SB 3B83A 3NFNA 1JUFA 1T0MB 2BNUA 2CRIA 4S10A 3SZKC 1TDQA 4J3OH 5C0AB 2OMXB 5C18A 4PJHE 4AY0A 3QCTH 2QZ5A 2BMKA 3NIGF 4OD3L 5L2KD 1R19A 2K7PA 3FMGL 3H9HA 2P8MB 2WXMA 4ZUUA 2EYRB 3IFNL 4IOFD 4PWHA 1HEZA 1N70A 5JHAA 4QYAA 1XGPB 4L05A 1A3LL 4WO0A 2DL2A 1PZ3A 2CXKA 5JHDB 4TULL 5FO7A 2BRRH 3AQZA 3MV9D 4ZO9A 1NC4A 3C2AH 4HUCA 4ENED 4MLIA 5E00B 3QS3A 3MCLH 5IM7B 3DRQB 4DGYL 3BHBA 3BVUA 3D9AH 4FN0A 2DB8A 1R3LA 3SIKA 2Z4TA 3BQUC 2J8UA 4M7KH 2E59A 5FR3A 2NYYC 4GW5A 4O51B 4U2ZA 5CLWA 1NSNH 2E0PA 5IW3A 4F24A 2R0ZL 4O9HH 4X5XA 5E4IA 1TVBA 5B3NA 1T83A 4QDGA 2ZUQC 5JIHA 3VGHA 1KJVB 3UJTL 1A6ZB 3IS1X 4N1HB 2ED8A 5CEYA 4FQQA 5CLYA 4J3UA 5CHNB 5E7FA 2BNRA 3A4DA 3RWDB 1BXXA 3MLUH 3H42L 3QFJB 3C5SB 4C4KO 1LDPH 3T5WA 1SBSH 3VYPA 3FQUB 3VNYA 1FGNL 2J1YA 3BAEH 4UZSA 3PWPD 1T7XA 3NIDF 3BEVB 5E2TL 5HHMD 3ULAB 1LEIB 3O5AA 4FE9A 4WEBH 1INEH 4UQ2B 5FYKU 3T71A 4XNMB 1E5BA 4FOMA 4U3SA 4LCYA 2IDTA 2I85A 1YEIH 3RY5A 4HISA 2FO1A 4PJDB 2AEPL 2AEQH 1WEJH 3MLYH 4FP8L 5DA0B 4DQOL 3V4VH 3O3BA 2Q3XA 2L7JA 3FFCD 5JOPD 2J43A 1W0VB 5CGTA 5EO1A 1TCRA 4X80H 5K9QI 1CVRA 3RWDA 3OKOB 5LGJB 3JV6B 3N1QC 3HAEH 4WTZG 5TTRA 3S34H 1PNCA 2HJKA 3PHOB 1P9MC 4K7PL 3HR6A 1M3IA 5JIQA 3IVKA 3PWVB 1L0PA 4HLEA 1ZDSA 3WKQA 5I1LB 3OMZA 3OKDB 5A7EA 2FLRT 1MY7A 4CJ1A 2OMUA 3P0YL 4TLSA 2P80D 2IPKB 2VC2B 4P2OD 4O51A 3BKJL 1PKOA 3FU3A 3D0LA 3GSWA 3MMEB 2ZOOA 5LJYH 4DSYA 3DRQA 4HG4J 3T0AA 2A6KA 4NZUL 5LQBL 1PY0A 1A7NL 5E2WH 5HDRA 3FRUB 1LE5B 2NOYA 4YHZH 1OP5H 1LM8V 4P5KA 3MCKA 2I07A 5KBDA 4YUEH 1E9QB 3MOBL 2Y69B 4P05A 5AW0B 5HY9A 3K0YA 2F8IA 4RQQA 5HYIA 1MNUL 5FYJE 4I5BB 3FO1A 1F41A 5C09E 1PCXA 1O9ZA 4XZ4A 3HAEB 5IMLB 3KXFD 2FJUB 1LP9B 1SJVA 1U8PB 4PJCA 3CZEA 5D7LD 5D93B 4Y2DC 3REWA 3ULSB 1AKJA 1HN1A 4GQ9H 5KS9B 3C6LA 5JO5A 2X87A 1LO3L 3OMAB 5I8CB 2ZX5A 3VXSE 4PYHA 4AVHA 1U95A 4FTVE 4L0ZA 2P5PA 5I5RA 2ATPB 1DDHB 3L8QA 1C12A 1KGCD 5BS0B 3MCYA 3S7GA 5KSAB 1RZGB 3ECUA 3BAXA 3EFDL 3P1VA 3WO4B 3I6GA 1ED3A 3BP6A 4PP1C 5AVSB 2MNWA 3V6OA 3IRCA 3QULB 4EDXB 4S2SB 3S35H 2EADA 3HNSH 1N5YL 3GLZA 2C1PA 3M7FB 4LQ1A 2NCMA 4O2CA 4M4RA 3RTLA 4P2QB 1PCSA 4JM2F 1OM9A 2EINB 2OKMA 2VDNH 4CKQA 5SX4H 2XV3A 1HHHB 3HC4L 5DUPL 2V5RA 4F7PA 3GXMA 1FYTB 1YN6B 3GGWB 2P24A 1WC2A 2KL6A 4L9LB 1S7XA 2XV2A 1DCEA 1U0QA 4ATTA 3HZKB 1YEGH 3RY6A 1P4BH 2AEWA 1TEGA 1R33A 3O9WA 4JHBA 1HHKA 3V79C 2F5BH 3INOA 4J3VA 2ROYA 1FO0B 5I8EB 4NGHH 2XA8L 1RUPL 3KDMA 4MZIA 4OZHA 2H8PA 1GY1A 3KYKH 5IOPA 3EADA 1FG2B 4PTTA 5C0BB 2YAEA 4NXKA 2GCYB 3MLXL 1OPGH 4AYGA 1FH5L 2ZXCA 3PDDA 4JO5A 4OI7A 2Y24A 3SDCD 5HSFA 2WD0A 1I7RB 2KLRA 5IB3A 2XXMB 4S1DC 5J9PB 4PJBB 3JWNH 1T1WA 3KJ6H 1HILA 4MA8L 5DRWB 4NN6C 1KCRL 2X2IA 3KNBA 5IMKA 5JYMA 1U3YA 3NN8B 4NRZB 3QR2A 2BCMA 2FWOB 4FA8A 3QIUC 1O7SA 3GXIA 3HRZA 4BWTA 1ZPUA 2CKBL 1N19A 2VXQL 1PX3A 1F4XH 2PW2A 3I02A 2AV7B 4OLWL 4WI8A 5DMKA 2YSSA 3OF6D 5JPNC 1KCSL 4OM0H 2E56A 2X12A 1INDL 4Q9QL 3STLB 2Y1YA 1JZEA 1A6WH 2B5IC 2B4CH 3WG7B 1QQDB 4U1IB 3F85A 4EDWL 4F3FB 2FQDA 5D1ZB 4CUCA 2WXQA 2VLMD 3FUHA 1GPOL 3DDFA 5CXPA 3W0WA 1HXMA 5I73B 4PVLA 4XCFL 3RNQA 1FO0L 4PJXA 4NQVB 5F7HA 3F7YA 2VGLM 1I9RH 4IRSA 5BOPA 4W9FC 1AFVH 1KBBA 3X2JA 3FQXB 4XZUA 3CFIC 3VFOB 4AW7A 1SJHB 4JHAH 4JCWA 5L88L 4UIKL 2JKNA 4XCNB 1FFTB 2X4NB 3MO1B 4RFNC 2OXHB 1NPUA 4MMYB 4R5VA 3WSQH 3QWRA 4YLCA 3HE7B 2AK4D 5EU4A 1IKOP 