2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YOAJ
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
molecule tags Cell adhesion
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
4JS7A 3SUKA 5GLXA 3X2OA 3D30A 2BH0A 3X2HA 2G6GA 3X2LA 3SUJA 3X2PA 3X2KA 4FG2A 1BMWA 3X2NA 4ENGA 4JP7A 2PI8A 4FERA 1OA9A 1N10A 4L48A 5H4UA 4AVRA 3X2JA 4JP6A 4FFTA 2PJJA 4JCWA 1WC2A 3FT1A 1WHPA 1BW4A 3CZBA 5GLYA 4ZM7A 2AE0X 4JJOA 3ENGA 2PICA 3SUMA 4FG4A 3SULA 3X2IA 3X2MA 1BW3A 2ENGA 2HCZX 1L8FA 5GM9A 2VXQA 2GAEA 2KQAA 1WHOA 1HD5A 2G5DA 2JNZA 3FT9A 2PNWA 3X2GA 1OA7A 3M3GA
chains in the Genus database with same CATH superfamily
1U3HA 5C6PB 5DVOA 1ZA6B 4AOKB 4WHCA 3CCHA 1TQCB 1GGBH 2A6IA 2YAHA 3HN5A 5E2JA 5ENWB 5INCB 3ZTDC 1T80A 5IT2H 4AQ1A 5JUEL 1A9BB 3DI3B 4HLZH 4G8IA 1F1GA 1HXMA 2B8OT 3ZZLA 4M7LH 1R3LA 1QNZL 2EH8L 3MRFB 4FCAA 4Y16D 3P4NA 2AQPA 3H54A 4OGYH 5D7EA 3MV9B 3X1EA 3DO7A 5B3JE 5EZLA 3PDGA 1BWWA 5LQBL 1NFDB 1P5UB 5CJXA 4LLYB 3MLSH 4FHBD 3VNYA 1K8DA 3RVVC 4WTQA 1EFXD 5KYYB 2MJWA 1I8KA 1BXXA 2EVIA 4PM1A 2WXPA 3N2JA 3VFSA 1DSYA 2NNXA 5LBVA 3D05A 3DYOA 3NZ8B 2Y72A 1W6WA 4RGNC 3VD4A 4W9FC 1FNSH 4I7ZC 1IQDA 1IZKA 3BKJH 2D3LA 1CD1A 5IVXB 3J07A 2NR6A 4LCUA 1E61A 4BCZA 3D87B 4AKPA 3UTPD 1FFPB 5CCGE 2ZKYA 1MI5B 2XA3A 1ZVNA 4JQXA 3MLTA 1N2RB 1JRHH 4H8QA 5AKVA 3THMH 2GTWA 3SDYH 3B5GA 4Y2NA 2WTRB 3VFMA 5E6IA 3VYPA 4ZMAT 2FD6L 2XA8H 2AC0A 4H2AA 3UMTA 1FVEA 1ZWIB 4DN4H 3CX5K 3LN4B 3LH2H 3P9LA 5AALA 2EE0A 3M8OH 5E9NA 5E8NB 4PI0A 2QQLL 2HFGH 2Y6SC 4LLQA 5FOBB 4IMLA 2X4NA 2P8MA 3T6VA 1A14L 1TKWA 5KYWB 3IMWA 1WWWX 3WKYA 5ICYA 4DGWC 2AQSA 4Y2OA 1H5BC 1A3ZA 4Z3TA 1PZ3A 4DP1X 1TMQA 1H19A 1RAMA 4RAVA 1RUPH 3ABKB 2XWRA 3B2UC 3OX8A 5EBMB 4ENEC 4ZFOA 4OZGF 4UQEA 3EBHA 1M7XA 4HULB 4ZYKB 1UB6A 1Y07A 2J1ZA 3AS3A 3SKOA 2XNAA 2K6YA 1OGAE 2GJ6D 5D7KE 3F58H 2W59A 4H1LG 4OCRH 4PD4J 4XN9A 5KYXB 4K3DL 1FDIA 2KKQA 5A16B 2WAQA 1HL9A 2EO1A 2NNFA 4M5YL 1I9JH 5GS3A 2MNJB 4HXAL 3V0FA 4I1PA 4HUCA 4N3UA 2X1QA 4XP5L 3D39B 5E1HB 4OD1L 4V2CB 1WWAX 5FXCH 3TO4A 5CGYC 1M7IA 4MMYB 3CVIH 4G3YL 4XO8A 5FYLL 3SYPA 1E9OB 5EU4B 3ROOA 5FO8B 1OB1A 2B5IC 4PUBL 4Y19E 2QLVB 4XPAL 1AMYA 4Z77A 4QRFA 2VO5A 1IO4C 1U3JA 1NEZG 5PCYA 5BCAA 1ZV9A 1NSNH 4CMHB 1P4BL 2ZF8A 4W9HC 1FO0H 3WGUB 2VZ3A 2YRLA 3T6XA 1HHJA 2KZBA 4PRNB 4ANVA 2WNWA 5EORL 2HTLC 3FU9A 4O58L 1I1CA 4FXLA 5JZ7D 3HJ0A 3C8KB 4JKWA 1N3NA 2JE8A 2X9YA 3CJJA 3HE6C 4NOFA 1T20B 3D2UA 4OZHE 3KPTA 3RKDC 4OFYD 4RLDA 4ALAH 3MOAL 4NKQB 4TF4A 4M6NL 5D8JL 1NUGA 3HFMH 2JIOA 1D7FA 3L4VA 4YDLB 1OAKH 1CK0H 2AKRA 4AYGA 3GSNA 1Z2KA 5DQJA 3RGVA 1D9KC 3E6FA 2CIIB 4ODXA 5DZLA 1WIPA 1S7WB 5E8PA 5A7BA 5IB5A 2BIHA 1NKOA 2KL6A 3QUYB 3S35X 4GAAA 1UACH 5I0ZA 2ZT9C 3KHQA 3OAUL 5KJ7E 1S4IA 4ZXBA 4LBEA 2OCCB 3MA9H 1FH5H 1RJYA 3MUZ1 4KTEH 4HFWA 2EIZB 5DFAA 5DYIA 3LRHA 2QR0B 4KKLD 4APQB 4KUZH 4AV5A 2NY5C 4WFHE 3ZT7A 3F7QA 3SULA 1RVFL 2HT4C 1IM3B 5HHXH 1IBGL 4JRWA 3WXVL 1JK8B 4FG6D 4KK9D 3FQWB 4NQEA 3U9PH 1BVNT 5DHXB 1YNTF 2VDLB 3VGEA 2ADJB 4P4KC 3DECA 1J18A 1KELH 3ZGHA 3K6OA 4XMVA 2BVQB 2WD0A 4JFHD 3L4ZA 4DP0X 4YR6B 4FHKA 3U7AA 4GBXA 1X7QB 4S11A 5D2LB 1E67A 4AYBA 2BX5A 1K4CB 4OB5L 1J1OH 2FL5A 1KTDB 3ARFC 1XCQA 1SZNA 4Y16B 4I18C 1SJEB 5FUCC 1I8IA 4H8PA 1JGLH 5CBAB 5F0PB 1ZT7A 1T0OA 3W38A 2IDTA 3NJKA 4JM4L 4WY7L 1F4HA 5JW3L 5KZCD 3SUKA 3CMOL 5F7LB 2DWDA 2CGRL 1SXBA 4MNQD 1KJ2H 2Y9RT 3KLSA 4P5TA 1NCUA 2FQGA 2V2XB 2VCOA 3DWTA 2YGPA 4N2MA 5JIDA 4FMFA 4OF7A 1ZE3H 5L7XL 3QCVH 3U4BL 1DVUA 3R06A 3EG9B 4QYOA 3CPUA 1XGTA 3BVVA 4Z76A 1R75A 5E2TH 1MCHA 2PTVA 4CC0A 5HGHA 3C5ZD 4NWTH 2HZHA 2QGDA 4B9JA 5IVOA 4DSYA 3I6GB 3UTSD 1JUFB 4NQTA 1KCVL 4G82A 5F7HA 3V7AG 5K9KB 3BEWB 1MFAL 5AW5B 5DS8A 4F7EB 1SVZA 3EADA 2XXGA 3GJEB 4YDKH 4GI8A 1Z3GH 4CBPA 4CMMB 4FLOA 2Q7YA 4WU5A 3KBPA 3L3GB 3OD3A 4MD4B 2VXTH 1YY8A 5BS0A 3BZ5A 4AYFB 3T0XA 1CLYL 2P5EE 4WI0A 4YPGB 3C8HA 3N44F 2HAZA 1OPGL 1GKEA 3WO3B 2WIIA 1MHHB 3U36A 1VERA 4GKZB 4WUUD 1GW6A 3AS1A 1MWAL 1I3RB 1TWHA 4PG9A 5KSBA 3JXAA 1HOCA 2XWXA 3GPEA 2QQQA 3MNWA 5E9DE 3PWPD 1GIGL 4P06A 3B7RL 3RNKB 2X89A 2D2OA 4GW4B 3TBTB 2ARWA 4LMQI 3V5KB 1PZ5A 4POZC 4P9HH 3CHPA 5LN8A 5B3NA 5GISH 2OTWB 3QJZA 4WJ5B 3NJVA 5EUOF 5F1NA 4OJFH 2MMXA 1RZQA 3SPHA 2EEDA 3BWZA 2A6DB 5ICZA 3PL6A 3CZSA 5KVEH 4ZW8A 2G5BA 1UOKA 1SMOA 1XDTT 2O6EA 2Y7MA 4N0UE 5JR1H 1D5RA 2IG2H 4YL9A 5F96L 3KPRD 4LLVA 4Z7WE 2BS8A 3ZTNL 3PV6B 3NH7L 3C9NA 2H32A 2QADC 4ZW3A 1AXTH 4NUQA 5G4OA 4J6RL 4NQDE 5BO1L 4OKVA 3BFQG 3GS0A 4H0GA 3QJXA 4PS7A 2PYED 3U6XA 4RGOH 1UZ8B 1NCCL 1BYOA 3VM7A 5GXBB 5BQDA 2KI8A 5IB4A 4AVJA 2FIRT 1B6DA 2N0KA 1OAJA 4HKZA 4EDXB 1JWSA 1S7XB 3RUGA 3S96B 1E32A 1KN2L 2J12B 3QGVA 3VFOA 3OHMB 5C8JB 5IUCA 1D6VH 2FATL 4G43A 2GBVA 2BZCA 4BFEA 1PD6A 5IROA 3JWOL 5DC9B 5AYTA 2DQUL 3TV3L 2FHCA 1D5XB 3QDME 1FJ1B 3LDBC 5F7MC 5JDSA 1LD9B 2WXGA 3HRPA 1ZV5A 5DEGB 2VAAA 3GXUB 3SE6A 3RDTC 5FECB 3CFJA 3CFNA 3TESA 2Q2LA 3ENGA 4BK5C 3VXRE 3QPXH 1Q0YL 4KVPA 3T0EC 1SVCP 2AABL 4OJYA 3B9KA 3NP4A 3NIGB 4WCYH 5AWNH 1JNNH 1B4JH 4GO9A 2G9KA 4Q4EA 3FHAA 4M93B 5I1CL 3ZZ1A 