2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YOAJ
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
molecule tags Cell adhesion
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
2ENGA 4FERA 2PNWA 5H4UA 4ZM7A 2KQAA 3D30A 3CZBA 3X2IA 3FT9A 3FT1A 4FFTA 1BMWA 3SUMA 2GAEA 3SUKA 3X2PA 4FG2A 3SULA 4JCWA 2G5DA 2VXQA 1OA9A 1HD5A 4L48A 4FG4A 3X2OA 4JP7A 1N10A 3X2JA 3M3GA 3SUJA 1WHOA 4AVRA 2PICA 1L8FA 1BW4A 3ENGA 2JNZA 4ENGA 4JS7A 4JP6A 1WC2A 3X2HA 2HCZX 5GM9A 1BW3A 2BH0A 5GLXA 5GLYA 2AE0X 3X2KA 2PI8A 3X2NA 3X2LA 1WHPA 2G6GA 3X2GA 4JJOA 3X2MA 1OA7A 2PJJA
chains in the Genus database with same CATH superfamily
1YUHA 5EHFA 4APXA 2NXYD 4Z8FH 4WUUB 2I9LB 2IXQA 3Q13A 1BWWA 1B9ZA 1KJMA 1P7QD 4N2OA 4N2KA 2OJZH 5DQDL 5E9DE 4A6YL 4GKZB 5J7CC 1IGYB 2DZEA 2VW6A 4PD4J 5EBMA 4EI5A 1SMDA 2FD6H 3NRQA 3VXRE 5GRZA 1CE1L 2WLIB 3CFEB 4P3DB 4B9YA 2I9TA 1FCGA 5F7DA 1FVEA 4X6CA 1IM9B 5CP3A 2BSEA 1A2YA 1NSNH 3DPDA 5C0BB 4E41D 5FCUL 3C2SA 5ECJE 3KLHD 4PJEF 3FQTA 4ZFOA 3FQUB 3MI6A 4I0PD 2GW5A 5T1LA 4MDJB 5GGQL 2Q1EA 4XRCA 1T22A 2JLPA 2WOYA 1DZ0A 1KENH 2K8QA 5MP6H 1LDSA 2YK1H 2JK5B 3CLFH 5C0CE 4CRPA 1Y1UA 4J4PA 4M61B 4LB8A 5FFOA 3FB8B 2YRZA 3QZWB 3II3A 5EIIB 3BQUD 2DL9A 5E6IC 1H5BB 5LCVL 2W59A 4GUPA 3RAJH 2UX6A 3C5ZD 4PBXA 3L4WA 1E61A 2YD9A 3ZN6A 4FNLH 2IWEA 5KSAD 3RGHA 3LNFA 4KX7A 4EE2A 4BZ2A 3DIDA 1MJ7H 1TCRA 4J12A 5HYSB 1MVFA 4WHDA 1HVXA 2W0KA 2NY3C 1KIPA 4KZEL 4LO9A 4DETA 4F5CE 1KYOK 3HMXH 1IL1B 3UGUA 1OKEA 3DMMC 1CDHA 3F7RA 5F71A 4ZAKB 3MBED 2CHWA 4GNKB 1D5XB 2YMXH 2NQCA 2AAVA 32C2B 5EWIH 4CILA 3JUYA 3CFDB 1YAIA 4HKZB 5KS9E 1M7IA 2DMCA 3CHRA 1DL7L 3VGEA 2CCVA 3MCYA 2X4TB 1QSFD 5HGBB 4FQXC 4PJEA 1QSVA 3GHEH 4KLNA 1SOSA 4BKLB 1IGTB 1QFWH 3O45B 2J6WA 3EDEA 4BDVB 2VMFA 4B6ZA 3PXHA 4QRFA 5AVXB 1FE8H 1CXFA 4I18C 3ULUL 1ACYL 1JN6B 5E1AB 1EFXD 3AVEA 4G6AC 4YX2H 2WGNB 4DZBA 2O72A 4PWJA 1X7TA 1XBDA 3VQ1C 1IBZA 4JMXA 2X0VA 5I73B 3RL1A 1RZFL 2H4EA 3GSWB 1MEXH 3CTTA 1YO4A 2VLJE 4H88L 4HIJB 3PHQA 1W0VA 4IOFD 3MRBB 2WO4A 1XIWD 3UTZA 2DEWX 2N7BA 4UQBA 1QQDA 3LRSA 4D7PA 1J1OH 1MFDL 2ZXGA 3Q6GH 3FQ4A 5CMAB 3B9KD 2VXQA 5EEXA 4HGKC 2XN2A 1AG0A 1F6AB 2WBJD 4CC4C 3BN3B 5E6SB 3ES6B 4FFZA 3C6LC 4XCCL 4M8UA 1ROWA 2HT4D 1A9BA 3TC9A 1RUML 2AV1B 2PPDA 1K4CA 1PQZA 1Y5IA 4HW6A 5T3XL 2NY4C 3SHSA 1IC5H 1L9PA 4TVPH 5E6IA 5DMJB 1HI6B 1L6XA 2MQCA 3MA9H 4W9IC 1XCTB 4EDXA 4KBPA 5TE7H 2P47B 5CF3A 4Z77B 1QACA 2DAVA 2Q7AA 4OZIA 1HQ4B 5C2BH 2SEBB 4K3GA 4M7JL 2OMUB 3H3PH 1A4KB 3X1BA 2GAZA 1ZSDB 4U6YA 3D6GA 4WENB 1M7XA 3TESA 4HKBA 3DIFB 3BLBA 3ARFD 1NAMA 2YUJA 3QPXH 5I1CH 3T0AA 1M1XB 5DYFA 5DQJB 2WQ8A 3DMMA 2GT9A 4BFFA 2OX5B 3X2NA 2NX5A 4X80L 3WDIA 2Q10A 3BVUA 3T4AB 3HS0B 5D1ZC 3VFUA 3ZSTA 4UDUA 1P7KA 3NSYA 1R5WA 4FQXA 2XSKA 4M43H 1UM5H 3ZDYF 2CRYA 2O6PA 3EAKA 2J8UA 4DQOH 3S3CB 4G2AA 1D7DA 1SYVA 6FABL 3IPEA 2Y06L 4I18A 4Y19D 2VIRA 4I3RH 4LCVA 1EGJA 4FZEH 5KTEL 4PW4A 3MCLH 4MNQA 3ZE2B 3O3UN 2IAND 4Z3TA 2W60A 1CFNA 1NC2D 3TZVB 4B0MB 2LU3A 3S6CA 2JCWA 3DIVA 3KPPB 1FVDA 1PPYA 3HE7C 3SKOA 3Q0HA 3MX0A 3WDJA 2FECI 4ONOA 5JPNB 5IB3B 3GXNA 3L4TA 3TJHC 3S37L 3BMWA 5FYLE 4JDZA 2E75C 3ERXA 4LCUB 4N0RA 1J8HB 2DJUA 3SY0A 2C9RA 1B2WL 3I9IA 4KV5E 1JPST 1IGML 3B9DA 3LNDA 1NCOA 1E9OA 4YO0A 2FQDA 4X6FB 1BFVL 4ZS7L 2EUXA 1FAIL 4CC4A 4MAUL 4GT7A 3C6LA 5D72L 3SDXA 3NPSB 1NC4B 3X2MA 4MJJA 4XGZA 4E9YA 3AB0B 1YNTF 4XZ4A 5I1IL 1XF5B 3LCYA 3RKPA 4WGWB 4FJ6A 4LP4A 2J8OA 1GGIL 4P5RA 3WO4B 4ETYA 2GBUA 1WFMA 3NAAL 4QRUA 3KCPB 4Z7OF 3GXPA 4BUGA 4KI1A 1YEIL 3I9AA 4PGJA 1Y7VA 4FQHB 3BHBB 5C3TA 2R8SH 4M8QA 2FATL 4JZNB 1F4WH 2VMEA 5B39G 4AUUA 1E4KC 1ZANH 1I9IH 3V52L 1WD9A 2XQYK 2F53E 5SX5K 4KROC 4OD3L 5D96C 5KBKA 5C08A 2Y5EA 1MIMH 2R92A 1AS8A 4PJXA 2C7UB 4JRXA 3FU8A 3P3TA 3UTPD 2DLEA 1NSNL 2P8MA 3HKFA 4FRWA 3TASA 5MEPB 5D1ZA 5AD0B 1BZ9B 3QZOA 5KBLA 3LZQA 4TM9A 3W57A 2VCOA 1ND0A 1I1CA 3BKCL 3O6KL 2Z9TA 1J5OL 2D7TH 2FX9L 2WNKA 3GNML 4LLQA 2Z92B 4XP9H 5INCB 4MJ6A 3KYMA 4IBLT 3QJHB 2M26A 1JPSL 3CLFL 4EZMA 4AIZB 3FOLB 3POCA 3LPWA 4R6UA 2IV9A 1U2CA 2VQ1B 5IREA 3FN9A 5DK3A 3VM7A 1PW3A 1A14H 4G8EB 3HZ3A 1MXDA 4ZUUA 1KTCA 2NYKA 3QG7L 1TWHA 5E5LA 4FG4A 3CX2A 3HE7A 1RPQA 1K2DA 4XI5C 3DUHA 5DC2A 3MC0A 1IO4C 1NCCH 1R19A 5I8EB 1AQDB 2VLRB 3EGSB 4A7GF 1EX0A 3KNBA 3ZYZA 4PWHA 4H20H 5A6LA 4H8HA 5E8EB 3P9MB 4OB5H 4J1UA 3GS0A 2FB4H 5AYUL 5KWYC 3T3MF 3P3YA 2JCCF 3TO4C 2FSEB 4X6DF 5DHXB 5ILTH 1KLUA 1SN2A 3AY4C 1CO1A 4OFYD 4JRYE 4QRPA 5EWIL 4MD5A 1JZFA 1ICTA 2QPDB 3NCCB 5F93C 4BE5A 4JRWA 4NRXA 1NCBL 1C12B 4JFFB 3HG0A 5I6OA 5M7QA 5I9QC 3P73A 2VDOH 1HJCA 5FYKE 3MRFB 5CP3H 5T3ZE 4N8PA 4LDCA 1JI1A 1YPZE 3U4BH 3SDAB 4JM4H 5CLXA 1KIQB 2R1XB 5D1QB 4EZJA 5IHZA 1ETZA 4NPKA 2VTFA 5ESAB 1E4KA 1OE1A 1D6VH 2AZUA 4W9LC 3BESR 5A2IH 4NI3A 3VH8G 1HINH 4CU7A 5I8KH 1FH5H 1KXQA 4JGUA 4UBDD 2WO2B 3FCUB 1CFVH 1KCUL 2F54D 2JKTM 3N1MC 4JY5H 3CXHJ 1MEXL 4OQTL 2WVUA 4WTXA 1UJ3C 4B9FA 2ZOUA 3ZTJG 3RDTC 2OMZB 4IRJC 3TCXA 2R1WA 4JO1H 3TFBA 3TBVB 2AANA 4XR8C 5KVFE 3QUXD 2BSSA 2MMXA 3JWNH 3L3GA 1ZGLB 3LIZA 2QELA 4LSUL 4A7GA 2F5AH 