4PV1C 1P6FA 1INQA 4M48H 4E41E 2F54D 1MCPL 4X7TB 2H32A 2R1XA 3RLSA 4MBRA 1QRKA 3NEOA 2HRPH 3ARQA 3GXTA 4MX7A 1OF2A 1CZ5A 4KOCA 5EEYA 2NY4C 4XMKH 5GISL 3MYZA 1OP3H 1TTBA 1GZHA 4MZRA 2V37A 4XHJD 5L4IA 5EG6C 5LO7A 1YEHL 4YPJA 3CVIL 2AJUL 5F3HA 4DHLA 1OAJA 1ZSHA 2IMMA 3BSZA 4H25B 3VXQB 3DV6B 3T2OA 4YNYA 5HYFA 4L23A 2CZNA 5LKNA 1VJSA 4XHQA 1HXKA 3QSKB 5J3HC 5MEOB 3BVTA 3IJ7A 1CICC 1ZLDA 1ZJBA 4CNIB 5BCAA 2WWNA 2DMCA 4MJ6A 4U3CA 2IOOA 3MLWL 1MIML 4P4RA 2D8KA 2CDFB 2MPAH 3WFCL 4D9QD 2QLYA 1HIML 4OZIA 3GK8H 1A14H 4FCAA 1LP9F 3K3QA 3UERA 4IBQA 4NHCL 1IGCL 1PGRB 2VIRB 4OZFG 2FIKB 2IAAC 4DVRL 2PETA 2ZUSA 4RIRB 4OJCA 3GS4A 1AS7A 4ZAKA 4JRXB 3T9WA 3FU7B 1JHTB 3NA9H 3VYNA 1I1AC 3R06B 5HI3D 5CEXB 2EDEA 3UTTD 1Z6JT 3MBED 5C1MB 2DQIL 1F90L 1SM3H 3ARFC 4R26L 4Y8AA 3KPRE 5EU3B 3N0PB 3KVPA 4BFEA 2IV8A 1OW0C 5DO8A 1KYFA 2D2OA 1MWAH 1MFBL 4M5ZH 5J0BA 4OZIB 2NVYA 3X2PA 5MEND 4P4RB 2B39A 2XWJA 5AKTA 2ENSA 3QDAA 1H0HA 1BF8A 4FG6D 3DGCR 1NDGA 4GRWH 1KLUB 1Y6KR 1NGYA 2G3ZA 1HE7A 3LTVA 5SV3A 3UTSD 1P7KB 3FB8A 4IU3A 3D50A 4K7PX 4W68A 3R1GH 4EUPH 2P8PB 4AYFA 3IXTA 3KLDA 2ZKMX 5J5EA 2R8SL 4Z23A 2CCWA 3LPPA 4JPWL 4OF3A 3JWDC 4PJIB 1ULVA 2VXTH 1MFAH 1SY6A 4P2OC 4R97B 4AKOA 2AGJH 2J5LB 2RQ8A 5C0DA 4ERSL 3RVUD 1ASPA 2JB5L 2FX9L 4MX7B 2BWIA 2H47C 4MQTB 4Z7UB 1LK3H 3IFPA 4LSPL 3O3DA 5B1KA 4NZTH 4X7TA 1SMDA 4OLZL 4WCYL 1W2KT 2HUEA 3GLEA 5C0FA 2VUYA 3IGUA 1X5XA 2CBMA 3GBLA 1EDHA 3K74B 3QI9B 3KYNB 3WXVL 1OOWA 4HPYL 1A47A 1U3NA 4P9HH 1FL6B 4QRUA 4IRJB 3S36X 5I1JH 2H26A 4LCWD 1ZD6A 2GY7B 3L3DA 3MBEB 2OTUB 3NEXA 2NNFA 4H1LA 4HULB 1ZANH 3QRBA 4Z7OE 2ZUUA 1Y1UA 4CN4A 2JIQA 3CK0L 5IKCA 1MUJB 5ADOL 1NAMB 1XZWA 1SYVB 3ULUD 1MDTA 4GA6A 2NPLX 3ISWA 1WT5C 4R96B 3L1OL 4HP5A 5EU6D 3U4KA 4A6YA 2ZX8A 3D3VB 1BIIB 1JWUA 1AI1L 1IJ9A 1I8UA 1MVUB 1MREH 4HCGA 4U7SA 4GAGH 4TTDC 4AG4H 2VUOA 2OMZB 5IQMA 4H0HB 4C56D 1ZMYA 2W60B 4QRPE 3L3OA 4KJQD 3T0EE 4OCXH 2JJUA 3FOLA 4JFPA 4J3SA 4BFIB 1XR8A 4HKBB 3AXIA 4M61B 1HL8A 4BCXA 4DP4X 3FTSA 2F8OA 4X7CC 3ML8A 4PRID 2YQBA 3UPAA 3GRWL 5D1XA 2B08A 4JKPL 1S46A 4MKTA 3APNA 5IB3B 3BKYH 3FUKA 1KV7A 4CS0A 3QH3A 3EO0A 4KI5D 2NMSA 4F2MA 4ZG1A 4BKLA 1MFEL 4XCEA 3C09B 4PLJC 5BS0D 1F5WA 3TWCH 3BYTA 4FEIA 2ENQA 5JLZA 4KGJA 3HG3A 3B5GA 1RZ8B 1VGEL 2BE5D 4Z3IA 1I1CA 1N6UA 2AK1L 3JQOB 4KPHL 1JRHI 2EYSA 3V4UH 4LESA 5EO9B 3ZDYE 4F7TA 5J1SC 5ICXB 2ICEA 4G3YH 4M1CC 4OCNC 1L9MA 1BVLB 2J6EA 1TWAA 3O41B 5HDBE 1KIUA 2ISDA 3K8LA 5F7EH 5KANI 5IWLA 4Y5XC 1HHJA 1EPFA 4F7CB 2PW1A 3L6FA 3UGUA 2PPCA 1HCVA 3RZCB 5CD3A 1D5XA 5TK4A 3VX1A 4N20A 2ITDA 2NLJA 2V45A 5F7MC 2E76C 2QV2A 4WFHE 3RHWF 1ZXKA 4R90H 4JPIA 3UZQA 3UABA 4I0KA 5EU5A 2ZJSH 3MBWA 5AAMA 1CE6B 4NQUA 3UL4A 4HQQH 4S2SA 2A9ML 3VXOB 1SHMA 1DVQA 2BW4A 3TPUB 5FM5O 3HIZA 3H2PA 3O0RH 4HZLB 4N24A 2NDGA 1J1OH 5AW2B 5JA8B 4UMSA 3S5LA 3B9VA 3TYFA 4DGWC 3T2PA 3DVGB 2G0LA 1C12B 3AAZB 3IF1B 5GGQL 1IIKA 3RX9A 2LVEA 3IAGC 1UXSB 5CJXC 1PZDA 1U95B 1SEQH 3FUNA 3QARA 3CSPA 4XWOD 1T66C 1U42A 2X4QB 4LEOB 5ICYA 3C2AL 5IHUL 1SEBA 1T04B 5IVZB 4TOYL 3V6ZA 1PAZA 1AO7A 2BRQA 4WK4B 1D5RA 3QDME 2CJTA 3JBG7 4FQHA 3L95B 1G6RA 4Y2DA 4QRTB 2YS4A 3ZO9A 4ZMWA 1SMYD 1KPUA 1MCBA 4LKCB 1QBMH 3IWUA 5C2BL 1KXQA 1LEGA 2PYEA 5TF0A 1JMZA 1IT9L 1UWEL 4Y9GA 5T5NG 3X1FA 3SYQA 5EEZA 3UJTH 2MQCA 3VG9B 1ZT1B 4O5LH 5IROA 1AHWB 1XD1A 