3W0WD 3WKML 1ONQB 3RWEB 3CQPA 5DS2A 4JFEE 3KPSD 1WV7T 1CZ8L 5JW5B 4B97A 4JM2F 1AGEA 3RTQB 1I4FB 1I1FA 4X5XA 4KXZI 4TNVK 1R5WB 4OI8A 3MRPA 4GG8B 4TSBL 2BNQE 4K07A 1G9NH 2YD5A 4H8WH 2DYPA 3H1ZA 5IHZB 1M6OB 2VN6A 1E8XA 5JNYB 3GTNA 5ANMA 3STLB 3ABLB 4JM2C 3UTOA 3P30L 4Q2ZB 2QZQA 1E4WL 3SKNA 4HMEA 3TH4T 5CLTA 5HHNB 1F97A 3NA9L 3BZFB 4E5XA 4XVUD 3S3CB 1XSOA 3UG3A 3VTTA 1CFNA 4ZW5A 5IHBA 4DGYH 1TWGA 1DFBH 1EJFA 2YAFA 1E4XI 2Z4TA 4M8QB 4MNQB 3ZE0F 5HGAB 4Z7NB 3O45B 1HU8A 5F7WC 4RH4A 4K94H 2ZKHH 4JB9H 4QCIA 3PWVA 3RKPA 1XMWA 1BW8A 4W81A 1UZGA 3MJWA 5L2JB 5CAYB 4P5KA 5CP3H 1ASOA 2HJKA 1J5IA 1SQMA 3EJPA 3F62A 3ZO9A 2FZ3A 4JHZA 4KKZA 1HKFA 3C5ZB 4HWNA 1U8IB 5D4QA 4HUXA 1H5BA 1NCAH 3UTSB 1FNLA 2VLME 3Q2NA 3KLHC 2BOLA 3OKMB 3V4VA 4CN4A 2DQHH 2NY1D 2R4SH 2DBJA 2F74A 4I3RH 3VD7A 1BP3B 1PQZB 3GSXA 5INDB 3FFCE 2A1WH 2JQZA 5EU6D 1URLA 3UAJC 2EXWD 1ITCA 3FUMA 3NIDF 3VX1A 4DN3L 1FE8L 3KYNA 4LT7A 5SWSA 2OR9L 3SQRA 3ZR5A 3QYNA 2IPKA 4PJAB 1L5GB 5AYUL 2X0WA 1C12A 2JSFA 3ISWA 2AE0X 5HD8C 5EOTA 2KPWA 3EFDL 4Y5YC 1NBYA 3LYRA 3ULSB 1AGFB 5IBUB 4ONGH 4JFFE 2WOBA 4QHMB 1M4KA 3AY2A 2ATKA 4Y9FA 4L8CB 5LAPA 3TYGH 1OV8A 3PWPB 5FKPA 1S7QB 4HHWA 2V37A 4J28A 1SY6A 4PGBA 4YHZH 3O2DH 2BSRB 4KO9A 3VXOB 1MFBH 2X40A 3V55A 3O2WL 1A3QA 5IW6B 2Y07H 3B3IA 2ZCLH 3VFPA 1Z5YD 4QHKJ 2CJSA 4GP5B 2JK5B 1UA7A 2CZNA 2YPLD 5C0BE 1SOKA 4PJXE 3FO2A 2DTMH 2VB5A 1S9XA 4KKBD 2AEQH 4MLIA 4AXWB 4KFMA 4BKLA 4L9LA 4BWUA 4Z7OF 1DLHA 4JR9H 3KPRB 4Y7OC 2W88A 3NTCL 4PV9B 3DHPA 3UZQA 1S9WA 4IOIB 4PRDB 3DMMC 3S5LB 3OKOA 3ULUF 4M56A 4RMUA 4M1CC 1QVOA 2APVA 3GXTA 3DLQR 1JV5A 1MUJA 2PYEB 4ZODA 3WTTA 1FSKC 2PP7A 5DUBA 5EO9A 1FG2A 4C56E 3R7RA 2VDLH 1OK8A 1PG7X 4OCWH 3AITA 5J56B 3R0NA 1E9QB 3AT0A 4RISL 2DD8H 3Q1SL 4PREB 4AK2A 5FPIA 2EDOA 1SYSA 3KXFA 12E8H 1A9EA 1ANUA 4HQQH 1WBXA 3BMVA 1U6AH 1KJVB 1W72A 3GMQB 3MV01 2R1XA 3GJFH 3ILDA 4AVRA 4OLXH 5EDSA 3K0WA 2WP3T 2XVBA 3QZLA 3F04A 1SXAA 1H0HA 4YZWA 4X6EA 1H8NA 5ES4B 3RWFB 1A64A 2NYKA 2ZPKH 3ECBB 4K5MA 4PWKA 3BH9A 5AVQB 2X4SA 2N7SA 1ODUA 5C0EB 3CXDL 3SYOA 1HNYA 1OA7A 3FJTA 4I18A 1YN6A 2XWTA 3Q8BA 4YWGH 4BH7A 2OR8A 4R5XA 3BGFC 3KPSB 2H8PB 4LP5A 4LSVL 4JDZA 2EYRA 1CXIA 3RLSA 5MI0B 2A6HD 5PAZA 4A7GF 4AMXA 3UTTD 2GSGB 3NFSH 4G9FE 4S1SL 1DVFD 2K78A 3FCUB 4M7KH 1C1EL 4HA1A 4JFPA 1HAWA 4WW2F 3FB5A 1OAXH 2WUCH 5I71C 2WXQA 1YMME 4R5TA 2UXGA 1XXFC 4KKQA 1WZMA 4YHPB 5EUOB 4YHYC 1SN5A 4DP5X 2VDKL 2X28A 4UU9A 3U9UA 5A43C 2EDFA 4K71B 2FEDD 5C0FA 2XZAL 2X7LA 1KYAA 4X9GA 3PNWB 5E23A 4NHUA 4FQ1H 4TN9A 2RMNA 3IJSA 1BOYA 3UO8B 5C07E 2MNWA 2VERA 3HTLX 3IKKA 4Y4KD 3FHQA 3OR7B 4L1DA 3ULUD 1IAKB 3PQYD 5MENE 4Y5XB 2R0WL 5AOMA 3SKJH 1BZDA 2R69A 3RJOA 2JJSA 4LOUD 2WO3B 1EPFA 5H37G 4XCEA 3IN2A 5JQIB 1HXYA 1KYFA 1MPAH 5CZVL 2ZAGA 3LZNA 3O11B 4S1QL 3NABH 4MB3A 2ZX5A 2AZAA 5E2UH 4G7VH 3FMGH 5A6MA 1KTCA 1QBBA 3DI2B 2BSDA 4OCXL 1CTMA 2F54D 3K2MC 5CBEB 4ZOBA 1X7TA 2EH7L 3VFWB 1PZ2A 3W2DL 4HU8A 3GC3A 3TVMB 3OJVC 1JZ6A 2EILB 5EN2A 4JY4A 4TSAH 3EGSB 4NC1E 5FA4A 1LEGB 4DP8X 1DBAL 4NIKB 5DC4B 1PSKL 1L9TA 1I1AC 2X2IA 4S0SD 3FO1B 4X6FB 1R3JB 1LXMA 2J57A 1HT6A 1R3HB 3OR6A 3DVIA 4H26B 5FTMA 1EEYB 5CHNA 2R0ZH 2ZIDA 1IC5H 1QLFB 4GA5A 4X8CA 4OSUH 1L7IL 1YG9A 2EVFA 4AG4H 2ZXCA 4JJOA 2FEJA 3OZ9L 1ZEAH 4W1TA 3ECUA 3AQZA 3FU8A 1WZLA 2R2HB 1TNMA 2R1YA 4PTUA 4HS8L 4NKDA 3KHOA 3O3UN 2YWYA 3TM6A 3NEOA 3CH1B 3GMNB 4NIYE 4RESB 1EX0A 4WHYH 3SDCC 3M17A 2XVKA 3DNKA 3V6OE 1IL1A 3FU5A 3QQ9D 3IDNA 4JE0A 5EUKB 2XN2A 3Q7JA 1QW9A 2IIJA 3X2JA 5LAXA 1WS7A 4ZMWA 4GRMB 5EWIH 1OGAA 5HHQA 2GFBA 5TDOA 5ESAB 3MUUA 1LEIA 3G5VA 4X4YA 5H4YA 4L8BB 3Q6FB 3RDTA 2XUWA 5DJ0A 1LE9A 1CBVH 1J5OL 1QACA 3NQKA 2H2SC 2JCWA 5T1KA 2X9ZA 1BQHA 5EZIH 3VTAA 4Z5RA 4AIOA 1VFUA 3SCMC 3QHZL 4GIOA 4F3FA 2DQTH 3HR5A 2IBZY 2ZUVA 4KXDA 1U8OA 3T8XB 1M2VA 4U1GB 1AZVA 4FFWD 4PW9A 3GTGA 4Y19A 2BFVL 3VJ6B 1QBLL 2YD3A 3QDGD 1ZTXH 3HAEG 4BK4A 1HNGA 1OAYL 5F3BB 3CZBA 3KYMA 5IEKB 2AAVA 4XX1E 2IALA 1TSRA 4NO3A 1QI3A 4F33B 5T3XD 3TA3C 5JW3H 3FU3A 5GS1B 2R29L 2AZUA 4IKJA 4KKNA 4XN7A 5EMYA 4YXHL 3T0WA 5LGHL 2G2RA 2WMPB 4QGYA 2A4CA 3NCYP 4O5LH 4X6DE 4OZHA 3NSYA 1WT5C 1EAPA 3SKMB 1IFHL 2QVMA 3FUDA 3N04A 3V4PB 4DPAX 3C5XA 4UBDC 5DJ8B 5AVXB 1AHKA 1NAMH 1OHQA 3MO1B 4R4FL 5DZJA 5C0AD 4P3DB 4LCWE 5IB3A 1FNFA 4I77L 4PRIE 5J06A 1DEEA 3BKCH 3UTTB 2Z3FA 3KPMA 4JPIA 1CXEA 1KXHA 4XMPH 1ZGLP 1DVFB 3IFNL 4KTDL 4PLKC 3D9AL 4E41E 1MNNA 5EU5A 3FT2A 5E8EB 1ZMYA 1LO5B 3OXSB 3EYVB 1T4KB 2WLYA 5GZND 4EN3A 4FQ2H 5IMLA 3VGAC 1F41A 4GRWH 4N2LA 4H5SB 3BDYH 1IGMH 1NWPA 2WZ5A 2OULB 2KLSA 4GLRI 4NKMA 3ZHKA 4DZ8B 1PKQE 2XQBL 3K3QA 4KZEL 4MA7H 4Y4KB 4FAAB 1JHKL 4P9MH 3WNJA 1KN4H 3PQYB 1JWUA 3GFUA 1L9PA 5DK3A 1CUOA 4UUJA 3HKZA 4HHAB 5BRPA 3EHBD 1EMTH 5D1QC 1IFGA 1RMFH 3MJ6A 4GSUA 2OYMA 3IWUA 5K5YA 2QFPA 3QJHB 5D2NE 2R4RL 3U1QA 4ELME 3RBGA 4EMZA 4OV5B 2QSTA 2FHFA 2CJ3A 1DQKA 3WEAA 3CC1A 3ZE1F 3L3IA 3FOLA 3PWNB 4J3WA 5FYKD 4D9LH 1KWGA 3CXFA 5C18A 1KB5L 5ACZB 3HRZB 4C83B 1UTDA 3ZIMA 4MQSB 5HHVL 3UYPB 1VDGA 2XG5A 5FHAL 4HPOL 1EAJA 4UTBL 5BVPH 1PKOA 5KBPA 1RU9H 