3AAZB 4JREC 1RK0A 4BSWB 3QRLA 3GLDA 3LKRA 3FB5A 3GJEA 4P49A 3PV6B 4X7SH 1BXVA 2AQRA 2UVEA 3RGVB 3FTYA 4BZ2H 1R9FA 3HOGA 2BP0B 2ZYRA 4OCXL 5CGMA 1N2RA 1MW1A 3IMUA 3QO1B 3B2PA 3CHQA 5J13C 3CVIL 4NJAL 1I3VA 1QSEE 5ICZB 1N5AA 3GTKA 2MHAB 3NT0A 3MV7B 4WK0B 5DK2B 3RFRA 4TVPL 1FV1A 3GSQA 3VDAA 4QYOB 4QIWA 3IMTA 3NVQA 4QLWA 3VXTB 3F5WA 3HLKA 3V7MA 4G9DA 5J11C 2ZWYA 5TE4H 3RWDA 5C2BL 1GJWA 3FF8A 1RZGB 4B27A 4ZUSA 2MKLC 2O5XL 3BW9B 1WWWX 1VRSA 4PRAB 2ZSWB 2AQSA 2NNCA 3DHJA 3WUWA 4G8FB 4FULA 3D08A 1JMXA 2XVGA 2A6IA 1AGFA 3QI9D 1PKQA 3ARWA 3PDGA 2QVTA 3BPNB 4I9XA 3V0IA 4ENED 3Q8EA 4GFXA 4Q97A 1F3JB 1GW6A 1H9DA 5EBWA 3BWAB 1P2CA 2PCXA 5D1ZI 4C57C 3AY4A 4UILH 2DQDL 1K5WA 4N26A 1CB4A 1LO5B 2D73A 3BPOC 4PY7A 2R51A 3VXOA 5HVHC 5KS9F 1SBBA 1FGVL 3ZMNA 2FBRA 1ZPUA 3FO9B 3D39A 3H4HA 1RAMA 2WIIB 3D69B 4N2IA 4NUGL 5KVGH 4HFUH 1NJ9A 2E8ZA 3FH5A 1UXWA 1E9PB 3F04A 3C12A 4NYLB 3QFJE 2ZUSA 1A5FH 4G70B 2VXQH 2IF7A 2AJSH 5DD6A 3ZMEA 4NIKB 4NM8H 3AT9A 1NKRA 4IIQB 4FFYL 4FFZH 3U0WL 4RH4A 2YKLH 1ZE3C 3GHPA 4LSQH 1KYAA 4XNXH 2RJMA 4HUXA 1ZKAA 3EFOB 4BQ8A 3S2AA 1UJ3A 3CN4A 3ESPA 4FQLL 2ZF9A 5IEHA 4IRJA 3GMRB 3KHOA 3FQWA 1QZ1A 43C9B 2OL3B 3LNEA 5D7IB 3QWOB 3HHSA 3LPPA 4B95C 2WUBL 4JKPH 1E18A 3RTQD 3QDGB 1Q9LB 1O7SA 1KJ3H 4G7RB 4JHUA 4TSBH 5D70H 2B16A 4XNQB 3PAZA 1IFGA 2VH5H 2WN2A 4ODSH 1CJYA 3ZBMA 2CO7B 2ZKYA 2A6ED 4DTGH 3T2QA 3LKNB 2C5DC 3P2TA 1F2QA 4TF4A 3MNWB 1NGXB 4YUEH 1J05A 3ECBA 4J7RA 5BXFA 3BXNA 3CC5A 1NAMH 2NUPA 4JFZH 1E30A 3RKDC 1TPXB 4XMVA 3FKIA 4P59H 2KC0A 3GUTA 2N01B 3KS0H 4BCXA 2H0PA 1IFHH 2CO3A 2VXVH 3QJQB 3TX4A 1WAAE 3AS2A 5IT2H 1F4WL 2J1KA 1AXTH 4PJIA 3DYMA 3VTAA 4JM2F 2YQ3A 2VLLB 3WMQA 3W9EA 4BUHA 5GS0C 4MSWA 1U3NA 3C6EA 2H0FA 1OA9A 2NR6D 2F19H 2KPNA 4GSQA 3W2DH 3EHBC 3JWOH 1AO7B 3KLSA 3WN6A 1Q38A 1TWGA 4AT6B 1EGJH 3WYRA 2YGOA 4IBSA 2P9RA 3LEYL 4TNVK 5PAZA 5T1KD 1OT4A 4JHAH 5JDSA 2EADA 1GA2A 3H9ZA 2RBLA 3FZUD 3L3IB 3OR6B 4RRPA 4FP8L 3AW5A 2AQPA 1Q0YL 4B9PA 4XZUA 1HH6A 2VLKE 3QUHA 5LDUA 4UV7H 1EFQA 4MS6A 3RX9A 1A6WH 3DVFA 5IKCA 2WZ5A 3I75A 4G8GE 4XP9L 2HFFB 4KKAD 2K78A 4XWOD 2F53B 3O8XB 1DBMH 1Q9OB 3MRRA 3FQNB 3N2JA 1EO7A 1UCBH 1ZT7B 5DSCA 4AY0A 1KWKA 4YMPA 4G6JH 1QBLL 4M8VA 4AEEA 3ATBA 4M5TA 4LSPH 3SPVB 4KO6A 2AK4A 4JHVA 1FFOA 2EE6A 1P4BH 3UGEA 4H1LG 3TV3L 5EZJA 2XWBB 1VKXB 1RZQA 4V11A 1NEUA 4AE1A 3HB3C 4J3WA 4O2FA 1H3WM 2MNWA 3CSYB 3V5HB 5DUBB 1T03H 3RWFB 4JHWL 4ZW3A 4OD1L 4RFOL 4Y5VB 1IIIA 1TEYA 3KPMB 5B39B 5C6WH 3LKSB 2FO4B 4Q4IA 2V3EA 1H8NA 5DJXA 1WZMA 1RK1A 1O6VA 2EIDA 2OMVA 1T1XB 3KM1A 3LSOB 2BNQE 2FWUA 3VFWB 3VWJC 1AGCA 1E3FA 3QARA 4KXDA 8FABA 1IC0A 1L8FA 2EYRA 2ZPKL 1BREA 3C9NB 2XQBL 5KSVA 1TQWA 2NZ1A 3HAEA 4HXBL 1TU2A 1ZAGA 4NERA 3BLKA 4JVUA 2YU9A 3QR1A 5AUMB 5IB5B 4AGLA 2ZCLL 4X0KB 4ELME 2FR4A 5F7BA 3VGFA 3BUYA 3BYYA 2UZYA 1YY8B 1ADQH 2FNBA 4X99A 2LTQB 3RNQB 2K7PA 2XIBA 2Y9RT 2VDNB 3RI5F 1TUPA 1QYGH 1UD5A 4HDIA 1DVUA 2DQCL 4WI4A 1MQKH 2XZQH 5JORA 3NZHH 4S1DD 3D0LA 5FF6A 1K5NB 5CEXB 4ZMXA 1MIEH 4NZRH 3MFFA 3X14A 4F7CB 5I0VA 3TBCA 4Y5XC 1QOKA 1S78C 2XVBA 3NRPA 4ZSOB 1JK8B 4YSDA 2QQLH 1SY6L 4RAVB 4M56A 1B88A 1CGVA 1KYOJ 1E8YA 1OCRB 3O6FC 4JQVC 4YHKH 3QXUA 5DS8B 5E1GA 1TVHA 1D5ZB 2FHCA 2FX7H 3ATEA 4JO1L 2OR8A 5ACZA 4MBOA 3ZO0A 5KVMC 4XMUA 3NH7H 3Q7JA 5D7LA 5BMFH 1YPZB 2FZ3A 5EU6D 1A7OH 3BPCB 3KYKL 4NKIH 2PCYA 5HGDA 4GJTB 1CGWA 2C7FA 4MXVE 1T89C 4PEEA 4LBAA 5LXGH 1C5BH 3LZPA 3NIGF 3FUHA 4KKLD 3I74A 4QHNA 1QBBA 2HB0A 3MLTA 4RSVA 4EI5D 3K72A 1DO6A 2V7NB 1E5AA 3WKQA 4N6RA 3PUCA 4GMSH 2BSED 5EDSA 3PF2A 3ZYIA 2ZG2A 3I9PA 5IFHH 4KH2A 3MTRA 1G43A 4K9EL 3S5LA 5KYWA 2V9RA 2W0FB 5T1LD 5DRZA 5EZPA 5C6PB 5C0NC 4OZHB 3BDYL 3ZSSA 1MFMA 4P5TC 1BMZA 3IBEA 1KT2B 5E70A 4G72B 3SQBB 2EEFA 4PRDA 3VH8B 4J4PD 4GW1B 4LSRL 2JTYA 3SZKC 3GSXA 3VWJA 1LEIA 2QDWA 2PMZA 3UC2A 1QSEB 1VESA 3FRPG 2WKLA 4AGMA 2WKOF 2BOBB 2X4UA 5FW7A 5D9SA 3X13A 2TRHA 1TT6A 3RVWD 1A64A 3TNNB 4J3OC 1L9NA 1OAYH 3QH3A 4AVKA 3MMEB 4LOEA 3T2NH 3D50A 1MWAA 3LH2L 1JI2A 2OZNA 4N90D 1LK3H 4J39A 3S4SA 3LIZH 2GBAA 2X44D 3NJFA 3CLWA 4LKCB 3RVUC 3RVTD 1KLFB 3X11A 3MLYL 4YVNA 3CXDH 1CDJA 1HCZA 4NM8L 4OUUB 4AM0Q 5IJBC 5DI8A 1KV7A 2J20A 4Y5XA 4F33B 4XNXL 1HZHH 5TGBA 1JZ6A 4ZX5A 1JGDB 2MPVA 2YD6A 3UOAB 3O6FA 1U8IA 4JQVA 1JWUB 3FUMA 1QNIA 2HPTA 4J3OF 1PYUB 1FZJA 3BFQG 3MACL 1Q4NX 1RUKH 5GZOC 1UA6L 3OXRA 3HKZA 1WD8A 4N2BA 2A6DA 3QIWC 4L1TA 1FFRA 4LPXA 3KXFB 3P4MB 3WHE1 1WZ1L 1ZCRA 3PWVA 3F64A 2J1XA 1E5BA 1T89A 5IJVA 4U7SA 3SDDB 2XPGA 1TJHH 4YUEL 2MCPL 5AW5B 4NO2A 5EULV 5AWNL 2BNUB 2B9AA 2KI8A 4JR9L 3DSNB 2WCSA 4RQQA 3WL9B 1E6JH 4YDLB 2GEQA 1VFAA 3FHQA 4RIRA 4ZO7A 3MJ8A 2X2YA 4X9GA 5D93B 4KZDH 5GXBB 2H3NA 2H6OA 4XCFL 1BAWA 1WA2X 1IFHL 3RL2B 3OKNA 4L18A 4X7CC 3UO8B 1RFDH 3U0TB 4Y4KB 2EDBA 4KY1H 1I31A 3W3BA 1AXTL 1JHTA 1SBSL 2ARJQ 5DA4A 2A6KB 4PFEA 1D5RA 5AQ0A 1I8LC 1KPRA 4P5TA 4WTWA 1J48A 4WWKC 3VFVB 3M1BA 5JIQA 3W2DL 2L4OA 1J88A 1FCCA 1DO5A 1RXLA 1SGKA 1TZHA 1FNFA 1DBAL 4HIHB 4N3UA 4ORZC 5D1XB 1NGPL 5FA3A 1ZHNA 3W56A 2RHEA 4G3YH 5FGRA 2CLZA 1NTDA 4JHAL 1NQBA 2ZTBA 4HOWA 