3UTTA 2UX6A 3GBDA 4FXGA 4RISH 2EIJB 4LMQI 2BOCA 4YDIH 4NQDD 1D7BA 2Z7YA 2A3TA 2NY4D 3AWEA 4JFYB 3U1SH 3B7RL 1MDAA 3SPVA 1L5GA 3ECBA 5DVKA 4WWKA 3WUWA 3DETC 3RFZB 1RSYA 1IEAA 2WLMA 2VR5A 1XIWC 2J8HA 5D5MA 1DANT 4MGXA 5D9SA 4HUVA 3RA7H 2HJKB 1L4IA 2J6EH 5IJBC 5KYWB 2YN3A 3Q8EA 1JZDC 5KOMC 1AQDA 5AOMA 1QCSA 2WBJB 3ATEA 3E8UH 4OAWB 2GKIA 1LMIA 2AJZA 1ORSA 3QUMH 4RGNE 1TQUA 4PV9B 4RWYH 1FAIL 2A6DA 5AZEL 2JTDA 3Q5TA 3G5XB 4JJ5A 4LCYB 2V3EA 4JRYE 3H3KA 4ONGH 3G9VA 2VMJA 2VWEE 3QP3A 1P4IH 3ABGA 1I9JL 2ZXQA 4MAYB 4IRZH 25C8L 3OX8B 4U1GC 5C7XH 3N50A 3EIFA 2D03H 2KQMA 4ZRGA 5E2UL 3U6RB 4OF0A 3WIFA 3OUGA 2C1OA 1T20B 3DYMA 4G7SB 4YSCA 2HKHH 2VXVH 2HTKD 12E8L 2CK0H 2J8UF 3MBEC 4HIHB 2R7ZA 5E2WL 5EOTA 5AB0A 3DARA 3MBXL 1A21A 1F58H 3HLAA 2DYPD 3H3BC 3UZVB 1DVTA 4Q0XH 4MKMA 4Y2NA 1UWGH 1CZ8L 2L4OA 2ZWYA 4ZUWA 4LCUA 1NGQL 4LT7A 3X2LA 5INDB 3KH4A 4ODSL 5IBTH 2EVGA 1GYVA 3L9EA 1E67A 5FYJD 4F33B 5GZOC 2X4TA 4XX1G 3HR5A 5KG9B 2ENJA 3KXFE 1CTOA 4PJ8A 2AJSH 5C07B 2FBJH 3BZFB 5CJOH 1T7ZA 2R1YA 1B4TA 4PJHB 4N0FA 3T3PB 3X2MA 3HN8A 2ZAGA 4MQSB 1JK8B 3HE6A 1EXUA 4RFEB 3QQ9C 4JY4A 2H2SD 3BT0A 1P1ZB 3UOAB 1Q1JH 2GSMB 3HNTL 4X9FA 4V1DB 5CBEB 2XETA 4K7FB 5BZXA 2COVD 5DHEA 4X50A 1WZLA 4GKLA 4HKJA 2Q3ZA 3RVUC 2DN7A 4QHLB 3NTCH 5CZKA 2R4SL 1B4JH 3KPQA 5EZIH 4LOVA 3SDDB 3K4DA 2H0FA 2X6CA 4OGQC 2ARWA 3QJTB 2JFCA 2XTJD 4GKNA 5EUOA 4TUJB 1Y0LB 1Q9KA 4GUPB 5CEZH 1CLYL 8PAZA 1HCYA 3US1A 3VFWA 1TWCA 4OCSH 3ZGIA 3NBNA 4KK5C 1FIGH 4OLXL 2BZDA 2ZD0A 1AO7D 2VDNL 5F9JA 5JNYB 3N85H 4HK3N 3KPLB 5AALA 3FULA 2R27A 1RJCA 4QWWC 5I17A 3FQNB 3IYLW 3AABA 4QD2E 5K5YA 4UU9B 3SDXE 4G5ZH 2ARJQ 3ZE2F 4AQEA 4D0BB 4HPOH 2ADYA 5DJ8B 4F9LA 5I66B 1OAKL 3UYPB 4KVNL 3PUCA 4P23B 2Q7YB 3KGUA 3CUPB 3BPNB 4QRTA 1E43A 1KTDB 3OGCB 5DC2A 5FYLH 3QR0A 1TQSA 1DCLA 4L8CB 1ZVSA 1AO7B 7PAZA 1AY1H 5EMYA 3EO1A 1JF6A 3OB8A 3LN5B 2DQMA 3QEHA 4I1RA 4WI5A 5I74C 1ZLSL 4ODTH 3I3BA 1CFQB 1UOVA 4X6EB 1J9SA 2R2HB 1KUMA 3AACA 3EOAA 5JHBA 1J8HE 1F3DH 2X9XA 3Q8AA 2ETWA 2OX5A 2OSWA 4MNHB 3AAZA 2LGNA 4WY7L 2V17L 2OTWB 1PYWB 1A66A 4C83B 4M8VA 3CHSA 3Q6FA 1K72A 5IT2L 4KJQC 3LZFL 4HH8A 4A2LA 3KWXA 4FLHA 4JFWA 5LBSH 4QNPF 2GT9A 4FTVD 1PG7W 1XB6A 1CE6A 1QSZA 1RPKA 1ZV5A 3FB7A 3ALXA 4KK9C 4L3EB 1IV8A 3O6KL 5DVMA 5E5MA 4AQOA 3ULVH 3MGAA 4PQXA 3SBRA 3U4EA 4TVPL 4R4FH 4H8UA 3WNLA 1NGZB 5F7KC 3WOVA 1RK0B 4MAUL 4NCDA 2XVGA 1JPFB 4FQ2L 4N6RB 3UJJH 1L0QA 3ECVA 5EIIB 2NX5B 5TPWL 4D8PB 3UDWA 1QFWH 3QT2A 3MGTA 4DN3L 3DKHA 4WI3A 1WAEA 4LSTH 4TVUA 5IQ7L 3F8UB 2LVCA 2VH5H 4XPAH 1I31A 1Q4NX 1MXGA 2HVKA 3JTSB 4GI6A 5I0ZA 1HXYA 2DYRB 1TCMA 2NZIA 1NMCB 2HTLD 5BQ7A 2WCPA 3SBWA 3M88A 4ODUA 5FW6A 1GXEA 2WLIB 2VLME 1HQRB 3MUUA 2G3MA 2ZOLA 3B34A 3PQYD 4N9OB 4TN9A 1I8LA 4OIIL 4HSAC 1DBJL 5KBPA 4PRNB 2B2XH 3WNMA 2APBA 1QFWM 2EDXA 4FMFA 2Q8AL 2CA4A 3GSOA 4MCYA 4JDZB 3NJMA 4P59H 3DUHA 4FFYA 3RGVD 1NH6A 4LHJB 2PPFA 2QPUA 4OI9A 4ORGA 4XNUL 5E8PB 2ARJA 1T21A 4YK4B 4ES8A 1YCSA 2ENGA 1UT9A 5KBNC 2HB0A 5HYJD 3FOLB 4BFIA 2FO8A 2AFNA 4G6FB 5EIIG 4HIXL 3T4AC 3VWKA 5E8NA 1DP0A 4GAYA 4N2AA 2ZG3A 3QA3A 2QGEA 4KH2A 1DQQA 3P3SA 1P53A 1NCCH 1AVAA 3X3GH 3D25B 2BM3A 2BVOA 5TDOA 2AXJA 4JM2C 3LDBB 5SV4A 1FWXA 1OLZA 3A3YB 4KTYA 4R96A 1T83C 1J5CA 5DC4B 1MH5B 4GSUA 5C08D 3KW7A 3WY1A 3D09A 3ORJA 3P77A 4G43B 3ZDYB 4GI9A 5IQLA 1OK8A 4R2GB 