2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
molecule tags Cell adhesion
molecule keywords YOAJ
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
4JP7A 3X2MA 3X2NA 3X2JA 4JJOA 5H4UA 3CZBA 2KQAA 4FERA 5GM9A 2AE0X 4FFTA 2HCZX 5GLXA 2G5DA 3FT9A 3X2HA 3ENGA 2PNWA 3M3GA 2GAEA 4JP6A 3SUKA 2PI8A 1N10A 1OA7A 2PICA 2PJJA 4FG4A 3SULA 1OA9A 4JS7A 4AVRA 5GLYA 1BMWA 3X2KA 3X2OA 1BW3A 4ENGA 3X2LA 1WHOA 1WHPA 4FG2A 2JNZA 1WC2A 4L48A 3D30A 3SUJA 4JCWA 2ENGA 4ZM7A 1BW4A 1HD5A 3SUMA 3FT1A 2G6GA 3X2GA 2VXQA 3X2PA 3X2IA 2BH0A 1L8FA
chains in the Genus database with same CATH superfamily
4URTB 4LEOB 3FT2A 3L1OH 1VGKA 2CLRA 5BRZE 4R3SB 3MA9L 4I9XA 4WUUD 1KLFB 1BQLL 3M6DA 4OZFA 1HJCA 1RUKH 1BBJB 3NZSA 2OMBA 4ZW5A 2DL9A 2OSLA 3EW3B 3IFNL 4G42B 2X38A 4ZFGH 5I1EL 2FNBA 2QVMA 1SBBA 2XA8L 5T33L 4LRNH 4FQPA 1TCRB 5J06A 2J21A 4QXUL 2ZUUA 2QPSA 4XVTH 3WNMA 1T3FA 4DF9A 1LO4L 2A9NL 2JA6A 3TTSA 1JV5B 4Z18A 4M1CD 4OQTL 1CU4L 4X0NA 5A2IH 3OAZK 4J39A 1HSBB 3FQTA 3E1F1 3SBWC 3VQ1C 2Q8BL 5E6YA 1ORSB 1A7OL 1UEMA 3BZFB 5KTEH 4U7SA 1W72B 3QISA 5F96H 4O9HH 1IT9L 1JZHA 5CEZL 4P3DA 4M02A 4R7DB 2ICES 1BWWA 1OGSA 1WZ1H 2X2UA 1IAKB 3TFKD 1UKTA 3VH8A 4ZX6A 4O02H 4NEHB 3BD3A 4FQQA 1OGAE 3L3IA 5DFVD 4MA3A 4CDGC 4PJBE 5ENWA 2VRAA 1WGOA 3LZRA 4X7CC 4RDBA 4NQXB 3UTQA 2L0DA 2VNCA 3PHQB 4FABH 2X6VA 2IH3A 4O2EB 4TRPL 4F7MA 5J6HB 4Q89A 4AIZB 3MXVL 4L3CA 5K59E 2E7LC 3JWOL 5IHUH 1MFCH 3RL2A 5D7LB 4UZUA 1WP6A 2HRPH 1VZIA 3P0GB 1U8MA 1V7NH 4MNGA 1RZFH 3CVIL 2Z4QB 4U3SA 3FZUD 2NY6D 1FSKB 3GMRB 3TONA 5FM5O 3AITA 1RP9A 2IBGA 4KVNL 4W9FC 2YXWA 3TV3H 1AO7B 3SGJC 4X6FB 4CW1B 1CFVH 4AEIH 8CGTA 1YYCA 1EU1A 4L8CA 3K91A 3LQZB 1KWGA 1WV7T 2W38A 4NKOA 2R0LL 5KSUA 3ZBMA 4PJAF 2FK9A 3RFRA 3H6JA 3X1GA 2UY7A 3SE4A 4AK2A 1BLNB 1M53A 1Y0LA 2DEYX 4KKLD 5IT2L 4UM9B 4Q9RL 1A6TB 4JAMB 3CLFL 4HULB 5IGXL 4GAJL 3D2TA 3F58L 4N5ED 5T3XE 3D25A 4PLKD 3UC0L 2KZ1B 4LSDA 2H1LM 2GK2A 4FQJL 3OAYK 4Z7QF 1U0QA 4CC4C 5T8IA 4XCFL 3KPPB 1DVYA 4G72B 4KITB 