4RWYL 5E6ID 4NAMA 3L8QA 3VJ6A 4N1HB 3JTTB 1JMZA 5IHUH 2AMGA 4PV9A 2IH3B 4NKOA 2IDUA 3MRQA 3H9SA 3Q8AA 4UV7L 1HYRC 4A7TA 1IV8A 4NHCL 5C8JA 4AEIH 5FYJL 4A2GA 2X88A 1UZGA 3R06B 2M2DA 4HZLA 4OVUA 3KYNA 5EO9A 4ES9A 2DV6A 5EZIL 2DWEA 3MKKA 4LQFL 5JOPE 5K33A 4S2SB 2E27H 3IGAB 1N26A 4FG2A 3DMMD 1L0XA 4IEFB 3NFPB 2NX5D 1HHGB 1KCVH 5CXPA 4MX7B 4Z3JA 4FG0A 3I84A 5IIEB 3D4GA 1KGUA 2VLKB 3BGMA 4FXKB 4L1SA 4C8XA 3NJIA 2BCKB 5DHVB 1NCHA 2A74B 1KJ2L 2HFEB 4GG6B 5L2KA 3MRCA 4FQXD 5GZOA 2GIYA 2D0GA 3NJKA 3I02B 4PPTA 4GI9A 1XR9A 2DM3A 3B7YA 3QIWA 3AU0A 3GBNL 4XN5A 1WZLA 4UT6A 3WNOA 1ODUA 1WUZA 3D18A 3IDNB 1RURH 3QDJB 4NM4H 5FO9B 3VU2A 4G6AD 1CF8H 3NZ8B 1VZGA 4HS3A 3UG3A 3EJYC 4F15B 2UZXB 3CCHA 3GXFA 3L3HB 5JHBA 4MNQD 1CLYL 1IBDA 3UYRL 3HIZA 5EZLA 3VE0A 1PYWA 1TYRA 1S8DB 3Q6FB 3O3EB 3V6ZA 3ZHKA 2V37A 1WWAX 3CFTA 2WLMA 3OX8A 3C2AL 4X42A 5J6HA 4HXAL 1F0LA 2GSGA 3C5JB 5IBLD 3V0VA 5LLIC 4NO0A 3H3KA 4YHML 3VWKB 1NOAA 4ZQTA 2W07A 2WINB 3CZLA 4XP4H 4DHLA 1RMFL 2H2SC 3ABMB 4H13C 2WANA 1I8LA 5JNYB 4PJGE 3TO2A 1UWGH 4WWKA 1L0PA 3C6LD 2CM5A 2V8MA 3HPJB 4NQCE 1AZVA 4TPRL 1BVZA 4H1LB 2XWZA 4NQVA 4ELMB 4AQOA 1YN7B 3QJZA 4PJ8C 3ZT6A 1WAEA 2I32A 2NY4D 5B38B 5IHLB 4AQAA 3HCVA 5J6GA 2XUWA 4AKQA 2XZCH 1FO0B 4G7VH 5AKTA 1ZE3H 4S11A 3C08H 3QNYB 1CFSB 4LLVA 4JLRA 1DQLH 2V3FA 4ODVL 3U7WL 1BD2E 4OIIL 3JT2A 1DCEA 3SGEI 1IT9L 1C16A 3ZYOA 3O41B 2XNAB 5LXGL 2ADIB 1R3IL 1C5BL 4AGOA 1N6QL 5AB9A 4FGMA 3OGCB 1E27B 5C08D 5MENA 5TDPB 1V7MH 1MY7A 4QRSA 4JRXD 1T6VN 3JV0A 5I0DA 2AQQA 3K6NA 2XIDA 1KYDA 4U3SB 1ET8A 2HG0A 5E5UB 5IFHL 3HAEH 5D1ZD 4XPBH 1D9KC 1MRDL 1U8OA 1JV5B 2OSLB 3QQ4B 4AX3A 2IDQA 3BAEL 4BQCA 5JYLA 2EYTB 2X42A 1V3LA 5D2LA 1OGAE 1URIA 3FFDA 4N9OB 5BZZA 1WE5A 3IDYC 2QVMA 4LCWE 1DUYA 1LP9B 1TFPA 2ZKHL 2BM3A 4R4NC 1JRHL 3IMRA 3D87B 4A7VA 4QRTA 4NQSB 1O5DT 1NFDE 2ZYHA 5AG8A 1SMAA 3HR5B 1AFVL 1WEJL 2NQ3A 2G3NA 4F20A 4E68A 1DQQA 3TF7C 3K91A 1UWXH 3VI4A 1R5IB 4PJ6A 4WQOA 5EF0A 5CHNA 4AW7A 1OAYL 4DGVH 4P9HC 1QFOA 5CCKL 1O6TA 2NY7H 4ZFQA 3U1QA 2BJML 4MMXC 1X9UA 4M29A 4ZFZB 4AGNA 3T2NL 5DXWA 3TJHD 1UHVA 2ADGB 2R2EB 4G5AA 1OGPA 3WN5C 2D03H 3AC0A 2CDEB 5IMOB 3LIZL 4AYSA 1JVOA 3ZDZB 5GGSB 3ARPA 4CN1A 1ET5A 4MJID 4RVBA 3U7AA 2Y4SA 3FU7A 4Z7UB 4PGZA 4XWGL 2XWXA 3BEVB 4YDJB 1VLXA 3QULA 3CJJA 5IMKB 2OLDA 5F89B 1KIUA 3RPKA 4PJ8A 5DZPA 5AENA 4A04A 2Z91B 3NSDA 1VDGA 3RBSA 1RUKL 3SGJC 1D5MB 1OB1B 1YLBB 4GIAA 4JDTL 5C1BA 4Z5RB 4TRPL 2EXSA 4L3EE 4WJG3 6CGTA 3PXLA 1LDPL 4NZTL 5T8IA 5I8CB 5T33H 3NACH 1V54B 1VEMA 3MNVA 5E8PB 4MXVF 3K6IA 3QORC 4K8RL 3KYAA 1AMXA 1YNLL 2D2OA 3AITA 4E9RA 4KROD 1KTBA 3VFRB 1XTLA 1SFHA 2XIIA 1NMCB 2AV7A 4KTEL 2NUTA 2HZHA 1QSZA 2HRLA 3LZNA 3VXMD 4AYID 1EUTA 3UTTA 1D9KA 5IWLC 3D06A 5AVSB 3B2XA 5F9OL 1FBIH 1GIGH 4Q6IA 2NZ9C 2XTJC 1OCWH 3SULA 3D85A 5DHYA 3TPUA 5DO2C 5GSVA 1XXDC 1Q9WB 2R0KL 4TLKA 2FTAA 2XA8L 1MWAH 3KW7A 3LQAL 3EGDB 3IB4A 2A9AA 4MMYB 4ABQA 5L9DH 1FH2A 1B4RA 3RVXC 5LG1A 4YK4C 1HNGA 4FCHA 5GRUH 1E6OL 2Y7NA 4W9DC 3UBXB 3BAJA 3NP4A 4ZW6A 4YL9A 4G3YL 1PMYA 4WDIA 2O61A 3LEXA 4G6MH 1IJNA 4F7EA 1HHKA 1SN5A 5JHLL 3MLVL 4FKHA 2RMNA 1A7PL 3DUUB 3FN0H 1HHHA 2JA5A 4AEIL 1KXTA 1HCVA 2CBPA 2QBWA 4MMXA 1ONQA 1BW8A 1EZVY 3F6LA 4XI5D 4U1LB 5CNHA 2X0WA 3FOMB 4LBEA 3MRLA 3WN5A 2Y6SC 4E2OA 2VW7A 3QUKB 3ZMRA 1TWCA 3QQ9C 3FMGH 4DGYL 3K6SA 4MMZB 4K73A 2QADC 4UOW0 4PTUB 5E9DD 4L37A 1G7JB 3RVVC 4FHBD 3UADA 2CKBB 1GYCA 3EUUA 5FCSH 1INQA 4E0RB 4YBHA 3SGEH 4ELDA 3DA0A 2VLME 4XNZB 1HKFA 2XZAH 3EJCA 4K3JH 4E9SA 4KNSA 1MH5A 4MXQC 3GXMA 1FGNL 1D7BA 1UM4L 4HLEA 1RJCA 2AK1L 5LBSA 5BZDB 2BVEA 1HD5A 1BAFH 1BQUA 1FFNA 3D39D 4GS7B 3S97C 1N3NB 1V7NH 4PBVC 1GAFL 3FRUB 5JW4R 1UHDA 3CF2A 1P4IH 3CH1A 4M7LT 4EBQH 2QSQA 1CF8L 5IESH 5D7JD 3WEOA 4HC1H 4UMSA 4Q9QH 5C0CD 3QORA 3SDYL 1RV6X 1FIGH 3BE1L 2WB1A 4WEBH 2CGYA 5EPPA 5T5NG 1MFUA 3PQYE 4KUZH 3OC5A 4WAFA 4Z0BH 2AP2A 3TN0B 3QNZA 4F24A 3ARGD 2A68D 4E9XA 2AJVL 2R2HB 1JVLA 4IRJD 2HJLB 2J55A 2NY6B 2OW7A 2WK2A 2X89A 2OYMA 4HK3N 3DOSA 2AEPH 3CMGA 5I75B 1G7LA 2RQEA 4LDLB 3TEUA 4NKMA 5LBVA 5IWLA 5DYOA 4J3OH 2Q6WB 15C8H 3FTWA 4CRZA 2DKUA 2DM7A 5LWYH 4P46B 4YDKL 4B9KC 2CJUL 4R96A 3QRFM 1QLEH 5G5DA 5SWZE 4AZ8B 2BY3A 3T1FA 3LIUA 5CJ5A 3QZPA 5DJ8A 4B50A 1QEXA 3ZW3A 1UD3A 2YSSA 3CZNA 4XPFH 5B8CA 3IU3A 5I0YA 4WI8A 3ZY7A 4ODBD 1FNSL 4WY7H 1NOLA 2MQ3A 2AEQL 5CR8A 5KAQG 1OW0C 4LP8A 5IQ7H 5BVPH 5JLZA 4Z7NE 3MOQA 4ZDHB 1MI5E 4O5LH 3ZE1B 1MCHA 1RZJL 2YAFA 4ZMYA 1COBA 4BZ1L 3T6QC 1ZT4A 1T1WB 4ZPVB 3QNXB 2W95A 4M7LL 4NFCA 3OJDB 3EH1A 2F1AA 4UT6H 3MOAL 4Z78A 5JXAH 5FGSA 1ZA6B 4L4VB 3RWIA 1MFAL 4PG9B 1E28B 2ZCHH 3L4ZA 4NC1E 4S10A 4D9LL 4XN9A 3BN9D 3DX9A 1CIUA 5AFAA 1IKNC 2H1PL 3T3PE 4MNGB 4N2LA 1CICB 4DZ8A 3CQZA 3P77B 4YDIH 4KVPA 1A6TA 3BSZL 4L29A 3BH4A 3T6XA 2D3LA 2W9LA 3DTXB 3W82A 4IBVA 4JDVA 4M5SA 1U58B 4PRPA 4W9GC 1IGJA 1EMTL 2E7BA 5DZOA 4ICXA 3AQDA 4Z7IA 3ALWA 3O3BA 3BEWA 5ID0B 3HE6C 5I2IA 4TQEH 3HG5A 4P2OD 2I7SA 2Z7YA 1SZNA 1ADWA 1AE6L 3RIAK 1ED3A 1BQHB 2AVGA 5GS0L 2AK4D 3W0WB 5GGVY 4PJCB 3ZU8A 5D5ME 1DVTA 1UWEH 2W88A 3WFDH 5JA9A 