1MRDH 2Z6FA 3MNDA 3EBIA 4FABH 1J0KA 5L7XL 2J5WA 5C0ND 4OIAA 1BZEA 3FTWA 3L3DB 1F6LL 2IBBA 3DMRA 1PZSA 2B1OA 3QXUA 1K5NB 2P47B 4QRPA 2CM5A 3DXAB 3GK8L 4IRJA 4RSVA 3EDKA 2HT4C 3FAWA 2FNBA 4HT1L 5HPOA 2DQHH 1Q38A 3LQZB 3RWIB 1CFSB 3EH1A 3MRBA 3C08L 4AVIA 3PXJA 5ICZA 1CCZA 3WY4A 3BX7C 3KWTA 3U82B 4RSYA 4EZLA 4W9CC 3FL7A 4P2RD 4HLJA 1LLAA 1PU0A 1WS8A 2DI8A 3U9PL 3ILQD 1F90H 5T3XL 4N87A 3RKDD 1T0NA 3PCYA 2YD2A 1G7MA 1C8PA 3MU3A 5E94A 1H9VA 1FZJB 4AYID 4LLYB 1MAKA 1G6VK 4FXKB 1AKPA 1UACL 2UVFA 3WHE1 4UUJA 5GGTH 4CC4C 3ME0A 3IXTB 3K91A 3ROOA 2EDHA 4ZNEA 4BCYA 2Y7SA 4F7EB 4JZOB 5BRZA 4ZMTA 3BIKA 5B1JA 1F11B 3QQDA 4OCYH 4P3CL 4N8VB 3EH5B 3WS6C 3VVWA 4I0PD 4NZRH 1OV8A 3GWJA 3ZY7A 5DC0A 4KDLA 3VWJD 4PRPA 3GPEA 2P49B 3K6SA 1ETZA 3GSNH 2FQFA 4XBGA 5SX4I 4HS8H 5IJCC 1BEXA 5CILL 4GINA 3ZRSA 3RWCB 4MZ3A 2WC7A 3BZ4B 3AFLA 3L7FA 2ZCZA 4YBQC 5ID1B 1ETA1 4UILL 2VLRE 1A4KB 2VO8A 5I6PA 3EDEA 4BFFA 2WB1A 3GTPA 3BD3A 1GS8A 2H9GA 3P4NA 4GRLA 1CLCA 4AGLA 3F05A 4JB9H 5C8JA 1KB5H 2NNAB 3MCG1 1SBSL 4KQ3L 4Y4FB 3PXLA 4JFXB 4U1HB 1J18A 3TZVB 4YFDB 8FABA 3P11L 3OF6A 4MVBC 4AWJC 1Y1DA 2JH2A 4Y5VC 4GPVA 4NWTH 4CNIA 2IH1B 1C1EH 3I3EA 3UTPE 1E5YA 4NOHA 3FFDB 5EH1A 1DN0B 3V55A 3WDIA 3ZYZA 3QIWC 4X6BA 5JHLA 1U8MA 2HFGL 1A7QL 4LSRH 3X2HA 1O6SA 1YEIL 3JV0A 2YUXA 5F7FA 1WA0X 1ODUA 1B88A 1QSEA 1TU2B 1YEKH 2YLKA 1PDKA 3RRQA 5F3HB 4KKPA 3SDCA 4XCYA 2R7EB 3BMVA 3DX6B 3MRJA 2X0WA 5FYKD 4ZTEA 4XWOC 3V6FB 4OJAA 2IXQA 4HS3B 3IBOA 4LOUC 4EI5B 4A68A 4ANXA 2G75A 4BQ9A 4EVNB 4OZIE 4G43A 5AQ0A 4WTZA 1MH5A 4CVXB 1E4WH 4XPHL 1JGUH 4NM8L 1UZGA 2H32B 2R1XB 5E6SB 4DEWA 1Z5LA 3AREC 3VW3L 1NEZA 4NJAH 4NC2B 5MEPB 2O5ZH 4XN4A 2VR9A 3IJSA 4LAQH 5TE7H 2KLSA 3NIFF 3W0WD 4YR6A 1IGFH 1NEZB 4H8PA 4W4OC 5E8NB 1KN2L 1T1YA 5CLXA 5DLMH 2A9DA 4Y19D 2V8LA 3K8MA 4IRSB 4WHYH 1CE1L 1ND0B 2Y7OA 1A02N 2ZF8A 4Y16B 3KBHE 1R3IH 5G4OA 3WL9B 4Y4HC 2DWSA 5HGBA 4CMMA 2Y1ZA 3CDZB 3CH1A 4KNTA 2DQGH 3OG6B 3T0ED 4U1IA 1DJHA 3MFFA 1MRCH 1AQKH 1D5MA 4XO3A 4TSAH 2PO6B 4PLOB 1IFHH 2VPZA 1G6RH 4XMZA 3ULUE 2DQTH 1U8MB 2Y3NA 5JPNA 3OKEA 4KY1L 1UHDA 4ZXBB 1RP9A 2Z65C 1UWXH 3NRQA 1EHLH 4KXBA 1OAZL 1WWWX 4CRYG 3D18B 3PJNA 3MREA 4M7JL 5HYSA 3QZBA 3NQKA 3TZVA 8FABB 1JPGA 4HZAA 2EC8A 4RNRA 5BS0E 2GITA 5D7LA 3ELQA 1EFXA 2F58L 5HYJB 5AYUH 4X2UA 2FH8A 5JW3L 2OMTB 2EDWA 1ILUA 4NOBA 2X0UA 2J1ZA 4WFGE 4ODHL 4C4UA 2CLRA 4FYSA 4H44C 5CZVL 1JPFA 2HTKC 1B90A 3IDYC 4PRIE 1BJ8A 1E2ZA 1WAAF 5TQ0L 1HK6A 3VFGH 1XMEB 4YSDA 3CJJA 2AZUA 3T1FA 3S8GB 2VDLH 4X4XB 1RCYA 3U0TA 1ETZB 4XBGB 5D72L 1RZKH 5JOFA 3U2SB 4WK0B 4YHKL 2OSLB 3PL6C 2XG5B 1N2RA 2GT9B 2R0KL 2YQ2A 3CPLB 4P49A 2XRAL 3ZQXA 2C9AA 4JPKH 4ODBD 3ISYA 1TZOA 3VSQA 2BWDA 4IIZA 4YSTA 2APVA 5D1ZI 1RJYB 3CMOH 3KLAB 4PW9A 4R4ND 4WHCA 2CHNA 5B1AB 2IMNA 5JW5B 4Q4EA 1CGSH 3MLXH 4X7DC 2OX5B 2OMNA 3M45A 4A7VA 4W93A 1E60A 4OFYD 1FYTA 1I7UA 1NCNA 2HFFB 3DMMC 3VI3B 3QJUB 5F1OB 1Z9SB 4YN3A 2FEDC 4ZOBA 3K72B 4JFDB 1FZJA 3LH2L 5HHVL 1N0LA 3QIBA 5L8KB 1TJHL 3FJTA 2WQXA 5KANG 5I5JA 3RVVC 5EDSA 3MRCB 1L3NA 2X40A 2H0EA 2Q7YA 1CXHA 4P23A 2GSIA 2Z8RA 4G9FB 4HJEA 2R83A 1A7RL 4R7LA 4N5ED 1AKJD 2W0FB 4FEMA 1BQRA 4C58B 5HGGS 3GBMH 5LBGA 1D7DA 1HOCB 2CIIB 4ZZKA 2KH2B 3K6IA 3PU7A 1NAML 5DD0H 2ATPA 1ZE3C 1JTPA 4M56A 5AAWA 4PSPA 1CYXA 1FFPA 5L6YL 1WCBA 2BRRL 3KVDD 2L0DA 2EXYD 1URLA 2VDRH 