3BSZL 4E9VA 1WICA 1KGYE 1VACA 3HG1B 4J7RA 1IEAB 4OJAA 4D8PA 4HV8A 4N0CD 1CYXA 1TJGH 1ZDSA 4ZS6D 4C59B 1XH3B 3KPPB 8FABB 1I1YA 1KLUA 1NLDH 2E9JA 1JHTA 4Y1AE 2BRRL 2QGCA 4PJ7B 4XE0A 3T0VA 3EO0B 1BMGA 2GVYA 3IDIA 3A4DA 1T21A 4ZZFA 2FR4B 4Q0XL 5ISZE 3GK8L 1OGYA 1NGPH 3FCSA 2L3BA 4ZFFA 3JYCA 2IJ0C 1WHPA 1IAIL 2KBGA 4OLVL 4Q9QL 1TZHB 4G7SB 4I48B 1A5FL 3TV8A 1WA0X 3JTTA 5FO7A 1N0LA 4UQDA 2P5EA 5E6RB 2FATH 4F20A 4PJHE 4U31A 1JPFA 3WGVB 5I16B 3LEYL 5L2KE 3HI1A 3HS9A 3PGDA 1ID2A 4Z7VF 4N22A 1NDMA 1OSEA 3SD5A 5HDBF 3FSOA 4FYRA 3EOAB 5EV7A 5E9DA 4PV8A 1NC4A 3OAZK 2HPOA 4OCYH 5JPNC 1SQ2N 1QOKA 2BWIA 4MA3A 3KH4A 5I8OH 1FFOA 4P2CG 2AABH 3GTVA 3AREC 2ZOLB 1ZHLB 1Z5HA 1WEJL 4PH8A 4U1MA 3V0VA 5GLFA 1CZ8H 2XIDA 3LPGA 3ZKMD 1S8DB 3A6OA 4ZFQA 3K6SA 1ZJBA 4NZ8A 5KBLA 4ODVH 4WJG3 1A1OA 1KUMA 5JHAA 4N0UA 4OCSH 3ZE2E 2WVVB 3HS0B 2FX8H 4LPUA 4WTZA 4AEIL 1D7CA 1LMKA 2J73A 5B1CA 4BINA 4Z7WA 5AOIA 5CJBA 3U30B 5IV2A 4L3CA 3QDGB 1F3RB 1C16B 1IC4H 4FQJH 4N85A 2HLAB 4TSCH 4NQDA 1YDPA 1UXSB 1MFNA 2FB4L 5GS2D 1OTSD 4X6CF 4CVZB 4EN2A 3K8LA 2C3VB 3SDDC 4JFDB 1M05B 1XB6A 1ML0A 2HX7A 1A7QL 2NCMA 4JAMA 4QF1A 4EXKA 5F72S 3BAIA 2WSPA 2L4OA 2Q8BL 1O7DE 5FTKA 3I3BA 5MHSD 2DQIH 4J8RA 4YGVB 3V6OC 3L1EA 2XVGA 5I9QB 1L6ZA 1AIZA 1C8QA 3EGXA 3GSOA 2NPLX 2OMUB 5C0AB 3U83A 3MLRH 2VZOA 1QA9A 3ABMB 3P4MB 4H20H 1P7HL 4HUUB 3KJ4B 4YX2L 1MFCL 1LO2H 4C57C 3BCFA 5C0DB 1CCZA 2EDYA 4GINA 1DBBL 3QDMA 4ODUA 5LG1A 1FL5A 4X5WA 3O4LD 3D0VB 1ES0B 3ZDXF 3BKYH 2KDYA 3KD4A 1MSPA 4G9DA 3Q5OA 4NT6A 3FB6A 2J6EA 4OLEA 5JW4R 3P4OA 3BPOC 3OJMB 5FTJA 2CKBA 2X2JA 4KO7A 1LILA 2BFGA 3JV4A 3L6FB 3RX5A 3ARYA 3LHPH 3AFLA 4V33A 2BS9A 4GAJH 4DAGL 5BO0D 3ELQA 4E9WA 1U36A 4JFEA 1A6ZA 5IUSA 1UJTA 2YAEA 3LZQA 2WCSA 1QHQA 2FH8A 3IDYB 4I89A 4M9OA 1JPST 4HIHA 2AXHA 4U6XB 4YHKH 5BV7B 3QNZA 1UXWA 2BNQA 2FO8A 1G1OA 2BDNH 3FH7A 3KNBB 1KB9J 3LXAA 3LZFH 3M7OA 5E4AA 4WNSA 3VGDA 4FABH 4PJ5E 3H3PL 1J8KA 2VXSL 5GIRA 2V4LA 4L8DA 3EJTA 4ERSH 7FABL 1O6SB 2WAHA 3BIAX 4LF3A 1I1AA 3TNMB 4NQVB 5HP5A 3TZVB 1EIBA 3O2WH 5F8QC 5EF0A 5IQ7H 3G6AA 1BX2B 1ESOA 2F19L 1U8CB 1AZCA 1A6VL 2DQ6A 1UC6A 3FUKA 1PCXA 2Q20A 2FUTA 2CDGA 1UWGL 4K3EL 3KBEA 4YGAB 5D1XE 3S3SA 2Z8WC 4DKDC 4FI8A 5HYJD 2AGJH 4W68A 4HIEB 3FBKA 2Z91A 5D6CB 1UWXK 1YUHB 1EU1A 2Q76B 4A2HA 3VXTA 2WJ7A 3L7FA 5IFAL 4JJHA 5CZXD 3ZKSD 3N9GH 2BJML 3TIDB 3FO9B 4JFXB 1YPZE 2NLJB 2PW1A 3APFA 3CFEB 4TYUA 4X4ME 4Z7AA 1H6UA 3GMLB 1ZLVH 5J5EA 3EGDB 2R9HC 3WIIH 5BVJA 5C0NC 5D7JC 5DYOA 1EEZB 4FFZH 1QPPA 1ETA1 2A4EA 3PXHA 2DDQH 1U3HD 4HWBA 3L5HA 2DB8A 1UM4H 1MCDA 4MSWA 5ID0A 3KYAA 5TJWK 4NO2A 4P46C 1LYQA 1OB0A 5DWUL 4KJPC 2N4IA 1YJDC 5F88B 5I30H 2Z93B 4UQ2B 3FFCA 4AENA 4PRAB 4AEHL 1DJHA 1NOLA 1NOAA 1HWWA 4DFHA 4GPVA 4CVWA 5E8OA 2BOBA 1H3GA 2APBA 2Y1VA 4NENA 1YEHL 5GS0L 3IGLA 5IQNA 3IMTA 3PS6A 4LAQL 5F9WC 2DKMA 2GAZB 1IGFL 1IGTA 3BUYB 4RX4A 4IBWA 4JFFA 4X0KB 5D2NC 5EG6C 3EYSL 1ZT4B 1CURA 1AIFA 1LHZA 1IFRA 4HUKB 3SCMA 2I07A 5DD3L 1DVYA 1KTJA 1X4YA 1OLLA 5TF1H 3OKDA 3U79A 1MRFL 2UVEA 4JO1H 5K9OA 4TTDC 5DO8A 2WNXA 1NEUA 3JT2A 4E36A 2OMBA 4U3CA 4IEFB 1T2QL 2NR6D 2RD0A 3LVTA 2YFOA 1DSWA 3CLWA 4BJLA 2Y5TB 2B1AL 1ACCA 2GITB 3CFKA 4F8TA 1KCBA 1TENA 2ILLA 3WIAA 5C0BA 3E6HB 2XZCH 1BGXH 4PJXA 5E94B 1F11B 5HI5C 4NZRL 5G4NA 5I0VA 2IGLA 3WFDH 1WT5A 3B8SA 1PZSA 3RPIB 4UT9A 3QHFH 4GEJA 3RAJL 4N8CL 4N2GA 1MVYA 2NY4D 3QNXA 5DUPH 2K9UA 1A4CA 3MX0B 3FUJA 3SE3C 5J0BA 1BSIA 3I84A 5AW8B 2R15A 3O8XA 3QXAA 4AVHA 4PR5A 1EO7A 4N2IA 3L5JA 5ECJE 4XMZA 1J9CT 1NMCC 3IB4A 2YK1H 1HIML 4Y2DA 2EKSB 1OF2B 3ZDYB 4GUPA 3KR3L 1KLFA 2HKHH 4C56A 4K8RH 4B5EA 5KN5A 3QJVB 2ZWNA 5DK2A 3AUWB 5JO5B 2A4ZA 1CFQB 3E1F1 2CXKA 1MAML 4HS6B 3LIZA 4I5BA 5ABAA 3UGXA 3ULVE 5FM4A 5TGBB 2FSDA 2R0WH 1DE4B 1LO3H 1G7IA 1UHVA 3Q6GL 3G08A 2VUKA 5GRZA 5KS9F 1M1XB 1P7KB 1JGDA 3ULAB 3C6LB 5J1AB 1S7UA 3FCGA 5E8DL 4P2RE 3BUQA 3I9AA 4LRNH 2YD0A 1CDYA 4DVRL 5JOFB 3H9SD 4RIRA 3TO4D 2WWMD 3X13B 1NDGA 1TTRA 3P11L 1UUNA 3HMXA 4OCXH 4QYAA 4ZTOL 2CM5A 3H55A 4RWYH 1NIAA 1PNDA 1WP6A 2XBZA 4YHOL 2E7LC 4JRXB 4ODBD 2XTSA 3UJJL 5DF0A 3RVTC 2OFQA 2FLRT 1RZJL 1UZ6F 4G5ZH 4M8UA 3V4UH 3TBCA 5JIIA 3T6QC 2AQTA 2NUTB 1SDDA 5BRZE 3OGCB 2DIEA 3CIQA 4LRIC 2X4PA 3H9YA 1BBJB 2JVUA 2OYKA 1HKLL 2VUYA 2ZJSL 4G9FA 2IANB 2J1XA 1EANA 5CEYB 3BAXA 3FBQA 2BNRE 1INDH 3BUBA 4NWUH 4YDVB 3SE8L 3T6ZA 5E5MB 1U8KA 1YMMA 1O7DC 2IWEA 3ML1A 4LVHB 1NGXB 1WFNA 2Y1AA 4PJBB 3RGVD 4I0PC 4HF5L 3ZW3A 3WIFA 1MFUA 2K3TA 2BP0A 4MJ6B 2N56A 4YNYB 4Q9BA 4D0DA 4KDTA 5JA9A 1D5ZB 5E6YA 4U6YA 1TIUA 2X4UB 5HYJB 3RFRA 3NOIA 4QOKB 1I7UB 1QHOA 1WUZA 3HNTL 3NACH 5FHBH 5C07A 3VH8G 3W1ZA 2M26A 2QPUA 3BWAA 4M3HA 4OZFB 3MKKA 2HPTA 4C55A 3C5SA 1UB5A 1CGTA 2V9QA 1ZANL 3AM8C 2UXVA 1T1XB 2ZUXA 3SHSA 1U8QB 5MENA 3VYOA 1B0IA 1A8ZA 2B59A 2H1PH 4MXWL 3EKCA 4PSPA 1U3HB 2CIKB 2CO7A 2FQDA 4HGKC 4ORZC 4GSDL 1MCLA 5LGJA 3CCHB 4TQEL 1NKRA 2A6IB 3VFRA 5JXEA 1NM4A 4AQ1B 4KY1H 3MFGB 3VQ2C 4G8IB 2LE9A 1BXVA 4HS3A 1HXMB 3WNMA 4FFYA 3CBJB 4B41A 1R3LB 1TVHA 4WF7A 2F9BT 2QT6A 3AREA 1CE1L 3HG4A 3P4NB 3DO7B 4XO5A 5EZLB 