1WZMA 5EEVA 3OR6B 2O6FA 4PCYA 1O0VA 4P05A 5LXGL 3CFUA 3L1EA 4DVRL 3T3MF 2BVPB 4PJEB 4NYLA 3ECWA 3QHFL 4OT1H 2YJLA 4PUBL 4BFIA 3NGBC 3TESA 5E1AA 2GUYA 4JDEB 1XZ0A 3BXNA 5E2WH 4RFOL 4A7GF 1O6TA 4ZS6D 5HP5A 3SPVA 3SQBA 1KEGH 2YZ1A 3BRDA 5BS0A 5E2WL 1MVFA 1MZYA 4NPJA 5AVZB 2R0ZL 3L3KA 4NO3B 5FHAL 3RUGB 2ZP9A 1ZPUA 3RWEA 3MOQA 4LLUA 3IRZA 4HKXA 1SJMA 4OQTH 5DC9B 1UXSB 2D3JA 2ATAA 3UTTE 4R7DA 2Z6FA 4U7KA 6TAAA 3EJSA 5D1XD 3ZOAA 4JHAH 3GEWB 1PIFA 3L16A 1H6TA 3B5TA 2LLNA 1ACYH 1N26A 5C09B 1HESA 3T1FB 2PP9A 1NFDB 1OM9A 2HTKD 1FCCA 1MAJA 3CVCA 3EOYG 3CQZA 4L4VB 4GW5A 2HJLA 4HKJA 4OZFH 5ILTH 2P42B 5CIPA 5IG7B 1G6RL 4N8VG 4LCIL 1LMKA 2AEPH 3S36H 4PS3A 4N2HA 5BS0B 1KLUA 3HPJB 2IGTA 1MCRA 4JO3H 2YUJA 1NUGA 3AREB 3VGDA 3RKPA 2R1XA 4G70B 1MRFL 1PDKA 2DQEH 4PJ8C 4U6HB 4R2GC 4R3SA 3DKHA 2X9ZA 4LNRA 5BS0D 3OR6A 1PZ2A 3TNMA 1MLCB 1EFXA 2OKMA 5DD3H 3T65A 3VFUA 1NBZB 3TH4T 5JXAL 1HXYB 1YNLH 1Z5YD 5I5RA 5F1OB 2J8HA 4W4OA 4OH2A 4J12A 5FS5A 4HEPA 1DFXA 3D0LB 3VD5A 4ALAH 5J13C 4UILL 1BQRA 2XPZA 4F5CE 3FN3A 4KRNA 3T4AA 3QG6B 4G1EA 3C08L 3FSWA 4KX8A 3NRFA 5GJSL 5FYJE 3AWGA 4HQQH 1JJUA 4K23H 2DOCA 1JNJA 2YAFA 3ARDA 4KK5D 1NFKA 2AGJH 3FU7B 1ICTA 2JJUA 1K8IA 1UCTA 2Y1ZA 1XSIA 2J5LB 2OAAA 3BAWA 2FR4B 4U05A 4UOW0 1TFHA 2E9IA 3TT3L 3B9AA 4QRTA 3ZQXA 4GP5B 5FUOL 4MLIA 3MYJB 5K9JH 3UPRB 2B08A 5L8JB 5L4JA 1KJMA 2OMTA 2QTVA 3PUCA 4X6DE 3C12A 3BDYL 3TEUA 3HB3B 3GC3A 5HD8C 4MS8C 2L7EA 5I1HL 4IBZA 2LR4A 2XG5A 1G9MC 2OYMA 3B56A 3QQDB 2XIBA 1AANA 4JK0D 1NOAA 4FQCH 1T0PB 2VABB 1AI1L 2OMWA 1TFPA 2EE0A 2EXWD 3DGGA 1O6SA 4UV4L 4YK4C 4ZPTA 4L1BA 2JKSA 3IN0A 3EADA 1FL5A 3MRPB 4RX4D 3GMPB 2OQJB 5DVNA 3F12B 4L4VE 3KBFA 4P9HH 1ZGLB 1J1XH 2GI7A 3VXMA 1UHVA 3QDJA 3EO1A 3WNPA 4M5SA 4HIHB 1F3JB 2X4OB 5C08D 3W11D 4G80A 4ONGH 1MFEL 1X9UA 3BD4A 1OPGH 4IOFD 1BJMA 3CSPA 4QRUB 4OI7A 2CXGA 2PNDA 2XXFA 3X17A 4KX9A 1HN1A 3GLEA 1P7HL 2Y3NA 2ZOLB 1L5GB 2EJ1A 3QIBB 1QSVA 3K74B 4QRSB 3CZEA 2J7LA 5LN8A 1PT0A 1BVZA 1XH2A 5T5FA 3NFNB 2EZ0C 