4AT6B 2B3RA 4N0YH 2O6CA 3DX8A 1TZGH 3LXUX 4MXQC 4ONGL 1KC5L 5T5FA 3TN0D 1ADQH 4WU5B 2AI0L 3SKMA 1TJIH 2NTFB 2NAPA 2R0ZH 2KMWA 4CU7A 3MNVA 4GB9A 5T33L 2DDQH 1JK8A 3WS6A 5DRXA 1G8JA 3KHQA 2FSEB 2IAMA 4FYRA 4M03A 4PJ6A 5D7IA 3D25A 5IV2A 4PS3A 2OK0L 1P0SE 4KWUA 3RUGF 1NFDA 3VRLF 3FT4A 5DQ9A 2A0LD 1BBDL 2H1XA 2X4TB 1AMYA 1P4LA 3MBXH 2ZOUA 4F33A 3MROA 1KXTA 3QO1B 4XPTH 1UA6H 4Y7MA 3FW6A 3IETB 1WFTA 3VRJA 4ZJ9A 4QIRA 4U6XA 2J1KA 5I8KL 3O2DA 1DEEA 3V8CA 4JBSA 1TFPA 3JWDL 2R0LL 3DUSB 3IDUA 4DFIA 4YSEA 3D0AA 4M62H 2NY7L 4WW1A 3OD3A 5GISH 4TNWF 4GUOA 2HRLA 1IFRA 3PHOA 2CJUL 2ITEA 1NCBL 3X1NA 3ARBB 5EO1B 1TWHA 2OMYA 5F71A 3WHE0 4IOSA 5E8OB 1XBDA 3WIFB 5M7QA 4LLWA 4M9OA 5ISZE 2HT3D 1YNLH 5CSZA 3NIFB 4MSWA 2AF2A 4X80L 2FCBA 1UT2A 4UQBA 3PP4L 3QCVH 3I2CL 1FVCB 1JFQL 4XNMA 1VHPA 4ZTOL 5FUOL 3I74A 2IH3B 1AGCB 5A2AA 5BOJA 2BSTB 4EUPG 1SNRA 3V52L 3CXHK 4AVRA 1DVFA 3IT8D 5I6NA 2H0PA 4H7VA 4GO9A 1CLYH 2XTJE 3F7KA 5E5UB 5T1MB 3U48A 4BKTC 5CHNA 3WIHA 1IRAY 5EU6B 4WI6A 1U8IA 4FQQB 7TAAA 4WU5A 3BWAB 4IQHA 1JRHL 2BVUA 4F57H 2Q9OA 5TDPB 2HVJA 3N55A 1QVOA 1VEOA 1N68A 2YD3A 2PCYA 2WBXA 3KYOA 1QLFB 1SOKA 2N59A 3K2IA 4GFXA 3O3AB 3TA3C 5JDJA 4HGWB 3T4AA 1AY1L 2BO0A 5KN5B 1SXNA 3KEDA 2F1BA 3NIGE 2UZIL 4KKQA 4URKA 4O2FA 4YO0A 5IW1B 5AW9B 2EIEA 3HU2A 3D4GA 1CBVH 1KCVH 1AOZA 4TQPA 2JCCB 3IAQA 3VDAA 4YK4C 1PSKH 4U1KA 4AL8H 4EBQH 2GSIB 3GTVA 4GYBA 2NX5D 2P8MA 3W11C 5CMAB 3UAEA 1F3RB 4U0QB 4WU7B 1UGKA 2Y2YA 3LN5A 3QEHB 4NQCB 3TFBA 3ROLB 4R84A 3J7HA 2XPGA 3H9SB 5KVGL 4LL1A 4MNGB 4QRAA 4TUUA 1G9NL 2YAPA 4K3EH 1KIRB 1IVLA 2X42A 1V05A 5C3IA 1VRSA 3AS1A 1RV6X 3Q05A 4J12A 4IDLA 3EZJB 4BFBD 4B96A 4XXWA 4R4FL 1SZNA 1OGAE 3PGDA 4PREB 1PG7L 4JQIL 2ITCB 3GZQA 3MV7B 4FGMA 3Q01A 3FO2A 4XNQB 1J1XH 1YEGL 3GIVA 3I85A 1JYNA 2QL1A 2OSLA 1ZA6B 5ERWB 2ICES 5GGVH 5I1JL 3ALPA 3BW9A 3LZLA 3FTGB 4RAVB 1R46A 3NJVA 5LNEA 4W9GC 4PCTA 4N8VG 1Z32X 5DMYA 2PABA 2C5DC 4IGBB 3T0EC 1MJ7H 4K7FA 3CK0H 3GSVA 3JTTA 5K33A 2ITDB 1JZ5A 5J13C 2FNWA 4D9RD 3OL2A 3RZCA 4Z76A 4ZUTB 3ARZA 1EZVY 2LFGA 3L6FB 4GY4A 5HYJA 3MZGB 5EC2A 4MNGE 2W95A 4XOEA 4XWGH 3GEFA 1AI1H 2CHXA 1JPGB 3GSRB 2GPZA 3RWJB 4BFRA 1J8HD 4U7MA 5HYSB 4BE6A 2EUXA 1M7IB 2CO2A 3GRWA 3LS5H 3LV3A 4GSQA 3ZTDC 3T1WA 4ICWA 5F7UA 1WFNA 3GS7A 1OPOA 4QHKI 5JR1L 4DZBB 1FZMA 4S1QH 3TBCA 4UM8A 1BJMA 3W9DA 1BZOA 5ICUA 3VXMD 4C54A 4ZFOL 4TMPA 4P23D 2XG4A 2Y9RT 4LSDA 1YMMA 5CO1A 5C3TA 3GSXA 4KKCD 5J12C 3BPNC 3D33A 5DYGA 5IBUB 3U6RA 4YHPB 3EFFB 3GLDA 4IHBA 3GSQB 5E08L 4AM0Q 4JCMA 2WTRA 1MFEH 1EUUA 4B5EA 3SUKA 2JIXD 2W92A 2XPZA 1H3VA 2K1MA 1IZKA 2W9LA 3D34A 4U6XB 3HI5H 4G42B 4GG6A 1N3NA 4U2YA 2CE6A 3CFBB 2ALAA 4DO5A 2F53A 1MPAH 1MZZA 3QZWG 4XMPL 2WXGA 5D8JH 4KDVA 3HG1A 3D7PA 4WNQA 3BPLC 2JJTC 3HMWH 3TXAA 4A04A 5C6PB 7FABH 2E86A 3RTQA 3DO3A 5L88H 2WVSA 2YU9A 2AE0X 4G6FD 3E1F1 3H2QA 5J89A 4LGRB 3L5WB 2FEDD 4JG0H 2XV0A 2ZCKL 4OJFL 3C60B 1Z9OA 1FDLL 5E4EB 1XIWA 2ATKA 4OU3A 4G9DB 5EBWB 1MI5A 2PR9A 2NZ9C 1IC4H 3VFUA 1A6PA 4NQED 4QT5B 5C07D 3QO0A 4AZUA 4LRIA 1F4YL 5I1KL 2VABA 3X13B 2YGNA 1FV1B 1OE3A 1SXSA 2HLFD 2GJRA 2H26B 2K9FB 3EO9L 4XGZA 4AI7A 3KPSE 3LYRA 3QXVA 1YDPA 5JMOC 2DS4A 4M4PA 5LNDA 1AHWA 1RK1A 5DD3L 4ODXA 2BP5M 3BI9X 5GGRA 4QPEA 4JFHD 1P5VB 1NUDA 2WQSA 4QXWA 2IGTA 2ZX7A 2VSDA 5GGQH 2EXYC 4W4OA 1WFJA 5DTFB 1NSNL 3KGTA 