5EOQH 1TG8A 1KJVA 2NY7L 4GG8B 1OGAB 5EU5A 3BH9B 2WN3A 4U6VH 5GGUA 3L4CA 3ARDD 2OMWA 2CG9X 1KACB 3F8UB 4WO4D 5BRZB 3PJSA 3S8GB 4X6EA 4IBZA 2CH8A 3FTGA 4PJGF 3QHTC 1U0QA 5IBUB 3NZSA 4LLWA 1Q9KB 3KZ8A 1H8OA 3BI9X 3L3DA 4XVTL 3ULVC 3NIFE 5JW5A 2F74B 3OB0K 4JG1L 2XFXB 2NLJA 1OW0A 2H3XC 4HV8A 4MA8L 3IKKA 2VDQH 1X5IA 4YPGA 3CZSA 4QHKI 5KVDE 1HIML 2BNRB 3WNIA 1HEJC 3ILDA 3GTMA 4L4JA 4J8RA 1X5LA 4KMQA 4UB0L 5T33L 3I6GB 1EHLH 4JFQB 4OCWL 1SXCA 1RL1A 3L1FA 2Z31B 2HFGH 1DDTA 3EHBD 2IAMB 5EC2A 4U0RC 2BINA 2JKRM 3L13A 1OF2B 1NANI 2P5EE 3WXVH 4MRBA 2AW2A 2Y3AA 5D7LD 3DXAE 3NDYE 2XRAH 3NEEA 4KNTA 1F8TL 4S1SH 5JXEC 5E4OA 2PW1A 1A0QL 3I6LE 5GRWA 2OZ4A 4X4ME 3S3DB 4FI8A 1GIGL 2FDBP 1EZUA 1OY3B 2VR8A 3HFMH 4GPVA 4YAQB 2P42B 5MEQA 1O75A 2OQJA 1X5HA 4HEMA 4FQJH 4D94A 5D6DC 1FIEA 2BWDA 3ULSA 4UINL 3A4EA 3HE6A 4YNYA 4LCYA 1ITCA 4Y2OA 1LYQA 3DGCR 2X2JA 1TJMA 1Y0LB 2EC9U 1DQJB 2P28B 4KX8A 4CN4A 5EEYA 1EHNA 2FJHB 1MW3A 4P5KA 2X4SB 3GK8H 4MQTB 3HB3D 3GMNB 3LKOB 5KYYA 3TT3L 2ZP8A 5EBLB 3AQZA 3ETBF 3HBGA 5L8KB 1IVTA 4WKXA 3VX0A 1T2JA 2D31A 4JHZA 5I5MA 2XBZA 4Y7OC 2G5DA 5DUML 5DJ2A 5AKSA 3VVVA 2DBLH 4CVZB 1BQKA 2F15A 4D0DB 2FO1A 5AOKA 1UFGA 3B56A 4WV1B 4P4KA 4X7TA 4EO5A 3BLPX 5GISH 3VWJD 1ZD6A 3VXUE 5FYKU 1H3UA 1F11B 4P23B 4L05A 2A4EA 4R4FH 1GHFH 4TLSA 3DJRA 3TIEA 4A2MA 3N85H 1UYWH 2R93A 1NGYB 2JJVA 4F91B 2FHFA 3PNWA 3VG0L 4U1IB 3H0TB 2IDSA 1G7MA 1S7QB 4DT2A 4HHAA 2LW3A 3GZQA 1ZXQA 3PWUB 4QTHB 3BGFB 3C5XA 4LF3A 2FO8A 4H5SB 1JGLL 1MAMH 1H5BC 1M2OA 1J0YA 1HX0A 1NGZA 3JVGC 5EOCJ 5FM5M 5J5EA 3VYPA 5C0AB 4PS3A 3LX9A 3LDBB 3NABL 3GBML 3JTSA 4LQ1A 1N67A 1HXYB 1NGWA 1A4AA 2H45A 3DJTA 2KPWA 1W0WA 1L4IA 2EIEA 5DD3H 2R2BA 1J7VR 4ODXA 1JNNH 4RFEB 4J27A 3ATFA 4JFXA 3MJWA 3O6FD 1S3SA 4WW1A 3VD1A 3DV6A 3MA7B 3FB7A 4ZAKC 5BW7C 4JG9A 3CLEH 5JXEA 4E9WA 5I1LA 1G7IA 2NW2B 1CE6B 3GUFA 4NEHB 4R90H 1E2WA 1QFWM 1NDGB 3GSVB 5FHAL 2BRRL 4ZUWB 4AGQA 4P9HH 2R0LL 4AI7A 3EBGA 2EDDA 2AQTA 5F1IB 2JI2A 1TYJA 4N8CH 4KRPB 3OB8A 5D6DA 4HK0B 1MREH 2R56H 1BWMA 4WJ5B 4LL4A 1DUZB 1VFBB 4OT1H 2Q86A 1GGYA 4N9GB 5T5FA 4FMVA 4ZTOH 4Y5YB 5I28A 4WUUA 2I9LA 4K3DL 2JQAA 1A7RH 4L8DB 4GKZA 5I73C 5JIKA 25C8L 1N64H 1QHQA 2JF1A 5IQ7L 1IGYA 4KK5C 1H6TA 1PZCA 5CSZB 4O5LL 4J8QA 4P3DA 2WLIA 3CFEA 5C9KA 3EYFB 5C0ND 1IGFL 5SWZB 5LBSH 2ZT9C 1IM9A 4P5TD 4QRRE 5GGVL 2F18A 1U3YA 1OAUL 1YZZA 2IWGA 5C0BA 3KPLB 3NFSH 4BHUA 4EZLA 2Y7OA 2UV3A 2J57A 3FQUA 1OCCB 2OA9A 2X28A 2OR9L 4MDJA 2C9VA 3P0YH 4NRZB 4AONB 2AEWA 2F7PA 3OMAB 5AVUB 2V5RA 3RP1A 3TBSB 1QLRB 4HCIA 2BVYA 2HG5B 1WJ3A 4YL4A 2JK5A 3GYRA 4J3OD 1UB6B 2EQDA 4M61A 3MOBH 3FB8A 4Z7WE 5E00B 1N0XL 2DWDB 3V4UL 1NANH 2MSPA 4B97A 1YVLA 1IAII 3QZWA 1I1AB 5EIIA 1XSOA 2XJKA 4YHLH 1H5BA 3JVGA 5DD5H 3CSFA 3T65B 5TF1L 4JP7A 4KVCH 4IDJH 5E1IA 5E5MA 3K2UH 3APNA 1D5IL 4R7DB 1H3PH 5AB2A 4XOEA 5BOZG 2OJ1A 2IH1B 1DSWA 1FLTX 2JKWA 3RU8H 3T4YB 4MCYA 4BH7B 3IGFA 3QWZA 5HYSA 4OM1L 3MLRL 4CKQA 4AENB 2JJWA 2YWZA 5EOQL 1WIOA 5F7MC 4ALAH 1IL1A 1RD6A 5GZOD 1KGCD 4H8QA 5CINL 4ZAKA 5BW7A 2CK0L 4JG0L 2QKSA 2HRPH 1BBDL 3QIWD 3EO0B 1BOGB 1TO4A 1OPOA 32C2A 4H8PA 3T4AC 3CFDA 1MQ8A 4GAAA 4HKZA 3TL5A 1NIBA 2Z64C 4Z18A 2X4TA 2Z1PA 1OZUA 4FQIH 1NKOA 5HGBA 3BKYL 4I4WB 1JERA 5J12B 1IGTA 3WJJC 5CCGE 2XV3A 3O45A 1BEYH 4BDVA 2NVYA 3GI8H 4PIRF 4YFEA 2G9HB 1SEQH 1JN6A 5DZJA 5E1AA 2Q8BL 2WVSA 5JHDE 4DN3L 5I18H 3KHQA 3OAZH 3TZVC 1RUPL 4NO0D 3GSWA 4RBPH 1IKOP 2FLRT 4MHHI 5LAXB 2J5LB 4GRWE 4PS4H 2AFNA 2IG2H 2YUZA 4HIJA 3WFEL 1FL3B 2ZUTA 3ZL4L 3MRBA 5IB2B 3FUKA 3O2DA 3HBPA 1MW0A 4Y4HB 5JPNC 4WWKD 2G5BB 4MCZB 3UJJH 2L7UA 2Z8VC 3SE9H 2HCZX 2CNYA 2X12A 3O2VL 5EV7A 2VDMB 2VJXA 5E4AA 5AW1B 3HLAB 5CMAA 1NCIA 3I3EA 4NAJA 1F6AA 3BP7B 3NCBB 5ECGA 3L1OH 4WFFD 3T3PF 1S9WB 3ES6A 1OVZA 2H2PC 2XRAL 3SPCA 2IPTH 3ZE2F 3NPSC 3GLEA 2AV1A 3AB0C 2XICA 5FW8A 3HFML 2FH6A 1GJUA 1EXHA 3DX4A 3M7OA 1MFEL 4WJKB 2BIQA 4FG6D 4W9ZA 4JJ5B 4AG4H 1HI6A 3AMLA 3WLBB 2BFGA 1XCTA 5BOPA 4EIUA 2NPLX 3HI6H 4Z77A 1I8MB 4P4RB 1HQ4A 1AANA 2XWRA 2X2IA 2SEBA 3U36B 5MEND 4YSTA 1QDNA 1BVOA 2OMUA 2PWFA 1A4KA 4PJ5E 4JY4A 4HIXL 1EXUB 3U9PL 3UTSE 1ZSDA 3V5DB 3QFGA 3TXAA 1MCQA 2IWFA 5D5MF 3DIFA 4NFBA 4PRNA 3LAFA 3K5RA 1M1XA 1Z3RA 1RP8A 5EO0B 4RAHA 5DQJA 3Q2CA 2DLFH 2NCEA 4ABUA 2OX5A 4OLWL 1CYXA 1YYML 2R9HC 3MV8E 3T4AA 4BHUI 3HS0A 1JXDA 3FCGA 2NNAB 3E7JA 5GM9A 1L7IL 1V8HA 2JIPA 4PLNC 5ICYA 3BT2H 1RP9A 3LKQB 5J06A 1MRFL 2ZWSA 4Q6KA 4LLDB 4QY8B 3CZJA 4B3EA 1OM3H 3WJJA 4E9LA 4PWGA 3ILEA 1UHEA 2EDXA 2JA6A 4CVWA 4HBCH 1ZK5A 4K94C 5DGRA 2EDHA 1WZAA 4H0LC 4P2RE 1S2EA 4R97C 3WMSA 5D8JL 4NC0B 4NUQA 3NIFF 1U41A 2GIMA 4B9ZA 3RJOA 1ZC1A 3TZVA 2V7HB 3O4OB 4IBUA 4GAYB 4KI5C 4Y16A 1OK8A 1SHMA 2C4FU 2JJTC 1J10A 2EDWA 2OZ4H 4G8GD 3KPPA 5LNDA 2X2UA 4AC4A 1G9MC 4PV8B 1J86A 2YPVA 2H2SD 5JPNA 4KDWA 5IB3A 2VAAB 4HIIB 5DHEA 1IAIH 4OF3A 3VQ2C 4I0KA 4JFEA 2P80A 5DD3L 5E6UB 3IT8D 3FW6A 4LCUA 2QMJA 1JNNL 1J8HA 3I3DA 5TD4A 4BYHA 4X6FA 4FABH 4MNHB 3LY6A 3F65A 2PPCA 2JKNA 3R8BB 1SXNA 3CLEL 4R90L 1NC4A 4Y1AE 1CVSC 4N4YB 1TWFA 1XF5A 3NA9L 1PG7X 4N8CL 5K1NA 4FQCL 