1KF9B 3J7HA 3T65A 1BM3L 4IM8A 3FN3A 1MKFA 3OG6B 1RUQH 2HVBA 1TNNA 1DUYA 1K8DB 2AP2A 2FT8A 2Q86A 4I13B 4KKRA 1I8KB 3GM0A 4PJDE 2NX5E 1NBZA 4JG1H 2HX8A 3VFSB 5D1XC 5EF1A 3ZBMA 2ZQKA 1FFNA 4U1NA 3ZPDA 4DO5A 1IQDB 2R0KH 1CD1B 1X9LA 2A77L 2FX9L 4KV5F 2D03L 4MA8L 4R9HA 3X2KA 1HJBC 3GI8L 5DD5H 4J4PA 4LCUB 4ZX3A 1OE2A 4FQXC 4MJJA 1BQKA 1Q4NX 1WJ3A 2WKOF 2UY6A 3MLTB 4GEIA 1AAJA 1PX4A 2GTWB 4KK8D 3QUZC 4I77H 5E6IB 3VFMB 3NDZE 4MAZA 5JPMC 5DLML 4NERA 1FVEB 3U4AA 4Q89A 3V6OA 4F2ME 3P9LB 4LSUL 4N2BA 4EZJA 3MXVH 4XNDA 5AVTB 1G7MA 2GBUA 3EDFA 2GAEA 4NO0A 1PLBA 4I9WD 3N55A 2NY4B 3WFBL 4JQIA 4LLQB 4MS8C 4IMLB 2X4NB 2P8MB 2VMDA 3ARWA 4JFVA 1X4ZA 4MJ5A 4N5UA 1TKWB 4BWWA 3BPCA 3KGUA 5F9DC 4PYGA 5ICYB 2O5ZL 4Y2OB 4P57A 3K46A 2XV2A 3DX7A 3KLQA 3F6LA 4RAVB 3KE0A 2B2XH 4YHML 2OK0L 3OX8B 4ZFOB 4KHTH 4BZ1L 1KTRL 1ACYL 3O9WD 2X89D 4A68A 3NSXA 4F2EA 1UB6B 1FNEB 2NY6C 2LV4A 3QSKB 3SKOB 2YEZA 5BV7H 2XNAB 4TNWK 3CZGA 2BHFA 4L3EE 3SDAC 2BPBA 1A6AA 1KIPA 2ZCHL 1S5IL 4OBSA 1OANA 2GK2A 4N0RA 5CD5D 1BJ1J 3FN0L 4UM9A 2J25A 1T89A 4DOHB 4HAGA 3WE1A 1CIDA 1U9KA 3C75A 4DJMA 3W82A 2YZ8A 2K9FB 3QP3A 4BWTA 3CLFL 1NCWL 5CO1A 1UUSA 2VLKB 3TO4B 2ORBH 5J8OA 4G8FA 4LCVA 1N19A 1M7IB 2B4CH 2PO6A 3BQUD 4YSTA 3B2VH 3ROOB 1OB1B 1WYJA 4A6YH 4WNQA 4X6DA 4Z77B 1CWVA 3MJ9A 3IAPA 2AJSL 3NA4A 5HTSA 2WINA 1HHKB 1KQFA 3MREA 4FYTA 3NPSB 5KEZA 4LCWA 2Z6FA 3VD1A 1IQWH 3ECQA 1HHJB 1QKZH 1F3DJ 5ERWA 1AQHA 4PRIA 5CINL 3V5DA 1T5XA 2ZCKL 1ECYA 4K9EC 2BRRH 1N3NB 5GGTL 1HL4A 4PGEA 2HH0H 3D2UB 3TT3L 4E41A 1CTNA 2HRPH 4HVBA 4U1KA 2WLLA 1OCWL 3N5AA 5IR1A 2FX7H 2Y7QA 2AKRB 1IAIH 2ROYA 3JYBA 3GSNB 3L2LA 4G8GD 4HT1L 4DEPC 5IROD 5DQJB 3RGVB 2CR3A 3E6FB 3ME0A 3NSCA 4ODXB 5D7JA 3VB9A 4FTVE 4X5QA 3KYKH 1T4WA 3EF7A 2DBLH 2HX9A 5EOCJ 5FLUA 5E8PB 3K5SA 1VSCA 3QK0A 5IB5B 2NCEA 4GRLD 1NDTA 4JFOA 3QZMA 4ODHL 4P46A 3CZEA 4QHNA 4ZXBB 4LBEB 1RJYB 5IOPA 4DH2A 1PKQA 5J9PA 4P3WA 3WXWH 4HFWB 3KJ6H 4AQ8C 4OQTH 4DGIL 1YY9D 2DIBA 1DQDH 4RGMC 4UMSA 4KRPC 5F1KC 3LD8C 3EOBA 1JL8A 3B9KD 2NT1A 2J1WA 3EBIA 1M7UA 3NP3A 1M71A 4HUMB 3OMNB 4PJCF 4NQEB 5IP4A 3F8UB 1DLFH 4DWHA 5D1ZI 5GRJH 3TONA 1UOWA 2CLZA 5D2NA 2F53D 4ELMA 4GBXB 2KQAA 3CVHL 3DX9A 5GJTL 1JFHA 4OLYH 1LMIA 3U0TA 3ELAT 3WY1A 2DYPD 3Q48A 4R3SA 2FL5B 4FEIA 2R0LL 3QUXC 1NFIA 3U0PA 3QO0A 1XCQB 3CTTA 5CMAA 3CX5J 3PUCA 5LLIC 2C4XA 5GSVA 4DUXA 3HC4H 1T83C 1I8IB 1LK3L 1ZT7B 3FQUA 4FC3E 3F7LA 4QRAA 3FULA 3DYPA 4XTRC 5KVEE 3MCG1 3MBXL 1OAUL 2DWDB 5I1HH 2QKIA 3OKKA 5AW0B 4GAGL 4Y1AA 4P5TB 3ZQWA 1B4RA 1IE4A 3TC9A 3W37A 5ISZA 1A7QH 2ITCA 5DC0A 1J10A 2XICA 5I8KL 1T66C 3SE3A 3AG3B 3M88A 3R06B 4QYOB 1XGTB 4Z76B 5BQ7A 2NT0A 3ESNA 3WN5C 5HGHB 1CLZH 4ONOA 4UIMA 5TF0A 2C3GA 2HYMA 4JG0H 4PJHA 2R8SH 3QCUH 3QUMH 5F89A 3NVQA 3B2UD 4ENED 1DZBA 5DS8B 3HNVH 3ARVA 5B38G 1TMOA 2Q7YB 2XV0A 4WU5B 5HDOA 1VEMA 4ZNEE 1NCDH 1YY8B 1K6QH 4E9RA 5BS0B 1F2XK 2OA9A 2YC1A 2J1YA 3TFKD 5I8EA 1Q9LA 4PJIE 1HS6A 1IB5A 4WI0B 4PIRF 3MRBA 5AOKA 2O5XH 4S1DC 7TAAA 3U0WL 2PMZA 4XC1L 5L6YH 2WIIB 1JF6A 4WO0A 3ESVF 3U36B 3F5WA 4AYEC 2BVPA 4R0LC 4ZX6A 1CYWA 2Y2YA 3KCWA 2D7TH 4PG9B 4ETQB 5KSBB 1GCFA 1HOCB 4F8LA 1L0XA 1U93A 2FEEI 3KAAA 4N8PA 3MNWB 2DWSA 4EUPA 1KT2A 5F71A 1NFDE 5CGYD 3VW3L 2CO6A 3NJGA 3I50H 3U2JA 3FQ2A 1HXKA 1PZ5B 1YEIH 3QR2A 3S34H 4QNPF 4M8RA 2VDQB 4NN7C 3RFZC 3MBEA 4X80H 1BQLH 4UZUA 2J44A 3N85L 5GGRY 1Z9PA 2ZSVA 1D5IL 5F1NB 5I66A 4OT1L 4PB9L 2IBGA 4FYQA 4KKCC 4FEMA 5F6IC 2O5NA 2FIKB 3FTYA 4FNQA 4LRIA 5ICZB 3PL6B 1OGTA 1WCBA 2G5BB 2WANA 4TVPH 4CU6A 1WZ1L 4WK2B 1NA8A 5FM5M 3RKDD 3DVFA 5KVDL 1BHGA 4BA8A 3B43A 3WSQH 3WKNA 2PR9A 1JFQL 1DBML 1TQSA 4LLVB 5HDQH 1ILSA 1BW3A 1SXNA 3PWLA 4RMSA 4EI0A 4ALAC 3C9NB 2H32B 4MAYC 2I5YH 4UOW1 1O5PA 3MJ8A 2HLFC 4OKVB 2HMID 1T1YA 4MMXA 2MOVA 1TUPA 1S9YA 2CLRA 3PP4L 4FXGA 3HMWH 4WK4B 5CCKH 2CO2A 4RA3A 3FQXA 3O4OB 4NKIH 5IB4B 5B3JF 2DQDH 1U30A 3PU7A 4F5CE 3WTVA 1DMSA 1Q0EA 5AG8A 1JWSB 3RUGB 1PG7L 3AM8A 5K69A 1LWJA 3VFOB 4FQIH 5DWUH 4PBVC 3KXFD 4YE0A 4G43B 3L7EA 2CJUL 1OE1A 1OPOA 1RZ8A 4XPGL 1TYJA 3LPPA 4JFTA 4B53A 1BFVH 4KAQH 3V6ZA 2VTFA 5CN3A 1HH9A 5T5MD 3AMLA 4OFPA 2RH0A 1JRHI 3UG4A 3X2QB 4AQAA 5JDSB 1DN0A 5TK2A 1I7RA 2VAAB 3CFJB 3S0PA 3APCA 2Y22A 4GT7A 4G59C 2OTUA 1RP8A 3B9KB 3VG9C 4CC4C 5JHBA 4PJ5A 4XVSH 4UYPA 3ZTJG 3SUMA 2JA7A 3I9GL 3T0BA 2DQEL 4KDIA 1GYVA 3ALXA 1AGEB 4U6VH 4WWPA 2QL1A 1I1FB 4NP9A 3UJTH 3M7FB 4X5XB 1E5CA 2E4FA 3OVUB 2JKIS 1S46A 2PKDA 2G4EA 2DYPB 2NNCA 3MKGA 5D1XA 1E5AA 2TSAA 3MV7E 1DDHA 5ANMB 4X5LA 3RVUC 2E9GA 3SKNB 3T2NL 2COVD 2XWBA 3HZYA 4FQXA 4R26L 1V27A 1YPZA 4U7MA 2O30A 5B1AB 1UXLA 3S37X 4E5XB 4HYTB 5FOJA 1CFNB 5D1ZA 1N26A 4X4MA 1QR4A 1RQ5A 3RU8H 3UGEA 3EO1A 1Q1JH 1JHLH 3QUZA 1GMIA 3R4DA 3BT0A 5DZNA 3CSTA 2XN9E 5JPMA 3NCBB 3U82B 1BQHG 3EIFA 1R0AL 3PWVB 3ABZA 3Q8AA 3VGBA 2MPVA 4F15C 1NBVL 4LQFL 4BE5A 4AY0A 2HJKB 4IQHA 1JMXA 2FZ3B 2E56A 3L3HA 4HUXB 2NY2C 1H5BB 1HZHL 2BW4A 1Z9MA 3V4VB 4B9ZA 5DVLA 1N0XH 5GQBA 4EBQH 3LRMA 2F74B 3GRGA 4GMTL 5TQ2L 1WO2A 3GSXB 4POZD 5D2LE 3SDAA 1SOQA 2MQCA 3KYNB 5SWSB 4XXCC 3UTZA 2IPKB 4WQOA 