1GY2A 4FQHB 4JFXA 4U1HA 4KROB 3GSNB 4RAHA 4XNBA 4XBPA 4KKRA 2JVUA 4XNYH 3TN0C 3CU7A 5IVOA 4HWBL 1Z5HA 3WTYA 2YXFA 5ICYB 4M7ZC 1OM3H 4PY8I 3DO4A 1KFGA 3SPCA 3T8XA 4HU2A 4UOJA 3IJHB 5C08E 3FO9A 1QACA 3BJLA 4AYFB 1GYUA 1KLFB 1HH6A 4W9LC 5GHWH 2VDMB 1A4KA 4PRHB 1CXLA 1H8SA 2K4WA 5KTEH 3BVNB 4W9ZA 5SWSB 3T08A 3GTMA 4YDJB 1KNOB 3OPUA 2YHGA 4KDTA 3TO2B 2EH8L 2XWJB 1G9NC 5LGHL 4LPYA 1ZGLB 2FATH 4JO1L 1GGBL 3EYQD 1NJ9A 4TV3A 4BA0A 5K9KB 1AR1C 3GTTA 3QCTL 3AS2A 4QHUB 1KLFA 2XLLA 2A83A 3ZN6A 3RFZC 1XF2A 5I2IA 3KAAA 3IJHA 3B1TA 1DEDA 4LCCB 2IALB 5FGCE 3LKPB 1H0DB 4D9QE 5T3ZL 2VAJA 2YPKA 4HUWB 5E95B 1BVLA 3QUML 1OY3B 4AK1A 4RWYL 4YXLL 2J3SA 4ONFL 4ZSOA 4KVCH 4I18A 3AM8A 1RJZA 4JZJB 5JIPA 3L9RB 1AGEA 5CCJA 3MZTA 1ZTXH 2G5RA 4ELKA 2XZZA 2AJVH 2PR4L 1LO0L 3I6KB 1YO4A 3WDJA 4KK8C 1XGQA 3MOBH 3QUZC 4ZFQA 1NZRA 5I0YA 4NO0D 1ASOA 1NBCA 1USQA 4XN7A 2J25A 3DXAA 4KTEH 3DWTA 2WXFA 4IOIA 4XGZB 3VW3H 4PLKD 3CDZA 3SULA 3AADB 2HJFA 3BO8A 3WL9A 3H42H 3R19A 3SQOH 5J6GA 5KJRH 3QVAA 1A1NA 4Y16A 1EDYA 3REVA 1CR5A 3N5AA 1MFCL 3R8BB 4XXWC 4K07A 1BVNT 3TN0B 5IOKA 3QUYD 3E6HB 3C60A 3MLZL 3AVEA 3OB0K 1INEL 1ZHKB 3CVHB 4ZAKD 2EDDA 3ZKXC 2A9AA 4G6JH 2Y5EA 3Q3GA 3GD1C 3QQXA 1TLMA 5C0GA 1E2WA 3O45A 2PCXA 2I60H 1QSFE 2AJ3B 3P4LA 4JVUA 4Y9CA 1JGDB 3RGVA 1WZMA 3V0IA 2X4NA 1FFQA 2VSMB 4FP8H 4XVJL 3TEYA 2FBJL 3NVQA 3RWGA 4WV1A 3FQXA 4JDTL 4XZUB 4H1LH 5I1CL 1M71A 1UOWA 3ZPDA 4JK0D 4KODA 3G5YB 2NY0B 3ML9A 1MCQA 4EI5A 1SFDA 1I9IH 1PLCA 5J6GB 2JIRA 3MRJB 3KWVA 4XMXA 1SXBA 3AWFA 3T6QC 3FQ2A 1T03L 4FFTA 3IEAA 1MLBB 3QPQC 4UAOC 1CD8A 4CC1A 1XXFC 4UM8B 1NCGA 4R83A 4PRNA 5F7NC 1QSEB 1TU2A 1C16A 4EKJA 3L4XA 1T2JA 1RUQH 3FFCB 4F2FA 4OIBA 2ZOLB 3AMLA 4G2AA 4LPWA 1X5GA 3MI6A 4G8GA 5D7JA 4ZI8A 5C2UB 1DN0A 1HQRA 4L29A 1XD0A 2W81C 2AV7A 2IH1A 5DHVB 1DE4B 5BZZA 1MNUH 3KYKL 3BAJA 3HRZB 1FZOA 1JWSA 2JELL 3IWVA 4QYOB 5D2LF 1J5OH 1LEKB 2R29L 3X2OA 3TU6A 1MNNA 1FPTL 5TH2B 3QRFM 5KOVC 1EZLA 4W9IC 3P4NB 4YHKH 5E1QA 1I7RA 4OF5A 1WIOA 3QNXB 4XP9L 4I0CC 4D8PA 3P40A 2XWRA 4DUVA 2WN2A 3DRTB 4IRJD 5F7EL 2DMGA 2VPWA 4CRZA 5HHOD 1RK0A 5D1ZD 3TF4A 2IBZX 3FB8B 1NJ9B 1UEMA 2G5BA 3BZ4A 5T5FH 2OR9L 1D5ZA 4Z7VE 2BSDA 3QFDB 5HVHC 2QT6A 4ABWA 1ZS8B 1G5GA 5AW4B 4JFZH 4AENA 4MYWB 3CAFA 4UT7L 2DWDB 4LKXA 5FYKL 3FU6A 1T4KB 1KNOA 1INDH 1UM4H 4N8UA 4ZPTA 4Q9QH 4BA8A 4GIAA 5FWRA 2YEVB 3BAYA 2WLYA 1O6VA 3QFGA 4RMWA 2VZOA 3LNEA 5B3JF 5I6KA 5A6LA 5I76B 2EUVA 3X2IA 4BH7A 5BRQA 1W15A 4GSRA 5DUPH 4RMVA 4KTGA 2P24B 2R2HA 4KRPC 3VDCA 3DJ9A 2FZ3A 2X89A 3VWKD 4HGKC 1KFAL 1U8OA 4LL4A 1XMWA 5DZLA 3QDJE 4L2YA 2OCCB 4HPHA 3D06A 1SVBA 5DQDL 5CINL 1JNHA 2BIQA 2CO6A 4WI2A 5HJBA 4NKIL 1SEQL 4MA1C 2WZ6A 4XXDB 2EDRA 3NSCA 1A7PL 3CUPA 4NQSA 3TV3H 4AQEB 4L48A 4MAYD 2DY2A 3IM1A 3ZIYA 1U58A 3PDGA 1EMTH 4ODXB 4M48L 1FFNA 2D0HA 1CFSA 5JNYA 1IBZA 1TJIL 3DV6A 2JTYA 2D31B 1IGYB 2NXYD 4JFFB 3NRPA 3BSZL 1YDPB 3OJVC 1KTKE 1W0WB 1ZA3B 5EIQA 1PQEA 3W2DH 3UAAA 2V7NA 5EUOB 2JJWA 2GY5A 5KS9A 1QYGL 1ZEAH 1CF8H 4YC2C 1RJLA 4AGMA 1H19A 3CMGA 4LZKA 3AU0A 1F45A 5HBBA 5JTWA 2VC2H 2YOCA 2VDPH 4WI0A 1FI8C 4PBXA 5EBWA 2WLKA 4JEGB 4F37F 5EU6A 4I5BA 4BKSC 1AQHA 4ZD3H 2DQDH 1AZZC 5FECB 2QQLH 4N0FB 1S9VA 2NR6C 4FQXD 1OAQL 3UACA 4P8QA 1B2WL 4GJTB 3I84A 3A6BL 2Y07H 5K39A 4FI6A 1T0OA 1DLHA 2ZG2A 4DP9X 1JF5A 2X4SA 4QRBA 2BSTA 5MI0C 