2UY6B 2Q8AL 3SO3B 3KCPA 3PWPD 1G8KA 4FQHA 3BHBA 1XCXA 5D1QC 4JZNA 4JN1H 3MLZH 4XC1H 3QE5A 2Z8RA 6PAZA 5BRQA 5IY5B 3UTTD 4BA0A 1D9KD 3T0DA 1KUMA 4KO5A 4FXGA 4XE0A 1RIHL 3BVXA 4HWBL 5HVFB 4DKAA 2XBTA 2FT6A 4YSAA 1ET7A 1GYWA 2A2QT 3ULVH 1JWSB 4Z3FA 2C7UA 1UD6A 4E5XG 3GHBL 1BG9A 2G30A 5B7MA 5MEPA 5AD0A 1BZ9A 5HHQB 1IAOB 1NIAA 5HYJE 5AVZB 4HGWB 3KLDA 3RA7H 3P0YL 5IFJB 1WRFA 2Z92A 5INCA 3QJHA 3EG9B 4WW2F 3HC3H 3RGVC 1HSAA 5I71B 3FO2B 4K5PA 4AIZA 3FOLA 3NQIA 5PCYA 2VQ1A 3OKYA 1JXFA 1F4XH 5C7XH 1UCTA 3WNJA 1HAUA 5FTNA 5I76B 1BLNB 3Q43A 4G8EA 1IAKB 1PCSA 1WG3A 4TUKL 1LO0H 2E9JA 5A2AA 2JJTA 4KVCL 1JXKA 4IDJL 3TURA 2PYEB 1OM9A 4NIYE 3K71B 4FNRA 3D4CA 5D4IA 4GINA 1PG7H 4PJ7F 3SYOA 1AH1A 5DT1H 3INOA 5I8EA 3E9TA 4TS6A 1AQDA 2IFFH 2VLRA 1THAA 3EGSA 4PRIE 4POZC 3RU8L 1J1XH 3FF7A 4UMGA 3D0AA 3HZKB 3PL6B 5E8EA 3P9MA 5A7BA 1S7UB 1X5XA 3KWVA 2D7QA 4WEMB 5T5FH 5I6KA 4R2GD 2Z7ZA 4GW4B 1SVZA 3BPNC 1K6QH 2EECA 3HVDA 2FSEA 2WLNA 3T0WA 4KZCA 3S0PA 5E23A 3JV4B 3VXQB 1MCKA 1T0MB 3KWWB 1ZJBA 3SJVB 1LQBC 4JFFA 1C12A 1TTGA 3R18A 3D3VB 2WW8A 2ZG3A 4JZJB 3QORD 5HGGS 3MRFA 5IVZB 1EPFA 1BEYL 5AAPA 2XWCA 3SDAA 4AH2B 1KIQA 2R1XA 5D1QA 3KBEA 3R7RA 4RZCB 3RY6C 5CD5C 5ESAA 2C9QA 1BVKB 4AYMC 1LTXA 3ARVA 2WLLB 5E2WH 2X89D 4U0QB 4MD4B 5I18L 2AQ3A 3AJ7A 5HPMB 1Q1JL 5F3FA 4IIQC 1UH2A 5C0JB 1I9JH 2ZOOA 5IQ9B 3L3JB 5KANI 1OARH 3BIAX 2NZ9D 2XTJD 3KDPB 4LESA 4U1HB 4XMXA 4ZS6C 1JZ8A 1OF0A 1JHLL 3QDMD 5DO2D 3EYUL 2OMZA 1MELA 5KUKA 1OK0A 3AS0A 3TBVA 1EAOA 2OP4L 2XWTB 3VXNB 4F8NA 1A7NL 2QV4A 4U1KB 2LABA 3RVXD 2HSIA 2UWEE 1WTLA 4N28A 1FHGA 2NQDA 4B5ZA 4PJ7A 4LU5H 1ZEAH 3KPSB 3IJYB 1ZGLA 4CC1A 2AJZB 4GSDL 3AAZA 4BSWA 3W11D 4HA1A 1IGCL 1OT2A 4HD5A 3L54A 2I26N 2XA3A 4ETQB 3PV6A 1VPOH 4FTDA 3RGVA 4ZUTB 1OPGL 2BP0A 2E7DA 1DP0A 3HZVB 4GAJH 4DN4L 5IQNA 1BF8A 1MRCL 3O3DB 2R4SL 3QO1A 4GEJA 5T5MD 4Z7WF 3KLLA 1TPXC 1J8KA 5ICZA 2Q3AA 2MHAA 2X0UA 3MV7A 5DK2A 2VNCA 4AEHL 4NN7B 1CZ8H 4UIKL 3ZTDC 3LHPH 4QYOA 3QQ9D 4ZFOL 3VXTA 2QADD 1T0OA 5D71L 4RGND 3B2DC 2HH0H 2CXKA 1RZGA 3F58H 2DQUH 2IGLA 4X4ZA 3BW9A 2A9DA 5FUOH 3UC0L 3WFHA 4JVWA 2YD1A 2ZSWA 2E56A 4G8FA 3GM8A 1IZJA 4X4XB 2HTKD 5FPIA 4DVBB 4JPQA 4OZ4B 5L0QC 3LNHA 2APXA 3FAWA 2A1WL 3F7VB 2AQNA 5FIEA 3ZKQD 4PRPD 3UEZA 1KFGA 1F3JA 1NFAA 4WFHD 3BWAA 3CK0H 3QBTB 1X9RA 2QGEA 3KPRB 3ML8A 3MTXA 1PEZA 4JE0A 3UGXA 1EDQA 4WFEE 1LO5A 2BOCB 3KPQB 4LSSL 4UF7C 3BT2L 5FV1L 4PJ5B 3O2DH 2RA1A 1YAZA 3LV3B 4EEEA 2VDRB 4AOKB 3O8XC 2WIIA 3D69A 3G6JE 4OLXH 4U1JA 5AOJA 3LNIA 5K9KB 4KXCA 3MV9E 3RWHB 4NYLA 5IBTH 4TNVF 5AW7B 1MCWW 4KJWC 5D4QA 4IIQA 5FAAA 5C07E 3V0DA 3N06B 1PIGA 1Y1DA 3EFOA 5HHOE 1VC3B 5CUSL 4GRWF 3GMRA 4MZ3A 43C9A 4XHJD 2OL3A 3ILQC 4Y5VC 3QWOA 5D7IA 3SGDI 1SUHA 3RPIB 5A2JH 3W5MA 1ZIAA 1H6FA 3AXLB 3QDGA 1Q9LA 1F86A 4XNQA 2I85A 4P2RB 4DEPB 4JO3H 2CO7A 4LIQE 2VKWA 1RZ7L 5ALBL 3LKNA 4B7LA 3MNWA 1NGXA 5HHPB 4DP1X 1U21A 5A3IC 3OLGA 3DPBB 3HG1E 4XNMB 3WIIL 2XC8A 3QEGH 2VXSH 2B39A 2QHRL 4FHJA 2WLKA 2O5NA 3WUWG 4M6NH 2LTQC 4XX5A 4PJAB 2KZWA 1QRNB 1SRDA 3AUVA 2DMGA 2M8XA 1F3DH 2BP5M 4H2CA 3X3GL 1WZKA 3L6FB 1Y6NR 4DO4A 2VLLA 2O6FA 5E2TH 3VSQA 5DRNA 3X2LA 1AS6A 3KM2A 1I53A 3HNVH 3W37A 3HNSL 3D30A 4RESB 2LT9A 1N59B 1AO7A 5F7KC 4OM0H 3AM8A 4GXVL 4AT6A 3QUYB 1OTSD 4HWEH 5L8JB 5ELIA 1GCYA 5TDOB 4UT9L 5DUPL 3ISYA 1WBYB 3O4LE 3M07A 3L3IA 2C9SA 3OR6A 2AVFA 4JZOB 1R33A 2BRQA 4PLKD 4U49A 3PGCB 5D7SH 2MTAA 3HE6D 4PW9A 1HSBB 2X9YA 1JGEB 3P2DA 4M02A 3GD1C 3UPAA 3O5AA 3HW7A 3C75A 4NQEB 3W5NA 1DVXA 2YPVH 4LVNB 3CVDA 2HFFA 4BQBA 1N19A 3L48A 4NQCD 5HDRA 2F53A 3CU7A 1Q9OA 3O8XA 4KMTL 5JIDA 1CFBA 3FQNA 1JGVH 1ZT7A 3FHEA 4JPIB 3RX7A 4Z95L 4IGBB 1F4XL 2R1YB 1YJDH 5EU7C 1BJ1J 4GO8A 3SPVA 3K2IA 4LAQH 2NY1B 5F2FA 1I7RB 4YE4H 3EOYG 4EUPB 3T2PA 2XWBA 4XMZA 1LO0L 5AEAA 3O11B 1VKXA 1BD2D 1W0YT 4P4KD 3NG5A 3CSYA 1UADC 1Y1WA 3V5HA 3IF1B 3RWFA 2VUKA 2ROXA 3FQRB 4ZXBB 3F12B 2E6QA 4Y5VA 1QR4A 3V6OC 2G3MA 1C1EH 5KOVC 3KPMA 4WFGD 4ZUVB 4AC2A 5B39A 1FZOB 4P2QB 4NO5B 3LKSA 2FO4A 2HT2C 4U33A 1UOKA 1T1XA 3B8SA 3G6AB 2X4OB 3GIZL 3LSOA 4HMCA 5C0RH 5C70A 1F42A 3VFWA 4CKVX 3ULVD 4ZZFA 3ZZ1A 1S5IL 3C9NA 1PYQA 2DD8H 2A0LC 2DQIH 4NENB 3NUKA 4NT6B 2BMKB 1DCLA 1UOLA 2FEDC 3NCYS 5AUMA 4XCYB 4DKEL 5IB5A 1F5WA 5DD1H 2EDRA 3SE4C 1A1MB 2QT6A 1YY8A 4KQ4L 3RNQA 4AQ1A 3UPRB 1KCBA 4K7PX 4OZHF 3DSFL 4KVNL 2HA1A 4FTVE 4OI9A 5FGBC 5GLFA 1SLUA 1K5NA 4QYAA 4TQPA 2NY2D 5E2WL 5CEXA 1UVQB 4R5VA 4F7CA 3ZE0B 2E9IA 2DQJH 3FCSB 5IMMB 4ZSOA 1JK8A 2APWA 2FYVA 5EB9A 3MJ7B 1WGVA 2WXHA 5DS8A 4LOUD 5CEYA 4LLYB 1D5ZA 3HC4L 5I1HH 5T1MB 1H15B 3WY2A 4C4KO 2OULB 1FFQA 5E99H 1YPZA 4LU5L 1KEGL 3BPCA 3FQYA 4GQRA 1G9MH 2ZUVA 2ICWI 3QJRB 4WUUD 5CBAB 1KJ2B 3SDDC 4LRIC 5IF0B 1W72B 4AUYA 2Q87A 1IAMA 3SGDH 4B96A 4ZTPL 3TA3B 3V7AE 3D07A 4YHZL 1QFUL 4D9RE 4G5ZL 5E2VH 4FFVC 4YDLC 5JR1L 3AS1A 2V7NA 2J72A 4UQ9A 3RNKB 4G9FB 1IM9D 3FU3A 5TTRA 2OSYA 3KD4A 5C0BD 3LHPL 3NGBB 1SF5A 2B1OA 2W0FA 4Y4KC 2HH0L 1XAUA 2EILB 2IDFA 4NQDB 1WGOA 4OZHA 5HI3C 3V6OA 5GIRB 4QD2E 3VGDA 1Z0MA 1KPUB 1KT2A 3I85A 4K7PH 4ZQKA 3VH8A 4GW1A 1AGEB 