1KTBA 4ZUUA 6PAZA 1C12B 2EDJA 3HBGA 1H8SA 5EOTB 5I6XB 4UNTA 2HJFA 5K9QG 1NBYB 5DD0H 3F2LA 3QG7H 2YU9A 4UT6A 3UAAA 4OZ4A 2OZ4L 2ATKB 3EF4A 4PN6A 3BC9A 3D33A 4BH8A 1JXKA 4WI8A 1ZSHA 5FKPB 3NIFE 2DQJH 5DCCA 4PGBB 5EA0L 5DHDA 2DM2A 2B5IB 4AVIA 1TWCA 4RETB 5I26A 1S9KC 1BZEA 2YBRA 4HK0A 5T1LD 2QADD 4RCAA 4TQPA 3B3IB 3VFPB 3N50A 3UABA 3Q2LA 4OVUA 1NZRA 3FONA 4NCC1 3FH8A 1P84K 4NOBA 3UP6A 5AVZB 1R7RA 3GSNH 3OUGA 3FO2B 3DSFH 1OL0A 1S9XB 1H3PL 3RPBA 1S7SA 4P5RA 3LV3A 4BKLB 4L9LB 1PLGH 1DLHB 5GM9A 4OAWA 1KEGH 1BIHA 3UZQB 1S9WB 5HVFB 3OKOB 4WEBL 1QVOB 5D7KD 3QS2A 2X4RA 3WUZA 1JV5B 1OQOA 1MUJB 4NUJA 1KCSH 3JWNG 4NP4H 4P2OD 1SVBA 5C08E 5TQ0H 5DUBB 5EO9B 1FG2B 1G5AA 5JMOC 1ZY9A 3FU0A 4KROC 1GPOL 1THAA 1X5XA 4P2RA 4FMVA 3ZZSA 1G1YA 2ICWI 3MN8A 3QR0A 1SYSB 3KXFB 4F7CA 1A9EB 4XNUL 4F7MA 1IGCH 1WBXB 2WZAA 1HZKA 1LLAA 4Y19D 3NMEA 1W72B 2EIEA 4BD4A 2R1XB 3V0DA 1GOFA 1X5FA 1I7ZA 2OV0A 4CRZA 2W9DH 4YSQA 1JVLA 2PCFA 5D72H 2NXYC 1IKOP 4X6EB 4Y5VC 4OZIE 5JIPA 3VRLF 3BH9B 5BRZA 3QUXA 2X6MA 4HCGA 2X4SB 3GTLA 5A2KH 3WTUA 4AW7A 3MRCA 4XMUA 1R5IA 1JI2A 4H8WC 4NN6C 4I18B 5J12C 1T83A 1YN6B 2XWTB 2PICA 4BH7B 3CSPA 4XPTL 2BNRA 3L9BA 1BG9A 4ZW7A 1SUHA 5C0JA 3VI4F 4DK3A 4LSSH 3TWCH 1CLOL 4JDZB 1ZS2A 2EYRB 4BQCA 1NCTA 1CDJA 4I3SH 4MB1A 3S8FB 4JKNA 2L7EA 2VLLA 4X4ZA 1E6OL 1VEPA 2UWEE 3RVXC 4R4NC 5T5ID 2BIOA 2CALA 2F7IA 3MAWA 2EDDA 4JFPB 5I8CA 5IVNA 3FB5B 3QWQB 4L4JA 2I25N 4P49A 1FDOA 1F6AA 5DLMH 1VGEH 3HIZA 3WN5A 4LEOA 1LO0L 1KBGL 4WFHD 4EN3D 2H3NA 2VC2L 4UU9B 3U9UB 2Z35A 5F9OL 1FL6A 1INEL 5D4IA 3VI3A 4JY5L 2X7LB 4IOFC 1Y18A 3QAZC 4WI5A 2F1BA 4NHUB 3HHSA 3DTUB 2YSTA 3AACA 3IJSB 2O5ZH 1NIBA 1SLUA 2PPDA 5TE4L 4XN1A 4JRLA 3MLZH 2CU9A 4XWOC 3CMGA 2AXWA 2YJLA 2E8YA 2XV3A 3KW8A 1FLRL 4CSPA 3H6JA 4NJ9H 2R2EA 4JPSA 3E1ZA 1I1RA 3N42F 4OM0L 5HD8D 1NUNB 3P0VH 2RA1A 4XCEB 1HXYB 1FC1A 1H6TA 4Z0XA 1DN2A 4IGBC 3MRLA 1GHFH 3F84A 4YC2C 1HC1A 1ZLUH 1RIUL 3MC0A 4ZPTA 3RA7H 2IDCA 2VPYA 1FUNA 4LKCA 3WJLC 3OAYH 3W81A 3QIBC 1AZZC 1GMEA 2M83A 2RCSL 4PJDA 2NX5A 1UT1A 3RFZA 1AO7E 3V4PL 5I5JA 5EN2B 4JY4B 2KMWA 5GRXG 4QKTA 1MCQA 2F2HA 5FA4B 1EJOL 1ZTXE 1HL5A 1H5NA 3LZLA 5DD6A 4UWQB 4MQXD 1ZLSL 4WK0B 3VGHA 4WWKC 1QLEH 4LVNC 1FFQA 4N90D 3T3PF 5CHNB 1RD6A 1A4KA 3F7VA 5AW9B 1LDPH 4OW6A 4ADIA 2FNBA 5CINH 3X1NA 2ZCKH 2Y7NA 2EDNA 3S37H 3IDJA 4MAYA 3V95A 2QADB 4F2MA 1N5YH 3QIUA 4XB3A 4JO4L 1ZLEA 2VDOB 3L5XH 5AB0A 1OCWH 2F5AL 3AWGA 2R1YB 4PTUB 4HT1H 4NKDB 5CCHE 4DPRA 2HKAA 2AJVL 2OXHA 3NFPA 2QVTA 2XLLA 2VW4A 4AONB 3M17B 4C8XA 4M6ML 1IL1B 4W9JC 3QJFA 4UQAA 1DUZA 3ULUL 5E9DD 4UTCA 3IDNB 4W9GC 1WCMA 3WMPA 1SXCA 5ITBL 2ZYSA 1T22A 5LAXB 3TH3T 3PLXB 4XNXH 4DGIH 3CFMA 3MOBL 4JK0D 3RWHA 2APWA 1QUPA 3L08A 2YKLL 3STZA 2J8UE 4L3EA 1OGAB 1BXUA 4GRWE 4NBYB 5HHQB 2GFBB 4LARL 5TDOB 1NGQL 1PS3A 4LVEA 1LEIB 5DRXA 3G5VB 4RDQG 5HDRA 1R6VA 4X4YB 4RDBA 3RDTB 4Q14A 1E3ZA 5DJ0B 1LE9B 1ZD6A 2NYZA 3ERXA 1VADA 1S7VA 4NI6A 1KCUH 3CVHH 5DVMA 1BQHB 5T1KB 3EH4B 5E99H 2IXQB 4ZO7A 3BP5A 4Z5RB 4KODA 2F0CA 4F3FB 1ZS8A 1QBMH 1YEEH 4RDQF 3HR5B 4EXPX 4FP8H 5B7FA 1U8OB 1M2VB 3PJNA 3WFCH 2Y1ZA 3ROLA 4Y19B 4UB0H 3MLXL 3RVWC 3VTMA 4NN5C 4EIBA 4NQDD 3KYMB 1E5VA 1NLBH 3ARGA 2IALB 1SOXA 3BH8A 4NO3B 4G80A 2ZP8A 2VR3A 5LCVL 4NUPA 3MBXH 1KJ2A 3VE0A 1ZGLB 3ATEA 1C5BL 2G2RB 4PW3A 1RLBA 3D4CA 3QJRB 4XOEA 4J1UA 4OY9A 1JTTA 2ICWA 4OZHB 5C0RH 2AS5M 1NMBH 1EAPB 1XXDC 2C3HA 4XXWA 4Q9RH 4AI7A 1MH5A 5KSAD 1E60A 3LH9A 4WO4A 3P77A 2WZPD 1E42A 5MP6L 3A24A 5IB3B 5IESL 3MRGA 5JHDD 1JZHA 4M1GL 4PLJC 4FTVA 5D96B 3SDXE 1FYTA 1DEEB 3KPMB 3UIZA 4JPIB 4NZDA 4DW2L 4F8NA 3QDMD 3UPAA 4YFEA 1B4TA 1JGVL 4E9QA 3ARPA 1BEYL 3OLGA 5EU5B 2BRQA 3FT2B 5DFVC 1ED3A 3MLUH 4LP4A 1BZ9A 3O3DA 2XTJD 3FOMA 3DMRA 3VXRD 4FI6A 4DTGH 1H3XA 4RZCA 1DSFL 7CGTA 1DEDA 4EN3B 1PLCA 3F01A 4JHVA 5IMLB 4EO5A 2WB7A 2ATPA 3LNGA 1VF5C 1TCRA 4JREC 4YXKL 1TZGL 3EJRA 4HOZA 4KZCA 4JFED 1TOXA 4G6KH 4NKMB 2HXAA 4O2EA 3S36X 3ZU8A 1EQWA 1R47A 3IJ8A 4FLSA 4BDVA 3RL1A 2EEOB 4NQSA 1GC1L 4XXCA 4BE6A 1JWUB 1INQA 1FWXA 2NXZC 4YL4A 3KPLA 4MDJA 4UUJB 3TOPA 4GKNA 1U2CA 4H88L 4UOQA 2X4OA 3ZT5A 1Y1DA 3TF7C 3AABA 4TNGA 4D3CH 5F6HJ 2C3XA 1UGNA 3B2MA 3PPEA 3HI5H 2Z7UA 4W4OA 1XVSA 3WL9A 3L4UA 4HGWA 3L3IB 5ALCH 5T3XL 3FOLB 4H1LH 1NCNA 1MJ8H 1U8PA 2GC7C 1I8LC 1TMCB 1IGIL 2Z31D 4TUKH 3P4LA 4JPKH 4FA6A 5KYUA 1NJ9A 5DJ6A 2XG5B 4N2KA 5IJVA 1N8OE 2V2WA 3PCYA 2VWEC 1E30A 3GO1L 4MYPA 3LQAL 4CSTA 4FG0A 3QA3A 1Y4ZA 3QWZA 1DBMH 1YEGH 2VDNB 4GG6E 1VACB 3QH3A 4GSQA 2X10A 3IMBA 5EZOL 2WXMA 4HV8B 4D8PB 5I15L 4ODWA 1A6WL 1I1YB 1KLUB 1JHTB 1TYEB 5LXGH 2DLFH 2PPFA 1QLRA 1AKJA 3PP4H 4ZUVA 3IDIB 4LE8A 1T21B 4H2CA 3FCSB 4Z7UF 2P46B 4ZFFB 3GBNH 3NESA 4ZNEA 4AC2A 4LPCA 2NY0D 3PJSA 4XN2A 2FAUA 4HBCH 4JG5A 3JTTB 1JYVA 1Q0XH 3INOA 4PJIA 1N0LB 5FO7B 3ZGIA 2P5EB 3GHBH 5LNDA 5I18H 4HCIA 4M7JL 5E51A 1JPFB 4XPGH 1FSKB 1L6PA 3HI1B 1PIGA 3PGDB 3QFDA 1PT1A 2UVFA 3O0RL 3VFGL 4LDOB 5EF3A 3TPKA 4RX4D 1H3TA 1NDMB 3L4TA 3BFWA 1CR9L 1PX8A 4MRCA 1T7YA 5GRWA 2P8LA 2YRPA 4FZEL 5E9DB 4MQ7A 3VXMB 4PV8B 1NC4B 4KVNH 1F58L 2JI3A 3V4LA 