4P3WA 3SBRA 1D6VL 1YEIL 1IAOA 1H5BA 1IM9D 2LTQC 1UJTA 4I0PA 3RWJA 1GZHC 2ZG2A 4Y19A 1ZVHA 1OLLA 1YAZA 2WCPA 3GLZA 2P5PA 3LPWA 4KWUA 1RJYA 4PRDB 4QRFA 5DYOA 2Y7NA 3I3EA 5DTFB 1MWAL 2EXYD 2OMVB 5EU7E 4JVWA 4DN3H 1NA8A 2RQ8A 5DJXB 2NR6D 4K7PX 5H4YA 2HUEA 1WFIA 2X4NA 3BO8B 3FPYA 5AKRA 5CBAB 1B4JL 1NC2A 4ZFQA 3SE3A 1HL5A 3NOIA 4YHML 1A2YA 3BHBB 3SDAD 3V8OA 1PNCA 4XPBH 1HSAB 3V4PH 4CSSA 5DK2B 3LVTA 2D7OA 4HIEB 1S7SB 4C54A 1I3RA 4AGOA 3DIFA 1P53A 3VGHA 2ZWSA 1RPUA 2D03H 2CO7B 2AK1H 5D2NA 2N0KA 1NMAH 4PJCF 4LU5L 3H2PA 2XVBA 2MEJB 4ZJ9A 2UXVA 3RIFF 1UWFA 3RTQC 4LLUB 4B3VA 4ETYA 4F15C 1KCRH 1B0RA 1UH2A 4XMLH 1BREA 4MMYA 4OW6A 4XHJC 1PLAA 4F2FA 8FABA 1TG8A 1AFVL 4I0PC 1G7JB 4IIZA 1ZTXE 5LG1A 1YEDB 3BAIA 1X5MA 3G9VA 5AALA 5FO2A 3TZVB 1N2RA 3PXLA 5KJ4A 4G7VH 4TQ8A 4GRLA 2WXPA 3FYIB 3QPXL 5JZ7C 1FO0H 2CH8A 1FNFA 3NK4A 4KK5C 4ABWA 1X7QA 1PZAA 3EZJB 3MNDA 4LBEB 3OTTA 5C6TH 1OSYA 3LRSA 1J8KA 2Y07L 3CMOL 3QARA 4AW7A 2QMKA 2BVQA 3WYRA 4F24A 5D4JA 3WI9A 3PIQA 4JFFA 5C7XL 5KBNC 3HR5B 3IF1A 3L3HB 5JR1H 2QKSA 2QSQA 5DD0L 2C3GA 2ZUYA 2A6DA 3ZGHA 4RNRB 4KROC 4LSTH 2W07B 3LD8C 3HW7A 4PJ9C 4YH6A 5DT1H 3FFDB 2G75A 3ZK0A 4DUWA 2RAMA 4DTGH 2V9QA 4M4PA 1TTGA 4FI8A 3JWDC 3KJ4B 3PWPB 4XX5A 1A22B 1J1XL 1KPUB 2EDFA 3SPHA 3L5XH 1Y18A 1S9XB 1RU9H 2QQLL 2IAMD 3OL2A 1XIWB 1F2QA 2ZXGA 1MFDL 4QPEA 1I9RH 1JNHB 1U92A 3MGOA 1J1PH 5EBWB 5JIDA 1ADQA 1MJJB 1AR1C 3AY2A 4BDVA 1UWYA 5JORA 1IGFL 3C09C 1L9OA 1Q72L 3CHSA 3VFRA 3RWFB 4HT1L 2HRLA 5BUAA 1KT2B 3WAKA 1MELA 1YNKH 43CAB 4Z3GA 5D96B 4XCNB 2H32A 1JN6B 1PY9A 3V0VB 2WMPA 4GMSH 3RL2B 3T8XB 4Q9QL 1F6FB 1W0WA 3E2HC 3UO1L 4OFPA 1XXDC 1A1OB 1JHTB 2X6CA 5AZ2H 3KDMB 3W2DH 7FABL 4Q9BA 3NTCL 5I18H 2IQAB 2DTML 4ZUUB 4EOWL 4GMTL 3ZKNC 1CD1A 4JPWL 4LKCB 2OFQA 1KJVA 1S2EA 3FTZA 5DURB 1OB1B 4XP5L 2IH8A 3BVNA 2DTMH 4AVKA 4JM4L 4ZMLA 3L6FA 5JHAA 1JV2A 3P3YA 1PS3A 4NT6B 4PGEA 4HUNB 4UQDA 5A2KH 5GHWL 5C09D 4YHMH 1PVHA 1JL8A 2HJKA 2NSXA 4JG9A 3ARTA 2B3RA 5BRZB 2YSTA 4G3YH 2YQ3A 1V3KA 