2HAZA 4RZKA 3O0RH 4HQQH 5D1XC 3ZGHA 5HDQL 1U8HB 1WC7B 5FM8A 2FYYB 2BOBA 2OBGA 4BA8A 3QP3A 4FE9A 4WZ9A 4XBEH 5BO1L 3T8XB 3ALPA 4PRHE 3TNNA 2OK0L 4K5OA 1NCUA 1MNUL 3RWEB 4TSAH 3S35X 1ZHLB 1NL0H 1KDJA 2M1KA 2XT1B 3SE4A 3O2DL 3MMEA 3U82B 3K8LA 3PABA 3R4DA 3ZHFA 3E8UL 3BUQA 5CLZA 3WELA 3RZWA 3HMWL 4HPOH 5FGBA 4TN9A 3PWNB 3REVB 4LKCA 1J9SA 4MLSA 1JDDA 1KLFA 1GMEA 1DR9A 4OUUA 2XWDA 4TUJB 1F41A 4F33A 1JUFB 4N0UB 1RSFA 1YRKA 4FXKC 2DLHA 1JGDA 1TEFA 4X9FA 5FFGA 1EAPB 1JWUA 3PGFL 1FNLA 2G2RB 1UOWA 2J6EA 4PY8I 4BXVA 1O0VA 2EVHA 2QEJA 4Q8BA 4HKJB 5FTLA 2GBVA 3KXFA 3P4MA 4TMPA 4HJUA 4O00A 2PJHB 3LMJL 5TE6L 1L5GB 1R3JA 2AJUL 4PSPA 5DZNA 4F15C 3SDDA 4LRIA 4WCYH 5CN1A 3S5LG 3Q9PA 3HU2A 4KK5D 3OAUH 4RRPM 2VRAA 1BIHA 2BNUA 2VZVA 3DSNA 3WL9A 3GTVA 2DDQH 4A7QA 2C4XA 4F1SA 1WISA 3OKKB 2VXSL 3QEGL 4E41E 4ACTA 3BOVA 1DFBL 4RDBA 1U6AH 1R0AL 5TK4A 1FJ1B 3RL2A 1XV8A 2VDLL 3U0TA 5BQDA 4Y4KA 3VWKC 4DVRL 4Z3IA 1QNZL 4OGYL 3TYFB 1KIRB 1NCGA 2A6KA 2ZUWA 5IZ7A 2VXTH 3VFVA 3QHZL 2BW5A 3HNVL 3WSQH 1VACB 2EACA 3A67H 1KN2H 3NIDE 4YIQB 2GJ6E 3AWEA 4HIHA 1BYPA 5D1XA 5KYUA 1CIDA 5IHWA 4EDWH 4QHMB 5FOJA 3WEXB 4FQQB 3DBXB 1Z9LA 5ABDE 4XTRC 3INUL 5KVEE 3JTTA 2OM5A 4OZFB 4PJBB 1OAKL 3RILA 3NESA 1OIOA 2IH3A 1S5HB 1U8JB 3BDXA 4R0LB 1J1PL 1OCZB 1OSPH 2ZCKH 1AS7A 2F8OA 1IKFL 2OFQA 2OL3H 1U3HD 1CDCA 4XP1L 5CLTA 1HEHC 1T80A 5H35B 3SD2A 4PJFB 2UY7B 1JGVL 4O58H 3G6JF 3N9GH 2G0KA 2D7NA 4M6MH 3RDJA 5FX3A 2O5ZH 3ETSA 3CVHL 1NCWH 1SXBA 3DROB 4HHWA 4S2SA 3IGAA 3P0VH 2ARWA 4IEFA 1HNYA 3NFPA 1CDUA 1HHGA 1MI5D 1EV2E 4MX7A 1IC7L 3K8KA 5D7EA 4EAEA 3MYZA 5IIEA 1LE9B 2BC4B 1AQHA 1YQVH 4FXKA 4MAYD 1G9NL 5CEZH 2BCKA 5DHVA 2ZF8A 5KW9H 4UTAA 1EANA 2A74A 2HFEA 4GG6A 1M05B 5I0XA 3BUBA 4NNYB 2AJ3B 3HI1B 2E9WA 3R1GH 4XMKH 5SWQB 1C1EL 2C3XA 3I02A 3TO4B 3ARQA 3ARSA 1FFPB 4HT1H 4G80B 3CIAA 5HJGA 5C6TL 1P5UB 3PHSA 3IDNA 3QCTH 3QDJA 5E6ZA 5FO9A 4AK2A 1DMSA 3NZ8A 2UZXA 4IM8A 3EBAA 3L3HA 3GRWA 4HUUA 3GLAA 2EXWC 5I9QB 3S36X 4NP4H 4Y16D 4PGEB 4RA0C 1XVSA 4KQ0A 4PJHE 4MA3B 2ZWKA 1S8DA 1J0ZA 3Q6FA 3O3EA 2CNZA 1HKLL 1UUSA 2RH0A 3FFCB 2FUTA 1FZKB 1Q72H 3C5JA 4JFED 2QGBA 2YS4A 1DTUA 4ZMLA 5HI4D 1J8HD 1B0GB 1LP9F 1R24B 2WINA 1F6LL 1U93B 5JNYA 2C9PA 4EN3B 4GRLB 2EEDA 1EEYB 2R7EB 2FGWH 1MJ8H 3WY3A 4ONHB 2H2PD 3CAFA 2HWZL 3ET9F 5DURB 1NC4D 3HPJA 4K94L 3V6FB 1S3KH 5A6IA 2VOTA 4H1LA 2FGZA 1Z9MA 1YN7A 5B38A 1XGZA 5CGTA 4A37A 2KL6A 1NOFA 3K6FA 1QR1B 1FO0A 5ITBL 4WGVB 1HXKA 3QNYA 2EEOB 1CFSA 1ZTXH 3QQ3B 5J0BA 5FKAA 3O6ML 4CSTA 3WIAA 1DBKH 4IMKC 3JXAA 3OPUA 1EJOH 4XVUC 3OWEA 1TJGH 2EDQA 4KKBC 5BV7L 1TSRA 4KAQH 1R75A 2WJ7A 3O41A 2XNAA 2ADIA 5F8RC 3OGCA 4Z7UF 1E27A 4PHZA 2HLFC 2IC2A 5LHDA 4JANB 5TDPA 3UIZA 5MERA 1JTPA 1GGBL 1MCOH 3S36H 2DM2A 2R9HD 4U3SA 4XPGL 3H7BB 3UZVB 4CW1B 1AZNA 2AHIA 3QQ4A 2OSLA 1XGYL 3D2UB 4I48B 3T5WA 1M2VB 2EYTA 5DU7A 3LXAA 4XVJH 3K6DA 3BVNB 4KU1A 4PYHA 2FE0A 3F7QA 3MO1B 1EJ8A 2VDNH 4N20A 1LP9A 4Y19E 1UT1A 1ZV2A 3RJQB 2HKFH 2K9UA 3S3JA 1PFCA 1TDQA 4OZGE 4HQQL 4NQSA 4ODTH 2IANE 3HR5A 5KSBF 3T0EB 2XN9B 3KPOB 4FYRA 5D2NE 4ONGL 4QRBA 4XBEL 3OHXA 3IDGB 1R5IA 4KI5D 3IRCA 1MLCB 4HUMB 5JW4N 1HH9B 3A21A 2P8LB 3PWLB 4TSAL 3IKCA 3JYCA 2A9CA 3SE3C 2D9QB 3DVGB 5GRJH 4ZFZA 4OLVL 2ADGA 2R2EA 2OMTB 2VLRD 2K6WA 2KKQA 2CDEA 5IMOA 3BO8B 9CGTA 4H40A 4MMZC 1LNUB 5GGSA 2YUVA 4HKXB 5IK3B 2PUQT 2EEBA 2QPFA 3N44B 4Z7UA 2VJ8A 3DUSB 3SO5A 4I2XB 3KMDA 2OCJA 1LEKB 5KBNC 1NBVL 3B6SB 4XNZC 1E3XA 3BEVA 4YDJA 3UEQA 5HTSA 4HCRA 5IMKA 5F89A 4LCIH 5C0EB 2BZCA 2Z91A 3HBZA 3N55A 4JFFD 5JOFB 3DYOA 5C3IA 2B8OT 2VABB 4U4IA 3OPZL 3II2A 9PCYA 1D5MA 1OB1A 4GS7C 4L5FE 3N3EA 3FULA 3I50L 4Z5RA 5DEGB 4DGWC 2FJGB 3SDAD 5SWSB 1YMMB 4TTDC 2IPUG 5D1QD 5IVOA 5I8CA 4PCSA 1KCRL 4X5WB 1GL4B 2EXYC 4QPEA 3SIKA 3EADA 2HVBA 3WY4A 1MF2H 2VXUH 5E8PA 3KBHE 5ABAA 2WCGA 3EFDH 5IB1A 2GSIB 3QFDB 5DD0H 5KSBA 3TN0C 3VFRA 1CYWA 1AY1H 1VSCA 4YXHH 2DDQL 3UTPE 3MXVH 1KELH 2PETA 4NGHL 2NY6C 1IJ9A 1UZ6E 2AZAA 3A5VA 5I75C 3F7KA 3ZTJH 1FA4A 2YA1A 1I3UA 2ADFL 1ZLVH 3TIWA 2G5RA 5AW6B 2R69L 3BRGC 1HL5A 2F61A 1P7QB 4P46C 3UL4A 4AGPA 1MPAL 4N22A 1TJIH 1Q9WA 4UZGA 4WU5B 3V0WH 7CGTA 3QEQB 4TULH 5KN5B 3RGVD 3BAKA 3EGDA 4MMYA 5ADPL 1PFOA 5B4MC 5L8LB 1KN2L 2XYCA 3RIKA 1O9VA 3U7YH 3UBXA 3S88H 5ANMB 5F7EL 2RCSH 4CDHA 2DWSA 3FSVA 5DJDB 4F7TB 3MV7D 1DYZA 2CR0A 4I0PB 2D3VA 5IM7B 3DUUA 5HYIA 2B1AH 3SE3A 4JFYB 1DLHA 4KZ0A 5I17B 5DZLA 2J6EH 2CMRL 4U1LA 2OTPA 3CWGA 4PP1D 3FOMA 4UV4L 3PAUA 4GSRA 3GXDA 4UYQA 3QUKA 4UU9B 1L9OA 4MMZA 3V0HA 1I82A 3N9GL 1M6OB 3Q9QA 4F2MB 3MRGB 4S0HA 4ZOEA 4X9YA 2V5TA 4PTUA 4WF7A 1G7JA 4OTXH 1RUQH 2CKBA 4IJ3C 3ILPB 2Y07H 4E0RA 4AZDA 4Z6AT 1M7UA 3NSCA 5CZVH 1SXAA 1CICC 3EIFA 2J43A 3RI5K 5TH2B 5IFAH 3MJ9A 3GZOA 3QRGH 4F8LA 5BZDA 4FQPA 1C5DB 3CFKB 1I8IB 3SYPA 3GC3A 1N3NA 3Q1SL 5FYLL 5AYTA 3SPJA 4CL7A 3FRUA 4RAUB 1PL3A 5F97E 2DQMA 5IQOA 2EH8L 3VFTB 1QTPA 5CD5D 3M8OL 4JUTA 1P4UA 3MLSH 3EDKA 2YRBA 3TBBA 4YEFA 4YQXH 1WHOA 2F54E 3WFZA 3RZCB 4CVXB 3KJ6L 2ZUXA 1OGSA 5AW3B 4IOIB 2V4LA 2BS8A 1TVDA 2X1PA 3TN0A 1QSFB 1RZ8B 4A7UA 2AJXL 5IEKB 