3T2LA 4MA3B 3VG0L 2ENJA 2QV2A 3N91A 4RRPG 4MZ2A 5FDWA 1FFOB 3FF8A 2R83A 4YLQT 4YHLH 4WFGE 3KM1A 4NNYA 4HLEA 5F7EH 3GTTA 3E8VA 4Y5VA 3DO3A 4JCWA 1S3KH 3UC0H 4DKEH 4AE1A 2H41A 5HJ3A 5FYKL 2DQEH 3BAWA 3TN0A 1DVSA 3V0VB 1NPJA 3SY0A 4TNWF 3K6SB 1WWCA 5C0BD 2IQAA 1QFUH 2ENPA 3ESUF 3BZDA 1G6RL 1A1OB 2LVCA 2E3VA 3L1GA 4F8OA 4N0UB 3H3KA 1AQKL 2ADGA 15C8L 4LKXA 1I9RH 5IV2B 1S3RA 3QRBA 1KJMA 2IH3A 3BGFB 1TQWA 4LU5L 4Q52A 2WLHA 5F21B 4L3CB 4L5FL 2AQRA 1EZSA 1UJ3C 4HUWA 4NI3A 1PFCA 3W56A 2AEOA 2YA1A 4NQDB 1YDPB 3O8XD 3OPZL 4UINH 2UXTA 3RURA 4UCFA 5DTFA 1XGQA 4H0HB 4L3AA 4A2MA 4BV1A 4JAMB 1SBSL 4Y2DD 1ETB1 3ECVA 4N8VG 4QF1B 1K3IA 1T04A 5FA3A 3U6XS 35C8H 4PHXA 4C56D 5I71B 4J2QA 1YZZA 4F5CA 4YHYB 3QZWG 2H5UA 3DXAD 5T5FA 3ETBF 1UKTA 4J8RB 4UZGA 2ZG3A 5CP3A 4J5VA 3BP4A 4QMEA 2KYIA 5BMFL 3EGXB 3GSOB 4MXVE 3IU4H 5GJSH 1GYWA 1QA9B 5HHMB 3VFUA 1CLVA 1FAKT 2KHAA 5B3SB 1JP5A 3FQTA 2R69H 3EZ8A 4HMDA 1GYAA 1N64H 2WUBL 5KJ4A 1I9EA 4QJ5B 1GA2A 1PJ9A 3QDMB 4ODUB 1FL5B 4X5WB 3CQZA 3TEUA 4LLUA 5FDYA 2LAGB 2IADA 4G9DB 1OM3H 1DQJA 1MVUA 2DL9A 3FB6B 4NT6B 5I0XA 3P4OB 4UIKH 1WC7A 2CKBB 3C6EA 2WXLA 3JV4B 1KGIA 2K4WA 2UUDH 4IGBA 4Y8DC 2X2UA 3WS3A 1SLXA 3N43F 4XNYL 4JFEB 1A6ZB 1BAFH 2JKLA 1JNLH 4J3BA 1XL4A 2QV4A 4B50A 3AG4B 3QIWC 5F7UA 4WSJA 3QIBA 2Z92A 4HIHB 3IDXL 2N01B 2XKNA 3QNZB 1UXWB 1BQRA 2BNQB 4G9FD 5E08H 4EVNA 1JF1A 1HQ4A 1LP9E 3O6FD 3O2DA 3MV7A 5FGCE 5GIRB 4FXTA 4L8DB 2QPFA 3QEGH 2MCPH 1YMMD 2BC4A 4LF3B 1I1AB 2QTEA 3L4WA 3RZCA 3RPKA 5DMJB 2SODB 3G6AB 1E2VA 4FXKC 4WWKA 1W0YT 5EOCL 2WXNA 2CDGB 4FZ8H 3PRZA 3GDCA 4XPHL 2XN9A 4TLTA 4HJSA 4I85A 4G6MH 1AE6H 2Z91B 2DRUA 3G3LA 3VXTB 4NM4H 3L7FB 1CVSC 3MHZA 5I17A 4HPYH 3OHXC 2PW1B 3C2SA 5MEND 3V9EA 5DEFA 2YPVL 5CS7A 5BVJB 1VAHA 2FGWH 1WGVA 5KW9L 1Z0MA 5DYOB 4XX1G 3FO0L 3GRWL 3HE7C 4L8SC 3VWKD 3JWOC 4MSWB 5FYKU 5ID0B 2K3HA 3DIFA 4P59H 4NO2B 5JW4N 1AD9A 3DV6A 5JQ6L 5FGSA 5JXED 2BVQA 2MHAA 4PJGE 1Y6MR 3LMJL 3LS5H 4PJEF 3FFCB 4GQ9H 4XAWH 4AENB 3WEXA 3FCTA 4FQLH 3DPBA 1GYCA 5DVKA 3ARXA 3BP6A 2DV6A 3FTWA 3UBHA 2X44D 3S36H 5E8OB 2BOBB 3G5ZA 1ECZA 1RHHA 4NENB 2XI9A 25C8H 3GJFA 1E18A 5J13C 4X6DF 1KCRL 2FECL 3UC2A 1IGTB 3TASA 1WFUA 1H15A 4JFFB 4ZMNA 2AANA 3GTJA 4XWGL 5ADOL 2V8MA 1AIFB 3KL0A 2YRBA 3MLVH 2CNZA 2I07B 2XACC 4MZ3A 4N5ED 3SCMB 3CLEH 3SZ6A 2ZG2A 3IETA 1PTZA 3OKDB 3Q44A 1YNKH 4C4KO 5K9OB 4A37A 4HPHA 4ZAKC 2D2CC 1A6UL 1COBA 4JFWA 2AI0L 4J4PD 5J3HC 5G4MA 3V52H 1U2HA 3CZKA 2AJYH 3IVKA 2EDLA 4BZ2L 3CFKB 3HG1E 1N7ML 4X99A 1CLOH 2NDFA 5C0BB 1JZJA 1Z9OA 1PFOA 2H47C 2NTFA 4PJXB 5E1IA 5AW1B 1MCJA 2VDPB 3GI9L 3BD3A 1QRND 2VOTA 5L8JB 4ODSH 5K9KA 2IGFH 1II4E 4DETA 2W9EH 3GSUA 4IU3A 2E46A 4Z0BL 3P2TA 4NO0D 2V3VA 2PPEA 4XMTA 3QNXB 3D08A 2F1EA 2GBAA 3DRTA 4AUUA 2DMKA 2Y3AA 1UM6H 4WZ9A 3RNQA 3H3BC 1FDLL 1DQLL 1T0PB 5F9JA 5FEBA 1PD0A 1G9MH 3FB8A 4E2OA 3O8XB 1IVTA 3MNVA 1HZLA 1SM3H 1EGJL 4PR5B 4NKOA 4HCFA 2EDQA 1Q9KA 3JV5A 3ALPA 1YNJD 1VC3B 3WCYA 4Y2DB 5C08A 3MUY1 2FDBP 4GUPB 4FQHA 1KLFB 4C56B 1I3RA 5KN5B 4ZMVA 3ARSA 4WFEE 3AQXA 4FLRA 5DK2B 1Z1WA 1A6TA 2DF3A 4MBRA 1M7DA 4MXQD 3QEUA 4I5BB 1L3NA 1IC1A 3JSSA 3VGAB 4R84A 3C60C 3PNRB 3DARA 3TBTA 4CRPA 3VWJC 4YIQA 4S1RL 1YEJH 3SE9H 1BD2E 1G7IB 2QQKH 3G08B 3P73A 3V5KA 4M4RA 4PB0H 4XC3L 1JGDB 2R7ZA 1S7UB 2VZVA 4QLRA 4FNSA 4XODA 5CGMA 4N6QA 1RIUH 4OZIA 2X0UA 4RIRB 1AFVL 5BUAA 1NDGB 3S7GA 3NJHA 3MZTA 2W81C 3UYRL 2PO6D 2FBOJ 1AA6A 5ALBL 3X3FL 4TXVB 1SFOA 4Y4FA 1BIIA 5HJBA 3CV5A 4YXLH 1T0MA 1CF8H 4UNIA 5AKRA 1RPKA 4PRHD 4XHJD 1A9VA 2WYHA 5DSCA 3VAEA 2B08A 3MRJA 1I8LA 2FVNA 1WUNT 1SDDB 2E27H 2VDNH 1A4AA 1QMUA 2NNRA 3GSVA 4PRID 4R7NA 4ES9A 2X4PB 2ZWYA 2B0SL 2V9RA 3DVGA 3DK2A 4JQVC 3UZEC 4MJHA 4PJ8C 2B77A 1IBBA 3GZKA 4CILA 2UWEA 3GMMA 2EECA 1UZ8A 5EFIA 4XCFH 3SJVE 2J2ZA 3HC2A 4RV0A 1AANA 1MFVA 1U8KB 1YMMB 4Y8AA 5F3HA 1CFMA 4P3CH 1VRSA 2E7HA 4H13C 3EDEA 3WIFB 1OTTC 2BP0B 5EO0A 1PZBA 4D0DB 1MCRA 2NVYA 2JFCA 2N7BA 4U6YB 1X5GA 3AY4C 3F00A 4KJPD 4ZUWA 3ZSSA 3IXTA 4ZFOL 1I31A 4CJ1A 1D7BA 5C07B 2CRYA 5CD3A 3BWAB 3WELA 1SMAA 4KWUA 2Y25A 1MFDL 1YECL 2V5TA 2P49B 3C5SB 1UB5B 5DR5H 1XL6A 1RURL 2Y7LA 4M5ZL 5MENB 2IDUA 2G60H 4NLAA 3NK3A 1RERA 1CGSL 2QSVA 5HSFA 1WBYA 4BQ9A 1ICTA 1UKSA 2B59B 2P42B 3AJ7A 3PLYA 2CO7B 1AKPA 5E00A 2X6UA 2W94A 3H42L 4DT2A 5CEXA 2WN2A 1E27A 5LGJB 2VN7A 3RL2A 3VFRB 1HCFX 3OQRA 3C2AH 4E42A 2K45A 4L1LA 5D7HA 4HS3B 2OW6A 1MFMA 1FGNH 1GGIL 5TTRA 1RZFL 1TVHB 2VDRH 3A5VA 2H3KA 2G3ZA 3AREB 2IMNA 1AO7A 5IHZA 2J88H 4JGUA 1FH2A 3FT9A 3K6FA 4LLDA 3GNML 3T65B 1I9IH 1I3QA 1IEBA 3HBPA 4P5MA 4R8WL 3RHWK 5DMYA 2CDEA 4YDIL 1DUYB 2Q86B 2JIRA 3SGEH 4PSRA 2MTAA 3LAFA 4D7BA 4Y1AD 4HIIA 4BFJA 1NBZB 4Z8FL 1WAPA 3VU2A 2VW7A 1XMEB 2XVLA 5L9DL 1IE5A 1XSIA 3PE9A 1FFNB 4CGTA 4U1NB 5DVPA 4PS4H 3LKSA 2D3NA 4HWEH 3CC5A 4EIUA 2AQ2A 1UGKA 4BM7A 2A0LC 1AY1L 1NAMA 4DESA 5TDNA 1UWEL 2WQUA 1MCPH 5KSUA 2UY6B 4MB5A 4NJAL 5E4OA 4GXVH 3DROA 1OD9A 5EU7E 4AM0A 5L2KD 5TE6H 3HPJA 2QPSA 6PCYA 4DW2H 4FERA 5CIPA 3D7PA 5LN4A 2ENYA 2LABA 3QWNA 4HZLA 4NO0B 1OT2A 1UCBH 2FJFA 4YMPA 3AT9A 1QR1A 5KSVA 