1HOCB 2V4LA 1ETZB 3B1UA 3TFBA 5GZOD 2BCKB 3WENA 3NCCB 4XB8A 3OF6D 3FB6B 2V8MA 3KXFE 4DVBB 2GK0A 3MLSH 4BEIA 1H3XA 1BZ9A 1DQLL 1P4LB 1NCDL 5MP6L 4PJ8A 1GSMA 3BIBX 2V7HA 2O26U 3LXAA 3VFNA 3LRMA 1A7PL 3T3ME 3QH3B 4NQEA 1A1MA 1O7VA 2X53A 3HVNA 3MC0A 2EINB 3OLEA 4R7LA 4I89A 4X8JB 4RMBA 2VAAB 3N1FC 3DDFA 3U2JA 3N1QC 5CHNA 4TNGA 5CGBA 4JZOA 5F6IC 2HA1A 2XHNA 4LLAA 4N2CA 4NUPA 1M7IB 4IGBB 1RZIA 4HZAA 1MI5D 5AB9A 2N56A 5JDSB 1OTUC 4UINL 5D1QA 1MRCH 1R6VA 1N5AA 1H5NA 1SMOA 1AZUA 1L3NA 5FKPA 1I8KA 4GQRA 5E9DB 1ZLWK 2ZG3A 4OGQC 3SO3C 3UIZA 1BLIA 2IAMC 4A66A 3WTYA 2Z0UA 1U3ZA 2IANB 3N43F 2OCJA 2ZKHL 4XGZB 2VMJA 4UT6A 2VGLM 4PJIA 3B2UC 2J1XA 3L4VA 1NGWA 3EJRA 3U7AA 2DH2A 1XVSA 3BUBA 3O81A 5LXVA 1H19A 3ESUF 3PQYE 3V4PL 2WVUA 5KSBF 2RFXA 2E27H 1Y1WA 4M6OL 3GXMA 5DYOB 5E9DE 1MW0A 4D9RD 5CLZA 1BMWA 4JHAL 1OO2A 5F7DB 1E50A 1NCGA 2EEDA 1NCIA 3CNKA 4X99A 5HVWA 1KIPA 1F5WA 2G5BB 4KRPB 3ALXA 1KELL 3GPSA 2JIXD 5DMGC 5BW7A 1YYML 4R9HA 4QKXB 4JY4B 4JPIB 4OV6F 4YIQB 1CIDA 1OP3H 1RKRA 3DPBA 4NRXB 3IDNB 3N41F 4HAFA 4OZHB 4NQCD 4ZOBA 1GS8A 2ED6A 1M2VB 1CURA 4BD4A 1PF3A 4PHZA 5GGSA 1T1WA 3B8YA 1H6FA 3IDJA 3TBSB 4FGMA 3GZPA 1JSYA 2BW4A 2VL4A 1J5OL 2K6YA 1TWAA 1DN0B 4BH7A 3VFVB 1U8IA 3EJZD 2XWJB 2EIKB 4MZ2A 5I15H 2OCFD 3B7TA 3H6AA 4U1SB 1SHSA 2ZF9A 4P23C 1PNDA 3AG1B 5C0GB 2VC2L 2P5ED 1K4CA 1F45A 1ZXQA 3E3QE 4ZDHB 1KENL 4KNQA 3ZUCA 4RGMB 4UT7L 1DN2A 4GO9A 3P2BA 2A99A 2XG4A 1QUNA 1MSPA 4HFWA 3CLEL 4CKQA 3CQQA 3PFQA 5FA3B 3WIHH 2X4SA 1IKFH 5D1XE 4R97C 3H85A 3TH3T 2FT6A 1I8IB 3KMDA 1WA2X 2C45A 1P1ZA 4ODXA 4E68A 3J27A 1IUZA 1AGFA 1XGYH 2QQNH 4GSDH 4QHMA 3FO9A 1I9IH 1ZS2A 5JA9A 1M1XB 5MERB 1KCLA 5FM8A 4IGBA 2IH1B 2DLFL 2AEPL 4MRBA 3X2QB 1N2RB 4MJJA 4CBPA 4WQOA 4B41A 4KHXH 4L3ED 1UA6L 3OR7B 3JV4B 1T2JA 4JRWA 4KTDH 2J8UF 3ZQ9A 2PXYA 1HHIB 4LHJB 1HHHA 5FUCC 4IMLA 5B22A 1OKEA 4C4BA 1J48A 2GB2A 4OAWB 2F53E 3TNNB 3HAEA 5KSAC 2VDOB 4R96A 3UDWA 3B4NA 4XPGL 2OMUB 5INCA 3QB7C 2VLLB 3RTQA 4XC3L 1NTDA 5D2LB 4AEHH 