1KB9K 2R2HA 1NM4A 2HJLA 5FR3A 3FKUS 4DWHA 5ADOL 1W6WA 2LLNA 4FNPA 3VD5A 5AVRB 1Q72L 5BNXD 2X6AA 5DLML 3QDGD 2Q6WA 4HCFA 4QKXB 2EC9T 1A3RH 4MA7H 3EBHA 4P46A 3DMRA 3GINA 5LQBL 5DVKA 4AZ8A 3IDXH 2XYBA 1EHAA 2WWKO 4XPAL 5G55A 1OWRM 3NIDF 3C8HA 1ZA3B 5CEZD 1J5HA 1BM7A 3D12B 2XWEA 4KDLA 1HFUA 2I07B 2ZUYA 4BEIA 5DVMA 1ID2A 5K69A 1WP6A 4PJDB 1BXUA 3PAYA 3BPLB 2VR3A 1AIFB 2WBWB 3GB7B 2OCFD 1Z3GH 1YQ2A 4F7MB 3HS9A 4ZDHA 2MFNA 5LVEA 5DHVH 5I19L 3UERA 3BVTA 1URLA 2Y1VA 2ZP0T 4TLTA 3SE8L 4UTAH 1RU9H 4GUQA 1ASOA 3QCUL 3ZQWA 1T1WA 3UJTH 1OGTB 3OTTA 4ZPVA 3QNXA 2Z31C 3OJDA 4UM8B 3V0FA 4NZFA 2IAMC 1RIUH 3KYOB 2C3WA 1ZLEA 5SV3A 3MRJB 2PLTA 3MRIB 4L4VA 1HDMB 4PG9A 1E28A 3RHWK 1YEKL 4ZW8A 3GRWH 1AJ7H 1ZRUA 4MNGA 3P77A 3GDCA 1XWVA 5HHNB 4AK1A 2ZKWA 4AIOA 5B1BB 1BF2A 4NCDA 5ICXB 3DTXA 2I27N 2YPLE 4AQZA 3QW9A 1U58A 1CVRA 2OJEB 3DNKA 5DYIA 3NRFA 1XB3A 3O8XD 2VDPL 4O2EB 2F5BL 2YD2A 4A63A 3UBXI 4F58L 4LEXL 5ID0A 4NFDA 2X1QA 4DK3A 5CAYB 4U2ZA 4TVPE 3K6OA 5DFTA 1RVFH 1BF5A 1I7TB 2BE5D 1BQHA 1KTJA 4KDIA 1YSOA 2W80C 4JPKL 3W0WA 4KJWD 4PJCA 5MEOB 2CALA 3KLAB 4OF6A 2PNWA 1KDIA 4PJHF 1E4HA 4H1LH 4PYGA 1G0DA 1JGUH 5GRJL 4GG8A 3ULUC 3MLPA 2X53A 1OGAA 4KQ3L 3U6RB 3ILQD 5FYKL 4JW3A 4J28A 5T3ZL 3BH9A 3BYTA 1EAJA 3KH3A 4ANUA 1FO0H 1T5XB 2R29L 3QVAA 1A47A 1GPOL 3F62A 3HUJE 3CBRA 4MLIA 5F6HJ 4B7IA 3CPUA 1MHPH 1WV7T 3AMKA 4JDEB 2J73A 5BRZA 3NEXA 3U2IA 2IBZX 1KBGL 4P23C 5I16B 3ZDXB 1S7SB 3E6HB 3MBXL 4N85A 1Q9KA 2NYYC 5FGCE 2O6DA 5A3ID 2HT3C 5J89A 1JD9A 3K3QA 3MN8A 3O2WL 3HI5L 1BM3H 3IE9A 7FABL 3RWCB 3TVMB 2A9MH 2F74A 3BGFC 2XFXA 1DQDH 5KVFL 2NYZA 1RJLB 2JKJA 3D7PA 4Z7VE 2DIJA 2K6ZA 4D9QD 2BNRA 4XAKD 1N5YL 2X2HA 5HHVL 5HXMA 2NT1A 3LDBC 3L95B 4WSGA 3IAGC 3I6GA 1SYSB 4JFQA 2JELH 1CR9L 5GJSL 3EFDL 1HOEA 2Z31A 1BQ5A 2FEEL 3ZVVA 5J57B 4PN6A 2IAMA 2C1PB 4DQAA 2WZ6A 5LCVA 2BIIA 2LLLA 3BSGA 1OF2A 5T1DL 5FA4B 3HPLB 3IJHB 5GRXG 4OLUL 1NGQL 3LB6C 1NKGA 4LL1A 4WNSA 4IKKA 4MCNA 3MODL 2ED9A 4HUWA 1IM3B 3PXJA 1INDH 5LN4A 3MNMA 1R4XA 4G7SB 3C60B 4FD0A 3IRZA 1QFHA 4XN2A 4YZWA 1A6UH 1XD0A 1U36A 5D7HA 5E8DL 1Y6KR 4JO8A 4ZFGH 1K8DB 3DK2A 4QWWC 5INDB 1TF4A 2YEZB 1ACZA 3ARUA 4OZGF 2RCSL 5CR1A 5GS1C 1DBBH 4Y5YC 1Y0LA 1CPUA 1DQJA 4U7MA 1DJWA 5ESQB 5HDBE 2WGXA 1T7WA 1XT5A 4Y2DB 2FJHA 2EVJA 3V5KB 2X4SA 2UZIL 3GMNA 3LKOA 2YJLA 4HCRH 3BZDA 5EBLA 5DRWB 3K74B 1J0KA 1A4JB 3B2VL 1FG2B 2C9XA 3EYQD 4EXPX 4M5ZH 1W8EA 3MLUH 2VC2H 3AG4B 3L5HA 2E4TA 5K59E 1I3GL 2FX8H 4CVZA 2HT2D 1EHKB 5ALCL 1FWXA 3E38A 4WV1A 4NOFA 3EGXB 3HTLX 4FXTA 4ADJA 1YEFH 1F11A 1WBZB 4P23A 2Y07L 1UTDA 1XGQB 5AW8B 3GTPA 3PFQA 3QC5X 3THML 3BKJH 1NGYA 4RSYA 3V0JA 3EZ8A 4U1IA 3H0TA 1BOYA 2YKKA 1S7QA 1FG9C 1PTZA 2ZOTA 3HNTH 1RH8A 3PWUA 5IFAL 3VAEA 4DFHA 4QTHA 3E2HB 1VFUA 4J2XA 4XNUH 3ESMA 1I1AC 2F6AA 5HYJD 2JB5H 4H5SA 4H8WH 1RI8A 5C0AA 2FJSA 4FFWC 2DLGA 5DA0B 1XF2B 3MLSL 4JCMA 1AMYA 1CG9B 1QABA 2ADJA 1GGCH 1HXYA 2FIKB 4GP8B 4XC3L 5LGHL 2WLZA 5T5NF 4LRNH 4Y0GA 4U6XB 5TQ2L 2Y7QB 4RFEA 5TF0A 4DP7X 1LEGB 3ML9A 3MA7A 3IU4H 2PICA 1S9YB 3APMA 3K81A 4K3EL 2Y72A 1FDLL 4QGTA 5EU6E 3HRZB 1UZ6F 3QWQB 5C71A 3B2UC 2F8VA 2NW2A 1CE6A 3KXFD 2MTPA 4NUJB 1NDGA 3GSVA 4WK4B 5EA0H 4ZUWA 3B5GA 4YEEA 4PRID 4GQ9H 1R7RA 5F1IA 3GEWB 3SDDD 3MXWH 3EKCA 5J12C 2IMNA 4HK0A 2BHUA 3AQYA 1MCPL 1QW8A 4WJ5A 1CK0H 1DUZA 1VFBA 1BBJB 1F90L 4FFVD 4NKQB 4DKFH 4X6CE 4N9GA 2BFVL 4HJJL 2UUDH 4Y5YA 4FI6A 4MJ4A 2CKBH 3ALXA 5KAQF 4QHLB 4NPJA 4L8DA 4HUKB 4YHOH 5CSZA 5K9JH 2J5LC 4Y4KD 2BZ7A 1WIPA 2OW6A 3EYFA 3MJ9H 3TS8A 5HI3D 4BFRA 1HZLA 1KGWA 1G7HB 3KPLA 3NZUA 1RIUL 1NPJA 4R3SB 1E2ZA 1G7QB 4S1RL 5D1XD 1D2PA 2DQTL 2O4EA 4NRZA 1GGTA 3TBSA 5E6RB 3JWNE 4DUVA 1KEML 1QLRA 2C4FT 1AJ7L 2HG5A 1OAZH 5LDSA 3BZ5A 2WQSA 2QMKA 2ENPA 3IDYB 3ESUF 2DYPB 1UB6A 3IM1A 4DESA 2CJ3A 4PQXA 5E00A 3F01A 2YHGA 2DWDA 4OCSH 5C0IB 2YA0A 3N91A 3GTQA 2YC1B 2F7IA 1FDOA 4N90E 1I1AA 4IBTA 1SHXA 3K2KA 2Q9OA 3P0GB 3QI9B 1MSPA 3T65A 2WUCL 4L0YA 2YD5A 2I24N 3GTOA 3B7SA 5EU4B 4ANVA 5I15L 4U31A 4R7DA 4V2BA 1A4CA 3TH3T 1T6BX 1R17A 2E0PA 2IH1A 4BH7A 3T4YA 3MCKA 3MLWH 4HF5H 2AXGB 4Q0XH 4KHTH 1UACH 3ZHNA 1SFOA 4AENA 4HISA 2AI0H 1A6VL 3S8FB 3FB6B 1PQEA 1W8NA 4PJEE 4DW2H 4IBWA 3MGAA 1JGUL 1J9RA 4P9ML 5HVGB 1NMAL 3UYPB 1N7MH 1JZ2A 3F85A 1GSKA 4ZM7A 3EO0A 1YDPB 3U2SB 3HC0B 5KYXB 1USQA 5C92A 4DP5X 3QDJD 3FJTA 3UTQB 3CDGB 2YIHA 4I4WA 1SLXA 1NM9A 3A22A 4P3WA 3FL7A 4PU2A 1OAXL 1BFSA 1MLBB 2G9HA 5C09B 5DJAB 3SKJH 1ZOXA 3JSSA 3ZGIA 1QLFB 1NLDL 3VFGH 5B3NA 3L5WB 1BM3L 1KXVA 1MZZA 1UFUA 4NZUH 2A9ML 4PTTB 4MYPA 4XN1A 5KVGE 3RTQB 4WFED 1DQDL 3O4OC 1BZ8A 3PYCA 1IAIM 5D7KD 3TEZA 1UASA 4AXWB 2IDCA 4K23H 4JFUA 4ZTEA 2J5WA 3KJ4B 3EH2A 4MCZA 1JOIA 3PLYA 3LZLA 3GTTA 2KQNA 4PVNA 4M1CD 4N8UA 1K8IB 3HLAA 4Z7QB 3QZWG 4OI8A 3BP7A 4ISVB 1IBFA 1ILSA 4J6RL 4XTRD 5T1JA 1S9WA 1EU1A 1DBJL 3GO1L 2Z8SA 3OD3A 1KN4H 1M9WA 2APBA 3CSPA 3IN0A 1GTNA 1INDL 4MVBC 1BFOB 5KYNA 1S7XB 4FLRA 2ATKB 4NNPL 1A1NB 1D5BB 2P5WB 3OLEA 4JJ5A 1FUNA 3WLBA 5HYSG 1WWBX 5T1KB 2B0SL 5DQDH 2RACA 2W92A 4ZFGL 4UNIA 1I8MA 4P4RA 4G42B 2YXFA 4ZYKB 3U36A 2NX5E 