1LEKA 2DLEA 2YGQA 3OJ2C 3FUFA 5C6TL 1J8SA 4MJ5B 5IBLD 5JXAL 1G8JA 1XF4A 3BPCB 1HE8A 3FNKA 2J8UA 4NNPH 1AQDA 2F08A 4Q58C 2Z7YA 3ZDZE 1XGPA 4P57B 3W11C 3DX7B 4JHWH 1CXKA 2XXFA 1P6AB 3SUJA 1AOZA 4QRUA 2V7NA 3ZL1A 2BWDA 2CK0L 4GUCA 4XZUA 1OARH 3BPLC 2UYLA 2Z4QA 1RK1A 2VJ0A 3L3KA 5CUSH 2YEZB 4KQ3L 4KJQC 5E4EC 1A6AB 1KIPB 1NGYA 3DGCR 3K6DA 3MBED 4GQPH 2BP8A 4BA0A 5TK4A 3IK2A 2YAPA 4WW1A 1TCMA 4OJDH 4H88H 4MWFA 4UM9B 4ZFGL 3G9AB 3QIWA 1QPKA 3QI9C 2EDWA 3V5HA 2CMRL 4QJ3B 5GHWL 3A21A 1TETL 4R97C 1OSPL 2YD2A 3V0GA 3W39A 4G8AC 2X42A 2H1LM 2ZYIA 1NGWA 3DOHA 4G8FB 2CRIA 3HUJF 4Z3FA 2JIQA 2PO6B 5J1TC 2EEFA 2OCJA 4WNQB 4X6DB 3LN5A 1PCSA 5D7SH 4ONFL 2WINB 2DQGL 4FXKA 4MVBD 3MREB 2K8MA 2RQ8A 5HYFA 3LQAH 3MACL 1E7UA 2A9MH 4PJFA 2D7PA 5EIIG 4LCWB 1V7NH 3VX0A 5BNXD 1NEPA 2BW5A 5ERWB 4JZJC 2BCMA 2PETA 4HCRH 4PRIB 3SDXA 5I15H 3WFHA 3V5DB 1T5XB 4QRTA 3BWSA 1OTUD 3QJOA 3KCPA 4PGEB 3QZOA 3LZPA 4E41B 2GJPA 4HWBH 4NGHL 5IM7A 4U1KB 3D85A 3PWUA 2WLLB 4DNLA 1TF4A 5IR1B 2Y7QB 3FSWA 3BN3B 4G42A 1F4YL 2F5BL 2W95A 3ME0B 2HKFH 5D7JB 1XEUA 4L8SA 4UTAL 2NSMA 2YD9A 5B39G 4XP9H 3ESPA 2AF2A 3ZYOA 1GGCH 2EIJB 1DANU 1G0YR 4JFOB 4P46B 4BSVA 1VFAA 3FQNA 4QHNB 5ABDE 3FUIA 4NQCE 2GI7A 5IOPB 3R1GH 1PKQB 4KKAC 4NPYA 5J9PB 1B88A 4Q6KA 4XI5C 1U8LA 2CK2A 3BRGC 3EOBB 4XP1L 2B39A 2VDQL 3IDUA 3DBSA 1BPLB 1M71B 4PJ5D 4KOBA 4LOFA 2NY3D 5I2IA 1CBJA 4YO0A 5F9WB 4GIAA 4Y9CA 1PX3A 4YUEH 3G9VA 2CLZB 3NSDA 5D2NB 5CF3A 4NUGL 3IGUA 4ELMB 4U7KA 2IV2X 3DX9B 2NDGA 5AZUA 1ZHKA 1EWHA 2BY1A 3MUHL 5HYSA 3GKZA 1A4JA 3U0TB 4G8EA 4KITB 4R3SB 1UENA 1NFIB 3CZLA 4P4RA 3U0PB 3QO0B 4FQCL 5CMAB 2FH6A 1G6RH 2XZQH 2WQVA 3ATBA 3MRMA 2VDPH 4H25A 2EIKB 2IANE 3I75A 4IRJC 4LL9A 5GSVB 2E7BA 3BE1H 3F83A 3VA2C 3VQ1C 4FQXD 3SE4C 3FQUB 2QEJA 2W9LA 4Y4HA 2GEEA 2L7JA 3OKEA 4GG6A 5D1ZD 1ZVSA 3AW5A 4PJBE 3JV6A 4TVPE 4A38A 2F8OA 4H44C 2QKIB 3ZRCC 5DU7A 5D5ME 3OKKB 1NGZA 2B16A 3HAEH 4Y1AB 3ULVF 4QTIL 4Y2LA 4OJEH 3T3ME 4MKTA 5A3ID 5AL8A 1P7QA 1T7ZA 2ITCB 5ISZB 4FOMA 2PP8A 5C71A 3WI9A 4QOKE 1NCGA 4LCCA 4OR1A 5BQ7B 3LH8A 4ILDA 5FWQA 3R8QA 2W80C 4UIMB 4HH9A 2EE6A 2B3IA 1NMCB 4KI5E 2CJTA 4PJHB 1IIIA 5F89B 1ADQL 3BAKA 1RZKL 4YPJA 3GLZA 3KGRA 1CDUA 1HINL 2B1OA 3N40F 2YC1B 5I8EB 1JPTH 1Q9LB 1YYML 2V3EA 4IBLT 3B1TA 3INUL 3NRPA 3C60A 3OXRA 1BQUA 5CBEA 1GS8A 3MRBB 3EZJB 1XEDA 2M2DA 1U3ZA 2WTPA 5E1AA 3F5WB 2BVPB 4P23C 4QRBA 1UD4A 1S7RA 1R9TA 4N6RA 2Z8VC 1RL1A 1RUKH 3ETBJ 5JHLH 1U93B 3BI9X 2DQFA 2HG5A 4EUPB 1A4BA 1KT2B 4JNXA 1NIEA 3FT0A 1IARB 5ITFA 3A47A 2C7UA 1F3DH 4JANA 2CO6B 1DQMH 2HRGA 2VRKA 4WJKB 1F00I 5L4FA 3MBEB 1ZGLM 3ZE2B 3LXBA 1URZA 3MDJA 5C70A 2F58H 1JZ4A 1J48A 2ZSVB 3R4RA 5I66B 3O3BA 1HD5A 4O02H 1BYNA 1YEKH 4XP6H 4B95C 5IHUL 1OGTB 1WCBB 4MRBA 2QSCH 4PJ8A 3CFCL 5EU7C 1ODAA 1G1CA 1FHNA 1FBIL 3LKRA 5SX5H 4X6BA 1W8EA 2VM9A 2XQYK 2EO9A 2P47B 2Z8SA 3PWLB 2DYSB 2PXYA 3PPSA 1CMOA 3MJ8B 3Q5YA 1MIML 5K59F 4OVVA 1T1YB 3ULVD 1S9YB 2CLRB 4FXGB 5IBTL 3KDPB 3GMOA 3V4VL 1E5YA 4C4UA 1IRAY 2X6VA 4FFZA 4I2XA 3AY4A 2BXZA 3FQXB 3JBG7 4UV7L 5AVYB 2EVJA 3MCLL 5IGXL 5E1GA 1JVKA 2NNAA 5KW9H 3FUNA 1KFAH 1A7OL 2P5WE 3IU3A 1FZMB 4IW4C 3NUKA 3PGFH 1UM5L 4KRPD 4P2RD 1AGCA 2G0KA 1NL0H 3D09A 3PXJA 5ADPH 2ZXDA 2G5UA 1JPSH 5CSBA 1YEFH 4DKFL 1Q94A 1JCKA 3L7EB 1FRGL 4TL4A 1RZ8B 1PIFA 5HBBA 2UV3A 2EDEA 3V6ZB 2I60L 1AZBA 4NZUH 1HH9B 4CADA 2WLKA 3PIQB 4KXBA 5AL0A 1FAIH 2Q10A 4AQAB 1AQMA 4J3VA 4E9TA 4MBOA 4XN8A 1DN0B 1KCRH 4IKLA 1RIVH 2V3FA 3HBQA 4KK5C 1I7RB 4A7QA 1SY6L 5KJRL 5BRZD 4KVCH 2DMCA 3QUXD 1KEML 2OTUB 2VLKE 2Y2TA 4JKPL 2EDMA 4W6WB 5ACMA 1NCBL 1LP9A 4HK3J 4PJ5B 1RUAH 2ZOTA 3FRPG 1RFDH 2VLJD 3GBML 3QWRD 4K2UL 2ESVA 3BVXA 3LN9A 4XTRD 1T1ZA 5T3ZH 1MHPH 3ARBC 2RFXA 3ZXAC 1C5DA 5AFAA 1OIOA 2K70A 3F7RA 3BIBX 5IB2A 2CHDA 4LSTH 4HMCA 4BXSV 1EK3A 4POYA 2Y06L 4QWWD 2AEPL 1Q72H 3D3VE 4BCXA 5D1XB 2V9TA 3CZNA 3P3TA 1BFSA 4KXAA 1DDHB 4PP1D 1T03L 2BZDA 1V8HA 3BAEL 5ECGA 1GSMA 5CILL 2XWBB 2QQNL 3HZYB 4FQXB 4N1CA 1RUML 1YPZB 3SQBA 4OLZH 1HWHB 3R19A 5D1ZB 1UQSA 3EO1B 4JQIH 3QUZB 4LL4A 1J1XL 3CWGA 5JPMB 2O5YH 3MLWL 1VCBC 1EGJH 3NAAL 1I3GH 3WIHH 3VQLA 2WHVA 1WAAF 4GQQA 2NY5L 1MF2H 2HT2D 3CFBA 3TH2T 4QRRE 3T2QA 4PJGA 5I5RA 3W3BA 4JHAL 5E2VH 3A6BL 2DI7A 1JXGA 1W72L 4F7KA 3L3HB 4OD3L 5B22A 3ZKND 3WJJC 1XO8A 1VIWA 4TLSA 4A39A 1MNUH 3S88L 5DT1H 4XC3H 3BH4A 4LSPL 5LJYH 3E3QC 3A4EA 3MJGX 4XH2A 1MQ8A 1FGVL 3SDAB 2NX5D 1R5VA 2MKWA 3UTZB 3IDGA 4KO5A 4ZUUB 1IAII 1ZLVK 3UYRH 1DJIA 2MH4A 3QRGH 2HJFB 1KJ3L 1MJ7H 1WFOA 3QI9A 3MJ9H 1OAZH 4OZ4B 1MCFA 4XCCH 4BH8B 4UNVA 4M43H 2VQ1A 1FLTX 3BN9C 5A6LA 4HJJH 3EFOA 1YC8A 3NN8A 1Q9OA 2YBRB 1OKEA 2R56H 4HK0B 4N9GA 1XV8A 5C3TA 1U2YA 4MAYD 5B8CA 1R3KA 3LXUX 3LS4H 2E4TA 3UO1H 2RALA 3QIUD 1DJZA 2HLFD 4TPRL 1P1ZA 4U2ZA 4O9HH 3FONB 5LB1A 3MRIA 1JDAA 4JZJA 3WTSA 1IKFL 3H6AA 3K0YA 2I24N 3RI5K 1KENH 4Z7QF 1XIWA 1MDTA 1S7SB 4NQQA 1DL7L 2FJHA 4KI5C 3LV3B 4KHXL 1REIA 4XBEH 3QISA 1F4WL 4YBQD 4OAWB 4BFGA 1EHLH 1AG0A 5JDJA 1YJDH 5HPMA 2C9VA 2AVFA 1H9VA 4FRWA 4GFXA 1G7LA 3EYUH 1S78D 3QEQE 4E9YA 4L3ED 2E6PA 2B15A 2R7EA 2X4RB 