5F44A 2NY0D 4HUWB 3F58H 4H1LG 2A9CA 3B5HA 4N0CD 2VLMD 2GTWB 5CINH 1PD6A 4AIEA 1H3WM 2KMWA 2X70A 4HJ0C 3WY3A 2X6MA 1RULH 4OLYL 4F7CB 5KYUB 4F8TA 3WEXA 1UT1A 2ZOWA 2OULB 4GRWB 5EMYA 2PKDA 4LHUG 3ZKND 3OWEA 4UANA 4GG6F 4AE0A 1XGZA 4NO5A 1KCSL 3BVTA 4UM8A 3R8BB 4HKBA 5JOPE 3QP3A 1WHOA 1JVKA 4AG4H 5DJZA 1CZ5A 1KTDB 4NOHA 1ZOXA 3V55A 5MEQA 1UADC 1ZHLA 2A6KA 3C5XA 2E7ZA 1B2YA 2WTOA 1MCOH 5K39A 2OMWB 3OMNB 4LQFL 4WV1B 2B5IC 2H32B 1UXWB 2KZKA 4ODTL 2PWHA 4WJG3 1PKOA 2FJFA 4NM4H 3ZMNA 3MCLH 4A67A 3EFFA 5F3HB 2CRMA 4F2ME 4JMNA 2HAZA 4TSCL 1BZ9B 1P4LA 2BS71 1FP5A 4ODVH 3GMNA 3VXSD 5C6WH 2HFFA 3MNVB 1I8LA 3KXFA 1GZHA 4C58B 4EQ3A 3LN9A 3K8MA 2RBLA 2WXQA 5DMYA 1YQVH 3HMWH 1NPJA 2XQBH 5GS1C 1AMYA 4KX7A 1CF8H 4P5TA 1QFPA 3BGMB 5F1NA 3V0GA 3U36A 3HNVL 4QOKA 5E8NA 4NJAH 4IU3B 4XMWA 5J89A 3J8F7 2CGRL 4ZUWA 4M61A 1U2HA 3MLWH 1KV3A 5KYYA 3SOBL 1VPOH 1WEJH 2YD2A 3RKDD 3WAJA 2A6KB 3QO0B 2BP0A 1NFAA 2CJUL 4K0OA 4ENGA 4ETQA 1A6WL 3CX2A 4KRPC 3FQWA 4DMRA 5EPMB 1G1KA 1OALA 1Z9PA 4K3GA 3ZTNH 1EWHA 3MRMA 1DEEA 5KANG 2VR3A 1I8UA 1OAKL 4PP2B 2C26A 3ES6B 4C55A 4N2AA 1KIRB 4U3SB 3ZKXC 3A0OA 4OF7A 3C8KB 1XAUA 2DDQH 1HJBC 1IAIH 1VACB 1Z9OA 4DVRH 5CR8A 1VKXA 3FO1A 4XBMA 2B14A 1T5KA 1RIUH 1IV8A 3TA3C 2AFNA 5DZLA 5J6HA 1NDGB 2JCCE 4HPOH 15C8L 4ODVL 2CO7A 2D7QA 3MFGB 2Z92A 4PB0L 1RLBA 4S11A 5F96L 2FWOA 1J0KA 3HMXL 3DJSA 3G6JB 3QGVA 1FH5L 2FE0A 1KENH 3AU0A 3SDCC 4ADJA 1JZDC 2G2NA 2W80C 1JPSH 2Q8BH 4KQ0A 1CZ4A 3WIHA 1NKRA 1CG9A 4AQ1A 4YC2C 3S97C 4A39A 3MRKB 4L5FH 3VWKB 3NIDE 5F6HJ 1UC6A 4LOFA 4YFDB 4KODA 1OTSC 1UA3A 3SE9L 4P2OA 1FJ1B 1MW1A 1VPOL 4LIQE 1RFDL 2A0LC 4GRMA 5JA8B 4FQXC 1KCSH 4LBEA 5B8CB 1XV8A 5EF2A 5DD1H 2BSDA 3BJ91 3GSQB 1Q0EA 2VXTL 1BIIB 5TDOA 3FMGL 5CU5A 4R0LA 2OTWB 5BXFA 2A6ED 3U48A 5KYYB 1FYTE 4PLJD 1FGNL 5EZIL 4P2RB 3RY5A 2UYLB 4WWNA 5B3JE 2ZKWA 4B9YA 1T5WA 4UNTA 3MCLL 3LXUX 4IOIA 4BBWA 4TSCH 5I1LB 5TTRA 2B0SH 4ZW8A 4Z7UE 4N2OA 4RSVA 4XWGL 5D7KE 5B7FA 3N85L 1RZJH 1T1ZA 5IT2H 5FTNA 1G7QB 4KVPA 