3HR5B 3MO1A 4NNYA 2IPTL 1QO3A 3ZYOA 3PAVA 3D0LB 4DF9A 1KCSH 4K2UH 2HPOA 5INDA 4UT6H 4PJEF 2ADFH 4RESB 2PCFB 4RV0A 1ZLWH 5AB9A 3U4BL 4TSBL 3GF8A 3QJOA 3IMBA 1EXHA 1T7YA 3W0WB 3O4OB 4J8RA 4MD0B 2G2NA 1AW8B 4QXVA 3RG1C 4QO1A 1G4RA 4AQZA 3IVKB 4C4KT 3GSOB 4W6XB 4AZ8B 3JV6A 4MXWH 4JRLA 3UBXG 4P04A 1RZIA 1GAFL 2AXWA 4KTDL 4TLTA 1WH0A 4F27A 3QUMA 5BZDB 2F19L 3LNIA 1PFOA 1SJEA 2J20A 2O61A 1I9RL 5D6DA 4BXSV 3BDXA 2NXZD 2IPUK 2JKLA 4DP5X 1UFUA 1EEUA 3JWNG 4N1CA 2K7QA 2VAAA 1P4LB 3OR7B 5GS1B 2DJ4A 3FMGH 2FWOA 1H3PH 1QRNA 5H35B 4EN3B 5IY5B 3MRKA 2HG5A 5DFVC 2P7TA 1A6AA 2HVKB 3JWOL 3WKPA 2Y5TA 3GJEB 1A6TA 4I88A 4A6YL 1F8TL 3NSDA 4TULH 2IOMA 4Y16C 2AJYH 2NY4B 4JKNA 3C60D 4K23L 5EF1A 2TAAA 3OZ9L 2ICWJ 2MCPL 4U1LA 3T3PF 2VLJB 4N8CL 3FONA 3Q2VA 3VG0H 2JKRM 5A40E 1ZGLP 5DI8A 4TSCH 5DK2A 3IKKA 1TFHA 3KDMB 5K93A 1GRWA 3TJEH 4U6TA 4NZTL 4RZCB 5KZCD 2QTEA 1T5XB 1TTRA 3HE6D 4NAQA 1LO4H 1HT6A 2DQFB 4W4NA 3WE1A 2JB6A 4KO7A 2DQCL 2CRZA 3CZLA 1DSYA 2NQ3A 1A4AA 3O8XC 5EOQL 3KWWA 5C9KA 1YMHB 4P4KD 1MIMH 3DURB 5I19L 1MCNA 3U7AA 4AIZB 3H9HB 2X7LA 1L9OA 1SF3A 2WHVA 4CADA 5LHDA 4K3DL 3VQ1C 1MCCA 4G5ZL 4JN2A 1X4YA 2PTTA 3E2HC 3EO1B 4UOZA 1QG3A 3ROLA 1S78C 2VUKA 4UTAA 2LU5A 3NCMA 5FDWB 4L0PB 5GS0D 4ZAKC 5HJGA 2X4QA 3OC5A 4LEOA 5EUKA 4AEHH 1W8EA 5T1KB 3NZHL 1WEJL 1BOGA 5C09D 4G7QB 2W9DL 2OMBA 1TTAA 1G94A 2NX5E 4JRFA 2Z8WC 3DURA 3EYVA 4RVBA 2XC8A 1OQXA 4PI0A 4DAGH 2HLFC 2HVBA 2Z0UA 4ODVH 4WSGA 5I17B 5AUMB 2YXVA 2DQFA 1AYRA 3DSNA 4OGAD 3S5ZA 5BRZE 4ZOCA 5ISZA 1WCQA 1HAWA 2WANA 2ZSWA 3GNML 3O6FC 4LSUL 2BNQA 3U2SA 2E6JA 5ALCH 2BERA 1AKJB 4ZS6D 5CWSA 4K4KA 4A67A 1DQDL 2DKUA 1QVOB 5E1HB 5HD8C 2JQMA 5TDPA 3B43A 1KGUA 4KJYB 1BMWA 5IMLA 3H0GA 3ULUL 1U91A 1CDHA 3NFPB 3U2IA 2CLRB 1COBA 1U2CA 3HB3C 1IQWH 1FGVH 2HXAA 1BQKA 4P5MA 1ZLWK 1LK3L 5F93C 1NM9A 4U6VL 4LLDB 1EAPB 1PD6A 4R9HA 3BP4A 1LE5A 2FX9H 2WJ5A 4FL4B 4H8VA 4P0DA 3OTTA 5IQ7H 3DJRA 4EF3A 2K3TA 1KXVA 3D18A 4KDTC 1IGTB 3WFHB 4AC4A 1IC5L 4P2AA 4FXLA 4JRXE 4NNXA 5FC9A 3L5HA 3UP6A 5E7BA 3MLUL 3QJSB 3QUKB 2GAEA 4LLWB 3FUMA 3RJQB 5BZDA 3NP3A 3BRGC 3PWVA 4JFSA 2COQA 2OZ4H 1OVZA 4X6FB 4WEBL 5D1ZC 5INCA 3T77A 4CMMB 3MRLA 5B7FA 1WK0A 5D1XB 4JO2H 5D2LA 4Y2DD 3I50H 5B22A 4LSVL 4WEMB 1T7VA 1MREL 5DUML 3ZGHA 4BDVA 4JFPB 4NAMA 3JYBA 1KJ2A 2OLDA 4AG4L 5I71C 1AIFB 3M3GA 4ZODA 1T1YB 4AJVA 3O0RL 3W82A 1CI3M 4POZD 5DCCA 1NFDB 3C12A 4AQ1C 2LU4A 1T6VN 2EDNA 3AQXA 4YR6B 3WNPA 1EVTC 4PV9A 1X5AA 2WUCH 2RTTA 5D7IB 2R9HC 3UTOA 4Y5YC 3CH8A 1R6VA 2WAHA 3JVGA 3H7LA 4NZFA 2D7OA 4PGCB 1G1OA 2EIBA 1ZHBB 3UAJC 2BIOA 4CVXA 4L4TE 4PB9H 1IEAB 1ROCA 4ZO6A 5F7DA 4PGJA 2CR6A 1PAMA 4M1DL 4ZBJA 4WWKB 3WFEL 3WUWB 3S3SA 2CJSA 1IBBA 4AT6A 3LNHA 3PQYE 4KDWA 1L5GB 3BRFA 1BPVA 3EYUL 4YHMH 3PABA 3NJFA 4RZKA 1YNND 1G9ML 1MQKH 2FO4A 2XVKA 4LLUA 3HC3H 1SOSA 3K0WA 2Z91A 2NUPA 4F5CA 2V2WB 3QUYC 4LNRA 4IJ3B 2FWUA 2J88L 3OLDA 1IBFA 2EUZA 2NY6D 3QDGB 1FFNB 2QSCH 5E2VL 1HOCA 1JHLH 2CIIA 1AXTH 4NQEE 2KZBA 3TBYB 3MV7E 3TF7C 1UJ3C 4DKEH 2PYEB 4Q52A 4BUGA 3MOQA 1PL3A 1QLEB 2AXGA 5GRJH 1T5WB 4LKCA 3WMPA 4KXCA 2CO4A 2DQHL 2HMID 2ZXDA 4JMNA 4H2AA 4G8EB 1QDNA 5TGBA 5AG9A 4LAJH 1UFGA 4L1LA 5DR5H 1IVTA 4GAFB 1MHCB 2XX0A 4UAHA 4OZGB 5TQ2H 4OM0L 5FCUL 3QUHA 2ZWNA 1CD9B 3RA7L 5ID0B 2ZXWB 1WAAE 1OGTA 2CO7B 1T2QL 5AEAA 1XF1A 2CNYA 4YZFF 1DBML 1WHOA 1NOAA 