5GZOC 1JDCA 2GY7B 3KM2A 3NJMA 4NUJB 2OL3L 3TJEL 5DD1L 3X3GH 5J6GB 1BD2A 3CFIC 3K91A 1E4XL 1JXFA 3S4SA 3WG7B 5KSBE 5GS0C 3RWDA 2WCGA 4RGMB 1JE6A 3G6JF 4KRPB 4P2RB 3LD8B 4KU1A 4MZRA 3D5OF 3F7YA 4LIQH 2D31A 3UG5A 3AXHA 5FW8A 3NSJA 4F7MB 4F7CB 5LWYH 3A4FA 4NHCL 4F7TA 4IDLA 3WUWG 1RZFH 3FFDA 1HEZB 3HC0A 1TPXC 1I7ZB 1SXZA 2CR0A 1EZVY 2PCFB 3GNMH 3HVNA 2ZYHA 5H35A 4OGXH 3ARGD 5AVVB 1EFQA 2TSBA 3TT1L 4XCYA 5BRZB 3CHRA 3QUXB 4XBPA 3MRCB 4R6UA 2EIMB 1TSHA 1V7MH 4N3TA 1R5IB 4YAQA 3LHAA 4AQOA 2H9GA 1IC7H 4UT7L 4M29A 3SJVA 2BNRB 5C0JB 5GGQL 1SDYA 2H6OA 2VDOL 3IS0X 3PABA 1PZCA 4WO4D 4W6YB 2AK1L 3WBDA 1H3VA 3LPWA 3JWDL 1F5WA 1FNHA 1C5CL 2L7UA 2GJRA 4FTVD 1J0KA 2DW5A 2ZE0A 2KZWA 1VZGA 4NDMA 2VLLB 2ICCA 2CH8A 4D0BA 3IWVA 4ZNCD 5I8CB 3GRBA 1F6AB 3TGXA 2A73A 3WN5B 1XH2A 4LEOB 1TQCC 1WFTA 3D0VA 3EO9L 2I85A 2C9PA 3B4NA 2H3NB 2VITA 4JO5A 1NFDF 3H0TA 2DIJA 2H6PA 2Z35B 1FL6B 1OM9A 1CD9B 3VI3B 1JGIA 5I0YA 1Y18B 3QPQC 4WI6A 5KUMA 1SNRA 1DO6A 5C6TH 5JXAH 5KTEH 3HHSB 1OCCB 4LHUA 3ZKXB 2WO4A 2XTLA 4NFCA 1YC7A 4F2FA 4JZOA 4XPBH 1WHOA 2YGNA 5FV2A 1JV2A 1WS8A 4KQ4L 1I8MA 1P5UC 2UX6A 3T71A 4YDZA 2OR7A 5IVXF 2R2EB 3T5WA 2DAVA 2CK0H 1IBFA 3CN4A 1NAKH 3QFJD 3TBBA 4CDHA 3SGDH 2PI8A 1ZVHA 4Z0XB 4R2GC 2J1KA 4JDTL 3MRLB 4AGOA 5AKTA 3TS8A 2NZ9C 4R7LA 4ZPTB 2X09A 1M53A 2W1NA 5LKNA 2P52A 1P84J 4ODTH 1U91A 4ZFGH 1P4IH 4AYID 2CMRH 4ZX4A 4LKCB 4GAYA 3FTZA 1T2JA 4FDWA 2MQ3A 4KGJA 1KB5A 2NX5B 2XJKA 4PJDB 1U8JA 3RFZB 1RIHH 3GIZL 4A6YA 2Y3NA 4GNKB 5DZAA 2FBJL 4M00A 4RGNE 2BY3A 1KGCE 3FDWA 2EXSA 3IMUA 3Q43A 4HIEA 2P7TA 4G5AA 5DD6B 5F6IB 3U2IA 4IRSC 3N40P 4IDJL 1CU4H 3AU0A 4R90H 3IDMA 4WFFE 3TEWA 2DMHA 2NLJA 3CFEA 1OZTG 3BJLA 4MCZA 1N70A 4LPXA 1PT0A 3IS1X 4UDTA 3AG1B 4K55A 4R7DA 3F7VB 1A4KB 3QUKA 2E59A 4C2MA 5D70L 1EEZA 2YMXH 2YXVA 3IDJB 4MAYB 5E95B 3QORC 4F2MB 1Q16A 1WFIA 3QIUB 5AZ2L 3MNMA 2CHNA 3NYKA 2DWTA 2UX7A 2QLYA 1SEQH 1QFWL 1XF5A 2EDBA 2IBBA 3MRHA 4HKJA 3CNKA 4PRAA 2OX5A 3ZL4L 4XR8C 2OXHB 3NFPB 2LAAA 5TPWL 1Q38A 3A6CH 2FQFA 2XFXA 3QJFB 4TM9A 1DUZB 3S2AA 5DHEA 2EAEA 4OQTA 3DETD 1Z9SA 1T22B 1FORL 1GAFL 4B9IA 2QHRL 4X0NA 5DVNA 1J8RA 5IWLC 1J5DA 3STZB 4J3OC 4L3EB 2VISA 1B0GA 4LFHD 3D30A 4AITA 2DWXA 4QEGA 3TIWA 5DRXB 3U7YL 3MYJB 1CDIA 2QMKA 4CGUB 4JFHE 3RYMA 3UH8A 3TN0D 4NZTH 2UZIL 3U25A 4BFOA 1QW8A 2LHAA 1DCLA 1VADB 4X7SH 1S7VB 4Z95L 5FV1L 3VG9B 1MI5D 3BP5B 2FO1A 5DHVA 3VO0A 1F4XL 4Q7DA 1DBKH 4CL7A 4PGDA 1ZS8B 3N6YA 5I1EL 2DWEA 3FAXA 5FO2A 2YD6A 4UZSA 5FCUH 2Q8AH 3ROLB 2ENQA 3T9WA 4DEUA 4FQCH 4IRZH 4XVJH 2AJUL 3ARBA 3IJ9A 2LGNA 3BLKA 4YDLC 1YLEA 2YD7A 3GD1C 4JHBA 1BVZA 3ARGB 4LAJH 3BH8B 1A7RH 1EJ8A 4G80B 1P7BA 3RVXD 1EO8L 1KJ2B 3VE0B 4DPCX 1M9WA 4J1UB 2ICWB 2CM6A 3GB7A 4F58L 3DX1A 3EH5B 1UWFA 1HI6A 3FT3A 1MH5B 5JHMA 3GEWB 1NMAL 4FNLH 1TQBC 4KNUA 3P77B 4WO4B 1J5CA 3MRGB 2E9BA 4X5RA 4FI7A 5D2LF 4FTVB 1FYTB 6FABL 5ILTH 3QUMA 1MREL 2GC4C 3WKPA 4URTB 1E40A 4HWUA 4F15B 4NQCA 1TJIL 4BQ8A 1ED3B 2BO0A 3ATAA 5TH2A 1BZ9B 3O3DB 2EUXA 1L9OA 2ED7A 3FOMB 3MNDA 2MPAH 1MIEL 3D39D 4PAZA 4RZCB 1MCNA 4J3UA 3S3JA 2IPTH 4HIJA 4IGBD 1CFVH 4N24A 3BXNA 2ATPB 3OPUA 1TCRB 5CJQL 5DQDL 3C08H 1B6UA 1VPOH 4O2EB 1R9FA 2F7OA 3GTOA 5JA8B 5JW4M 5IMOA 43CAA 2HTKD 3GUTA 4B96A 4BDVB 2OSLA 4O00A 3RL1B 1PMYA 2XG4A 5DMIH 4NQSB 4QO1A 1OAQL 2YEQA 1INQB 3KPLB 1RZ7L 4MDJB 2JA6A 4GKNB 3IJHA 3HZMA 3OZKA 3QG6A 5LBSL 1UXMA 2JB6A 2X4OB 2FWOA 3QCTH 3V0WH 5FUCE 4UQCA 3RZCD 3PHOA 1BEXA 1TWFA 3WL9B 4WWKD 1ZCRA 1CD8A 3X14A 4HGWB 2A9NL 1JXJA 2Y4SA 1U8PB 4R96A 3ZKQD 5E1QA 2XN9D 5D5MA 5LDUA 5FFGA 5KYUB 1MCCA 1NJ9B 5I6OA 4G7RB 5T1MA 2OYLA 5IJVB 2V2WB 3TEXA 4GKSA 4K9EH 2YUVA 4ABVA 3NCEB 4IU2A 4LEEA 1EXHA 1XTLA 3QA3B 2DKUA 3NZUA 2Y2WA 3M86A 3QH3B 4RFOH 4G6JH 4I1RA 4ANUA 1AOHA 4ODWB 3CDGA 1L6XA 4Z9KB 4U49A 1QLRB 1AKJB 3TXAA 5GLYA 1CT8A 1WTGT 4ZUVB 1J0IA 1K3ZA 4Y89A 1XGUA 2X70A 5FFLA 3IJ7A 3ESOA 1PDKA 3ENEA 3UBGA 2J6EL 3O6KH 2CIKA 3PJSB 1RK0A 2CKBL 2AQ3A 2ZSWA 1MCBA 4OZIF 1MFEH 2IPUK 4PJIB 3DHMA 1J9SA 5GGVH 5KANI 1BVKA 3CN2A 4YK4C 4WHTA 1YYCA 5K39A 3QFDB 4XPFL 4AWJC 4DEWA 4ZS7H 5JOPE 1CXLA 2P8LB 4I3GA 2WO2B 3SBQA 3V7AE 1E4JA 3BCDA 5HDWA 2E2HA 4MQ7B 1UA6H 2EZ0C 1LO4L 1CYGA 4HFUL 4XAKE 5E0FA 3POHA 3VXSE 5L4JA 1QQDA 1KEMH 5FDWB 2BVOA 4N0YL 3RVWD 4NNYB 1QFHA 3W0WE 1D3CA 2NXYB 3FZUD 3LKNA 4Y5VB 5ABZA 4EZLA 1SUJA 3LEXA 3MXWL 1U21A 1CDGA 4XNAA 3NZHL 2FWLB 2XPZA 5HJ3B 3TN0B 5MEQA 2PTUA 5DHYA 5LDSA 3LCYA 1YNLL 3SY0B 2IQAB 1YMHA 3NCCB 4NPJA 4NN6B 4TULH 1MG3C 5J12B 1ID5I 4UILL 2WP3O 3HG0A 3K4ZA 2ADGB 1QSFE 3RQ3A 2NY7L 4KJWD 1E6JH 1K2DA 2OI9C 4LKXB 5JZ7C 2ADFH 2XWJA 1KJMB 2IH3B 2ZKMX 5IZ7A 5AW2B 4LO9A 4A67A 1RJLA 3Q01A 4HUWB 1GS6X 4AMKL 1LQBC 3KYOA 4UANA 3VD2A 2V17L 3DURA 5DTFB 2VDMH 2NSXA 1XGQB 4JZNA 2DJ4A 4OLWH 1OA9A 1ZK5A 5FA3B 5C08D 5GGRA 4HXBH 1T04B 4U3HA 3NIGF 5IKCA 2EIDA 5DFVD 1O75A 3QXTA 2VL5A 2P5WA 2H0JA 5I1LA 2CR6A 2DJUA 2EQDA 1SGKA 3O6ML 4ZTPH 3B2DC 1LE5A 2EC9T 3BP4B 4KKLC 3QAZB 1FNEA 3BT2L 3MQIA 4XMLH 4DGVH 3VFUB 3DBXA 4CW1A 3ARZA 3FQTB 3GXNA 4KK9C 3M1BA 4M93C 2DMGA 1DQVA 3S6CA 1A7NL 4LLUB 1UASA