5E2UH 1FNHA 1RSYA 2YQGA 2J5WA 5C07D 3W0WB 4BELD 2FBJH 4Y19D 4IOSD 2X4UB 3Q2WA 2X7LA 1MUJB 3NAAL 3PHOA 1S78C 2I60L 3LZFH 3F3HA 5BZZA 2H2PC 3CG8A 2MSPA 5DC0A 3GTVA 1EH9A 5FW6A 4XBGB 1RURH 3D07A 2FD6L 3QZWG 3CDGA 5KZCB 4ZMWA 3THMH 5ELIA 1U42A 2X1WL 4Y19B 5CEZE 4ES9A 1GGIH 3CFDA 5C07E 3X1EA 2Z3FA 1T83A 4U1IA 1ZVNA 4OZFB 2F7OA 3L08A 1SMDA 5D7KD 5I19H 2AEQH 5IUCA 3CFIC 4JM0A 3NJHA 2XA8H 5T33H 2D31B 3MXWH 4WI8A 1SVBA 2R1WB 5BV7C 1SDDB 4L05A 5EPPA 1A9EB 4XP9L 4H0LC 1A7QL 3HG1E 1UOLA 3TNMB 3L2NA 2H0EA 1FAIL 2ESVD 1DE4B 5GISL 1NFDE 1AP2B 4V2BA 1IGJB 1G7LA 2NUTB 3H56A 1NCAL 2NT0A 3BD5A 2EH7H 4FDWA 5HJ3B 1Z32X 3O9WA 3HZ3A 1BYNA 4NGHL 2VZTA 3LY6A 5EIQA 3UZVB 3S88H 1VESA 5LAXB 2VDNL 1U95B 4JHUA 3DO4A 4KJQC 4QXWA 1M6OB 3DOSA 4UQIM 4WTWA 4LRIA 5C07A 4FHJA 1N64H 4GUCA 3QCVL 3RURA 4PGDB 3HPLA 4NZRL 1YA5A 3ZDXF 4YSSA 1S9YB 1T1YB 5I6LA 4JGUA 3WTUA 5A16A 3OAYH 3T65B 2PWGA 4K9EL 1IC5L 5DHVH 1J5CA 3WJJC 3CBRA 4BQCA 5GGTA 3LV3A 4ODSL 1EDHA 1NICA 4LEXH 4RRPM 1BZ7B 2WXJA 5EO1B 4E9TA 4KK9C 1NFIB 1YLEA 2W9DL 3VH8G 2F8XC 1KTRL 4HBCH 2XZZA 3LNGA 5KAQF 3CPLB 5KVEH 4IIQC 3O2DH 2IH3B 4O2EA 4OFDA 4F7KA 2NRDA 3PAVA 4AYEC 2GY7B 5TF0A 3H53A 2IALB 4LLYA 1AS6A 1U4FA 5LAPA 4QYOB 1RK1B 3S3JA 2X4PB 4EI6B 1KBPA 5CSBA 1K6QH 4AKPA 5FC9A 3FOMB 1WZLA 4PJGA 1E5ZA 4HWBA 5IW1B 3MODH 3AB0C 5C0GA 4TS6A 3U2SB 1MCDA 4FN0A 3LDBC 4AX3A 5L88H 2ZPKH 5CGYC 5B1KA 4XTRD 3MV01 4XZ4A 4L8BA 3QDGD 1G7MB 3F84A 1J1PL 3GJFK 1AKJB 2DLEA 2LU4A 1F58H 4FYTA 4FQXA 3FTYA 4N85A 4PBVC 1W8NA 3UAAA 3VVWA 2JE8A 43CAA 2ZX9A 2OSYA 1RIVL 1CDIA 3N04A 4X6BB 3P9LB 3VMOA 1CXHA 1R24A 1WAEA 1MCHA 4X7DC 4MD0B 2EKJA 3WXWL 3HJEA 4N4YB 3U46A 3GRWL 1GIGH 2FWOB 5BO1L 5HGAB 1JVOA 4M7KH 5D7LE 2VXUL 2D9QB 4UNVA 1A3ZA 4Z5RB 4QR7A 2E4FA 1BYPA 1F4YH 1QDNA 4G7YH 1QI3A 4IKIA 2NXZC 4QF1A 3KWVA 2GIXA 1UCBL 3QQ3B 5A16B 4HLEA 2M1KA 3EBGA 4F7PA 2FECI 3IKKA 1TIUA 5FXCH 1TQBB 4IBLT 2A6IB 4OIBA 3VXMD 4XZUB 1E8XA 4Q58C 5F1SA 5KBMA 4DKAA 4TXVB 4HWEH 5C0RL 3BE1H 5IBUB 3CZFB 2AXGB 