2PF6A 5E8DL 1OTSD 1GGBH 2B3IA 4OVVA 4IHOA 5GRUL 4S1SL 5JW5A 3ARYA 3EGSA 5SWZA 4C4BA 2IDFA 5DD1L 5F1KC 3LB6D 4MXVE 1OB1B 4Z7OF 3U0PA 2D9CA 1Y4ZA 2PWGA 2X2JA 2ZYHA 1USZA 2ZXGA 1GPOH 2IJ0C 5HGDA 4UINH 2AAAA 3CPLA 3K6SB 2H1PH 4PRPB 3TO4B 5EF2A 1TOXA 2PNDA 1EFQA 2BSEA 2DWXA 3PFQA 1HOEA 3NMEA 2XN1A 4M6OL 3MBWB 2EDMA 3ZTJG 4RGNC 1P4BL 3LH8A 5DRZB 5A16B 4TOYH 2XKSA 4MZ2A 2P42B 1E27A 2DLFH 5CJXA 5DJ6B 1Q9LA 3RDTC 3VM5A 3EH4B 2TRHA 3CN0A 1JPTH 4UUJB 3FCBA 4HUUA 4OLEA 3OAUL 5CJQH 1HNYA 4WW2F 3QIBC 1C5BL 4U4IA 4WEUD 4EN3C 6PAZA 3IDNB 1FNLA 5D6CA 1OP4A 1R5IB 3AY2A 2DMRA 5KBMA 2H6PA 1LEKA 4Z0XA 3PG2A 4A2MA 4XPGH 5C70A 4PUBH 4HA1A 3OKLA 2OK0H 1F18A 1SDDA 3BN9C 5DGRA 1H9DA 3DIDA 3HFFA 1TG8A 3D8MA 1IKFH 3UZEC 2DKSA 3BH8A 5DFVD 4KHXH 3KPRD 3TIEA 4OCRL 1C7SA 3G9AB 3FFCA 4OD2B 3G6JB 5IB4B 1DL7L 3HI6L 5EO0B 3O2VL 5I71B 4XCEB 4YNYB 1O9WA 4HW6A 2V3FA 1C16B 2YUZA 4F2MB 1R5WB 1Q9WA 2AMGA 4YZWA 4M93C 2TSBA 3TH3T 4X4YA 4UI2A 4JDVB 1YMMD 4JHZA 4WTXA 5DWUH 3O4OC 3Q8BA 4M6MH 1UH3A 5BXFB 2EZ0C 4A38A 4Y88A 5FW7A 4H5SA 2PWDA 3P0YH 4XTRD 1BGXL 4M61A 3G5YA 5TD4A 2QQKL 2WQUA 3LHAA 1MFMA 2J6EL 2UWEA 1XV8A 2VSKB 2A6ED 5DU7A 1DUZA 5IJDC 2BNRD 4MA7H 1AD9A 1ITBB 1JFQH 4NO2B 5DC9B 4DEPC 3B9KC 1Z0MA 3QPXH 2GFBB 4DP7X 1BFVL 1WD9A 2OMVA 3WO4C 5B38A 3GI8H 1VACB 4NB7A 1E4WL 3WFBL 2OXHA 2RCSH 1YYML 1UOLA 2A4EA 4E9QA 4GAYB 1XGTB 1GTNA 4NUMA 1SJHA 3TT1H 25C8H 3S6CA 5KUKA 4ONOA 3TA3B 1P9MA 5C6TH 3SUMA 4TYUA 1P7QB 1F58L 4OF7A 2VLRA 3HB3B 2NCEA 3QYCA 4BFJA 4E9TA 4AYSA 5EBLB 3V6FA 1JHKL 2JWYA 4Z7NE 4KNUA 12E8H 2CK0L 1F6AB 1CZ8H 3MBEA 4LCWE 4AKPA 4F3FA 2HWZL 1CXKA 2Y7QB 3PJLA 1RFDH 3SJVB 1ZK9A 4PRPE 1NBYA 3RU8L 3GTGA 2P44B 1QAWA 1XGQB 5T3XD 1OD9A 3KBEA 5FGSA 2NW2B 2R8SH 3D2UA 2Y23A 4HHAA 3P9LB 3S96B 3KLLA 1RJZB 1EGJA 2GTWB 2NQCA 3L16A 3NK4A 3B9DA 4U3XA 3K4AA 2AGJL 4R6UA 1ZLUH 3RL1A 1RSFA 4ZNEE 1NANH 2WMPA 5CEZD 4KDIA 1BQUA 2YA1A 1ZPLA 2BX5A 2I7OA 1M1XB 1MXDA 1R75A 5FLUA 4EIBA 1FNGB 4AEIL 1NBZB 3L48A 2R2CA 4PVNA 2R4SH 1IC1A 3DHUA 3E1ZA 5EZIL 3UJJL 4IJTA 2VN3A 3DHJA 3IDXL 4JFOB 3C6LC 3MGTB 1FDIA 2V0AA 5TK2A 5EIIA 3PAUA 4DP2X 2X6UA 1IGMH 3TNMB 5J06A 2VM4A 4OF6A 5GJSH 4BCZA 5DFWH 3L7FB 3D39E 4L8DA 3RWCA 2E46A 1NDGB 2G5DA 2F08A 1NANI 4PB0H 3SDXB 3MR9A 3I9GL 1IGCH 3O8XB 4L3EA 4MWFA 2GIYA 3OR6A 2D4FA 3MOAH 5E5MB 4Q9CA 5FYJU 4YLBA 5MENB 1YEFH 4NUPA 4JZNA 4TNGA 3J8F7 5HHOE 4TUKH 2QADC 5GGVL 2G9HB 3VD1A 5SWSA 5ENWB 3QQDB 2CK2A 4HPOL 2Q86A 5LLIC 4QAMB 3HEIB 3LKQA 4JZOA 4CU8A 1H6UA 5K9OB 4PRHA 3ARUA 3F83A 1S7XB 4IKLA 1W72L 2KUTA 5D4HA 1GGIL 1YN6A 3GGWA 1AGDA 4W9EC 2WO3B 1G4MA 3FT3B 3O3EA 4LRIC 4NCC2 4XPFL 4DKDC 1OGAB 1ID2A 3MACL 2ADIA 4GMSH 2ID5A 3DVNB 5JDSB 1LO3H 2CR3A 1G7MB 1DVFD 3D6GA 5C0CA 3CVHH 3HVNA 4XMTA 1P7HL 1KTDA 3OGCA 4OFYA 2G4EA 3S8FB 4OUUA 3WE6A 1MCWW 2BS8A 1G7IB 3FTZA 1U8CA 3Q7JA 4KI1A 3G3LA 4TTDD 2OW6A 5F7LB 4UTBH 2VDPL 4I3SL 2XSKA 5GGRB 5DMGC 3AGVA 4ZQKA 3LKSA 1XCWA 4NYLB 1I8MA 3TS8A 2YPVA 3K46A 2G5UA 4XAKE 5FUZL 2DICA 3ZRCC 2D2CC 4N0CD 1NOFA 1S9WA 4N2BA 4GKNB 4O02B 3NRFA 3SN6N 1YAIA 2ZX6A 5DD0L 1FUNA 2AK1H 1J5HA 1GTFA 4YX2H 3QHTC 1LDSA 2VH5L 4FQ2H 4OFQA 1BV8A 3NPSB 5TF1H 4LXFA 2WY3B 4QLRA 5CBEA 4F80A 3G5VB 4KI5C 4Y89A 1DQJA 3QUGA 2JIXB 4JY4B 5KVDH 1VKXB 3ILEA 3T6XA 3LXAA 2UY6B 5FHAL 3AB0C 4HAGA 1XEDA 4PJ5E 3NCYS 3T4YB 2Z31B 2IFGA 1TEFA