5L4MA 1DBBL 3M46A 3OXSB 5E56A 1CE1H 1EXUA 3I3BA 4NNXB 3V5DA 4X5XB 1SEBB 3VFPB 4GKOA 3CC1A 1AC6A 4KXAA 5FCUH 3DHUA 4FZ8L 1XF3B 1DQML 5EO0A 2J8UE 1O5PA 4WI5A 3GSRB 2JB6B 1BMGA 5GGQH 3S8WA 3A3YB 4LEBA 4IDLA 2NNAA 1Z9SB 5HHXL 1P9MC 4MNQE 1YG9A 3OAZK 5GRYA 1YEFL 3LKQA 3NJMA 4OQTA 3QUML 4QY8A 4XO3A 2W1NA 1DVYA 4LLDA 4RBPK 5GRVL 2WQAA 5HDBB 5I71C 2VPYA 3HU1A 5LCVH 2H0EA 1XH2A 2VAJA 3MKGA 5IQLA 2WLHA 3JQOB 3MROB 1OOWA 3ZZLA 2EVFA 4XNUL 5IVXB 3NYKA 2CIKB 2V7HA 3MRNB 3TEYA 4GAYA 1JFQH 2ZD0A 4RMTA 4FC3E 4JX0A 1CL7H 4OH2A 4XXWA 2VDKL 1DVFB 2XPZA 3L5IA 2EIJB 3N1PC 4PV8A 1VA9A 4KZEH 1I50A 3SDXE 4HIIA 4AAYA 4LRNL 1WYJA 2W9EL 4URTB 4UNUA 5G4OA 3N41F 2NVXA 1MY5A 4FL4B 4YSRA 1FLRL 2BVQB 3PL6C 5I0ZA 1QI3A 4YDZA 1BVNP 4I1NB 5I24A 1GC1L 1DL7H 2W38A 3VXSB 5HI5D 3S5YA 1B4JL 1FYTB 3JV6A 1C08A 1HHJB 2Z4QB 4I13B 1KULA 3GKZA 3ULUH 1ACYH 4FCAA 3BJLA 1CU4L 4JZJC 5C08E 3MXWL 1XO8A 2UY6A 4YSCA 3EJJX 1YEGL 5C7ZA 4PJXE 1HQRB 3S3BB 1CK0L 4JRXE 1PLGL 2V2WB 3ZDWA 1RZFH 4KODA 5KBMA 5TK2A 1GMIA 3WKYA 1EO8L 2YFOA 3RUGB 1G6RB 1J8SA 4ELKB 5TDNB 4XPTL 5K9JL 1KB9J 4W9FC 3QYNA 1MJUL 2VO8A 2R15A 4QTFA 1JWSA 5M95B 1MFDH 3GS7A 3ECVA 3GBDA 2XVLA 1XF4B 4ATWA 2Y3NA 2VUOA 5K59F 4D0CB 5HHQA 1IAOA 4FFYA 3L2MA 1P9MA 2ALWA 4EPSA 3TT1L 3SD5A 4HGWA 3TNMB 4GUOA 2COVD 1RUMH 2R39A 1MCWM 4UDTB 3EG9A 2SODB 4GXFA 5T3XH 4YSUA 1T7VA 1CUOA 1XHHA 3N50A 5LUMA 3FO2A 3POHA 2JKXA 2ICEB 4Z7OE 1R47A 4HETA 4M8RA 2NY0B 4KO7A 3S37X 4OCSL 4HHGA 5I76A 1BLNA 1IAKA 1JGIA 1BDYA 3Q8BA 4M7JH 5HDOA 4MXWL 4MJIE 1QG3A 2PYEA 4AV4A 3K71A 4OSUL 3ZTCC 4CNIB 1KBKA 4QRPE 4U2YA 2ZXEB 1TCMA 4KRLB 3MLWL 2ZOKB 3O3AB 3ZOAA 1ASPA 4EZKA 2HX9A 3HZKA 4KHTL 4X80H 4H25B 4G6FB 2EC8A 1S7UA 2PR4L 4R84A 4GW4A 5IROA 4TLUA 1TCRB 2APVA 3GPSA 3NJHA 2BW4A 3H6JA 1AHMA 3ORJA 3KPNB 4H2AA 1YMHB 2LLGA 3EDJA 3Q2WA 2GK0B 3SCMB 3TM6A 3JV4A 4GAGL 3VXQA 2UYLB 3KWWA 1T0MA 2BVTA 4S1QL 3SJVA 2B59B 4GIPD 2KUTA 6FABH 1JV2B 1KXQE 2EUWA 4XMWA 3MRHB 2EXYD 2Y06H 4ZO6A 5JA8B 3D3VA 3LZFL 4YWGL 4JZJA 2EIZB 2ICCA 5KTEH 5H4UA 1HK6A 5IVZA 4N5EC 4UUJB 5JZ7C 2JE8A 3GS4A 3TN0D 3N42F 4AH2A 1NMBL 4QEGA 4RZCA 2VL5B 4CSPA 1BVKA 3OMNB 4L2YA 3VXME 2WLLA 4N25A 2NY6D 2XLLA 4MD4A 4PRHD 3VD2A 1FC2D 1XGPB 5AZUA 5HPMA 3AY2A 3FNKA 4NRYA 4F57H 3QAZB 3AREB 2CIIB 3FUFA 5DMGC 5I74C 4P2CG 1PD1A 3PS6A 5C0JA 3NN8B 3L3JA 5IQ9A 5JHAA 1RULL 5ISZB 1QHOA 2FBJH 3EOBB 3G5XB 4U1HA 3VM5A 4P46D 3UDWC 1B2WH 3RL1B 3T3ME 1IGMH 1U8KB 3IJSB 4OLEA 1G1CA 1WBXB 1BFVH 2XWTA 2YD7A 4U1KA 4ZS7H 3VXNA 3FTZA 1FAIH 4HOMA 3WTVA 4MAUH 5AKVA 3AGWA 4DERA 1R1CA 4CGUB 1E5UI 3KPSA 2HKAA 3IJYA 5CN3A 4HPHA 5D72H 3CIQA 4K9EC 2AJZA 4DEPC 4TNWF 4JFDB 1QP1A 4ETQA 5I1IH 2PO6B 4CADB 4H0HB 4ZUTA 3D9AL 1T2QL 5IR1B 3HZVA 1E9QB 3WIHL 3T6WA 1X4XA 3NAAH 4KJQD 2EH7L 2H0JA 3O3DA 3SKMB 4OW6A 2VO5A 2ZX6A 2D4DA 5CJBA 4Z3EA 2FATH 3X1EA 3UZQB 1AQKL 4P57B 3V52H 1PKQE 2HYMA 1BMWA 4OD3H 4L4VD 1B6DA 4MQ7B 2MKWA 4IK7A 2Q2EB 3WS3B 3AUWB 1T7XA 7TAAA 2YBRB 4DOHB 2WHVA 1C5CL 4X4XA 1QI5A 4G83A 1HXMB 4OZ4A 4DVBA 4ZMWA 2HLEB 3QUYC 2IMMA 3D39E 3F7VA 4QNPE 1KCWA 2KLSA 3BKCH 2VPWA 3O6KH 1J5OH 2YOAA 3VYOA 2FX9H 3GNMH 3N40P 3KPRA 4R5XA 2C26A 2EICA 4JPWL 4YGVB 3EJQA 2MPAL 1T4KB 1HEZB 1BQSA 2VWEC 1JPSH 3KPQA 4D7BA 2ZOWA 2XKSA 1E90A 2CBTA 1KZQA 1SY6A 1VHPA 4LVNC 3MRKB 3B43A 3LV3A 3W0WD 1G0XA 1GH7A 3IDMB 1JF1B 2GJ6D 1KC5H 4X6BB 3SOBL 1VGKB 1NAKL 5K9KA 2VDMH 3QG7H 4IRZL 2WJ5A 4HPYL 3HZYB 4IGBC 3RWHA 2FQGA 4CJ1A 2NY1C 3HRPA 2W65B 5ID1B 1T4WA 5JDJA 4HUNB 1JFQL 2YXVA 1CL7L 2FLBT 4GQZA 5IJCC 1K72A 4KHXH 3CH8A 3ZRCC 1S9KC 6PCYA 5BRZD 3UDWA 2YXMA 1SN0A 5AYUH 1SDDB 4ZXBC 1W9XA 3VMOA 4P5SA 3RPIA 3TIDB 4YLCA 3OV6A 1N68A 2HLAB 4MS8C 3AXLA 3DGGB 2B08A 2WYZA 3ME0B 4TXVB 1ES0B 4P2RA 1FZMB 1Y1VA 4JCLA 1TR7A 3VRJB 2QVIA 1NCBH 3ROLB 1LVEA 4H7VA 2DQFB 4NSKB 5DJCB 5GS3A 5HHPA 4OZIF 4PJIE 2WP3O 3VSVA 5IUCA 4JGMA 3DPBA 3G6DH 4XNMA 1MG2C 5DHMC 5DR5L 5EO1A 1UQSB 2Z31D 3CN0A 4FN0A 2BSTB 4PJAA 2IAMD 5ESVB 3MSPA 1QRNA 4V1DB 3V4VL 1N4XL 3SQOL 1KCUH 4AYEC 4BK8A 3L6FA 4OLYL 1X3DA 2R2CA 4X5PA 4OQTH 4P3CL 2O93L 2XN1A 2GCYB 1XCQB 4Z1PA 2OYPA 3ZDYB 2JQMA 5FM4A 1N59A 1XH3B 2D7PA 3QUYA 4C83B 1U8PB 4NJ9H 5TDOA 2J8UF 4N2AA 1WBYA 4LSUH 2BHYA 1CFQB 4RCAA 4JZOA 3FO1B 3PGCA 5LKNA 4BWWA 1HSBA 3GZKA 1JGEA 2IH8A 3F7LA 4NHUB 1MNNA 2AK4E 4NQEA 1NWOA 4OCXH 1RUAL 1KY7A 5DEJA 1A8ZA 3SPIA 5E7BA 4L2LA 1BQLL 2WXOA 3CVIH 4NJAH 1PZ5B 4RMVA 4JPIA 3TA3C 1F4HA 1WLHA 1NCJA 2Z0UA 4IGBA 2R1YA 5EUOB 3ULUD 4IMLB 1SLVA 4ZOBA 3D2TA 3GBLA 2V45A 1B4TA 4OF7A 1I7RA 1W2KT 3NFNB 4AW4A 1L7TL 1UB5B 2O5XH 4OLZL 4DP9X 3O11A 5E51A 4ZMTA 3NGBC 2P1YA 3B4NA 2QSCL 2D8KA 2RQ8A 2IBGA 5H94B 3IF1A 3NOIA 4LFHG 4P23D 1YNTB 3FQRA 1E65A 1O7DC 3FH8A 3F12A 2RD0A 4APQC 4ZXBA 1S4IA 3SDXF 4ZUVA 1FZOA 4JP6A 4GY4A 2NYYD 4P2QA 1JZEA 4D3CL 4NQQA 4Z7OB 2HT3D 2DQDH 2JIRA 1Z1WA 3G6AA 2X4OA 2VZSA 2VDLB 2ITDB 3M1CA 1L3WA 3J2PA 1FGVH 1H8SA 5GGTL 3SQRA 4I77L 2L7EA 4ODUB 3FPXA 4NENA 2EE2A 3LRGA 5I5RA 4C56B 4MJIB 4E5XA 1FNEB 2BMKA 4NT6A 5C0AD 1QA9B 4MB3A 4NUGH 4XCYA 4E9QA 5EU3B 5CU5A 3WTUA 1A1MA 3G9VA 5FO7B 1ETJA 5T3XD