1CVRA 4E0RB 3CH1A 4LARH 4MJIE 3ABMB 3VSTA 4PRBA 2CUMA 3FJTA 4JFPB 1FNSH 2NY2B 3REWA 4MSWB 3STZA 1XBRA 2HVJA 4KXAA 1PZDA 1F86A 2IDCA 3HE6C 5AVXB 4UTBH 5IOPA 5C2BL 1FNEA 2IADA 2XFXA 2XV3A 4PGEB 1FFNA 4A2HA 2B20A 4FTDA 8FABB 1V10A 2NY2D 3MOBH 3Q8FA 3FU3A 2IPUK 3VI4F 1S3RA 3VXPA 5FF6A 5EWIL 1MF2H 3MBWA 1H3PH 1ZSHA 4MD4B 3ZXAC 1D6VH 5GGUA 4GKZA 4AV5A 1QSEA 1QWHA 4G9DB 5TDNA 3LS4L 3VWJC 1N7ML 2FIKA 3UJTH 3X3FH 4A7UA 3CJJA 3MLUL 4FCHA 1M56B 3TPKA 4WHYG 1S7SA 3UACA 1FH2A 1K4DA 2H3NB 3PRZA 4M1GH 4X8CA 4E0RA 3A67H 1PT1A 4HUXA 3X2NA 2OZNA 4HS8H 3Q43A 2PTUA 3UPAA 3U6RB 4FFVD 3QDAA 4UDTB 3QUYD 3MN8A 1AQ8A 1OGPA 3IJ7A 3TFKC 3WIAA 3DSFH 4HSAC 4L3EE 4MMYB 4NRZB 3MO1A 4JM2B 3DHPA 3NSJA 4TTDD 1KCWA 4YXLL 3FT4B 4IRZH 5I8KH 5AOZA 2G5BA 32C2A 3V4PA 3PV6A 1U6AH 5DJZB 2JELL 3UTSA 1WPCA 4GAYA 2ZWYA 4RISL 3VTAA 1EHNA 1QBLH 3CXFA 3DUSB 1JG9A 5I8EA 4DKFL 1CR5A 5C08B 3BQVA 4TQEH 4TV3A 5JMRA 4JG5A 1KGIA 1KCRL 2XN9D 4GLRH 2W0PA 4R5XA 3C6SA 1PGRB 4G1MA 3V9FA 2EO9A 1DVFA 4AJ0A 1U8MB 3QCUH 2WP3T 1K4DB 2H3NA 1JGEB 1XTLA 2NW2A 5J1TC 3BZ4A 5HI3C 3DX1A 1EMTH 1O6VA 4HJJL 4JB9L 3WBDA 3O3BB 3WTWA 2NX5B 1RIHH 3BAEH 4FLSA 4IYKA 4TLUA 4U1KB 4ZD3L 5HDBF 1WSST 4BFBD 4FTVE 1PZ5B 4DCQB 2KLSA 2KDYA 3T3PB 1SXAA 1E27A 2H2SC 1IARB 4APXB 3MO1B 3OHXC 4JM2A 2V7NA 4HLZH 3P02A 4BZ1H 5M95B 5I6OA 4GS7C 4PP1D 2ZCKH 3GHEL 3W0WD 4DP2X 1KB5A 1E5BA 2ZOLA 3LIZL 1PFOA 5C9JB 2Y2WA 5HY9B 4ZSOA 4AVRA 1E5YA 1BCIA 3O3DB 3CPLA 4I3RH 1YNLL 2P52A 4QWWC 4YN3A 5JPMA 1WF5A 4QHUA 4Y5YB 4YR6B 3LXCA 1DUZA 5DSCA 2BNUA 3CN1A 3L7EA 1ZT4B 4WNQB 1KLFA 5EU6E 1UH4A 5IJCC 3DYOA 2LLGA 3MBWB 2AS5M 3BP6B 1VGEL 1QSFD 3EYUL 4JY6B 4KI5C 2GUOB 4S1RH 4AJWA 2K8QA 5DJAB 4L5FL 2AZAA 1AD0A 3RA7H 4QJ4B 5JIHA 1YAIA 5K9QG 3HE6D 2MCPH 2H0PA 4XCEB 2UV3A 3WXWH 1E27B 5I2IB 4OZGB 2EDBA 3RL1B 3TT1H 2IOMA 2B3IA 1BZ8A 1NDGA 1QPKA 2E9WA 3K4AA 5GRVL 5C1MB 3P4MB 4DN3L 3Q2VA 3O6LL 3I02A 2I5YL 5JW4Q 3GBEA 1BYOA 2ZWKA 1YECH 4LHUB 2P1YA 4MA8H 3RZCD 4MXVF 4NZTH 5IMKA 4EDXA 3EKCA 4MNHB 1J10A 3O0LA 2M83A 3VW3L 4ORGA 5J3HD 2GW5A 1MPAL 3SQRA 1U2CA 4G6FB 2CW0D 3F6JA 4QIRA 1IX2A 1PG7H 2BNUB 3FCBA 5E99H 2YAHA 1DVXA 5F72S 1OSEA 2QDVA 4N2KA 3RYMA 4G6JH 5D1ZA 3QR0A 4HEME 3VDAA 5C0CD 4Z78A 1YY8A 1U8NA 1UM5H 4QF1B 3SDAA 4XN7A 4ADGA 5I0VA 1CFNA 4NQED 1L0QA 2W0LA 5T5MD 1E30A 1QBAA 4HF5H 1KYOJ 1IM3B 4OZIF 3L4YA 1SVCP 4YLQT 1S7QA 2AJSL 2O5XH 4MWFA 4TTDC 1EHLL 5AVQB 2OZ4A 2WSDA 4XBGA 1AY1L 4BSWA 1J1OH 4OZIE 5B6CA 4KTEL 1SLWA 5I19L 2R4SL 3A24A 5I66A 1C5DB 1F02I 4G8AC 4XGZA 4FG6D 2CLZB 3C5ZC 4JRXB 2HVJB 1ADQL 4NO5B 5HHME 1A14L 1T1ZB 3QQ8A 2KZBA 4H44C 3QPQC 3ZMRA 3AG3B 2AQ3A 4J1UB 2LFEA 4Q6IB 5D1QB 2BWQA 3MBED 1JYXA 1PQZB 4ONFL 3VXPB 2LVCA 1Q1PA 1LO0L 4WI7A 4B0MB 3QUGA 4M5ZH 2WIIB 3MA7A 3S5LG 4GAAA 2JB5H 4F2MA 1KJ2B 1KJ2L 4NKIL 5D1QD 3X1NA 3QG6A 4TUKH 3ZKSD 1JPST 4IU2B 1WIOA 3V7MA 1MEXH 2XC8A 1SEQL 2A3TA 1RURL 1KWKA 5E5LA 4JO4L 1F11B 3ZDXE 3IMUA 4U1SA 5DO8A 1G5AA 1SY6L 1AGDB 4MAYA 2Y72A 2I60H 3DLQR 2WVSA 4LLDB 5AL0A 3VFVA 3UO8B 2AW2A 5AL8A 4XO5A 2FZ3B 1C08A 3ZY7A 4JRXA 3QUMA 1N6QH 4U33A 1TVHB 3MAWA 1RULL 5CEXB 4MCNA 4PJXF 2O6PA 3OC8A 4OZHA 1GGIL 1BJ8A 2GFBB 3OV6A 1K3IA 3POHA 4NT6A 4BXVA 5ICZB 3OKYA 1P7KB 4LSUL 4M6NL 5JXEC 2ENQA 5IMOB 5GRYA 3GRGA 4LSVL 4OGZA 3MRNA 2VB5A 3QULB 4KUCD 3JWDL 1S9VB 2IXQA 1IGCH 1WHPA 4IGBD 4DOHE 3Q8CA 3FBQA 4PRHD 1F4XL 3UYPA 2VXVH 1AIZA 4ZPTB 5IIEA 5IMLA 3QORB 3T8XA 3CVIH 2PCXA 5DZJA 2ZPKL 3RDTD 2CM5A 4PJAB 4XPFH 2YPLE 1JPSL 2RQEA 3ZYOA 3P3SA 4PD4J 3WLBA 1TITA 4OFKA 4WU7A 1DO6A 5HHPA 3VXOB 3FHAA 1RUPL 4ZO7A 1WA0X 1W72L 3BPOB 1MFMA 4NN7C 4X9BA 1CD0A 3TBTB 4HA1A 1JPGA 2HN7A 4GIAA 4OBRA 2Y5QA 2L3BA 2G3ZA 3RBSA 5SWQB 4N2LA 3CCHB 2X88A 1JHKH 2WQUA 2EEXA 2XRAL 3G3LA 4HHAA 2R2BB 1SEQH 3VACA 1X4XA 4A6YL 2D0HA 2VXSL 4L3EA 3DSNA 4MXQD 4ICWA 5F7WC 2WXFA 3WNOA 4P4KB 3ZN6A 3GSRB 1P5UC 5E9NA 3N44B 4FQ2L 5HXMA 4O02L 4KQ3L 4WGWB 1QA9B 1HHGB 4OCMC 4QO1B 3PPSA 5HHNA 2P45B 3ZTJG 4J3OF 3UYPB 3BZEB 3FTGB 4OLWH 2Q7YB 2F7IA 1IBGH 5AOKA 4Z5RA 2PYFA 1A14H 4HX1A 3HRPA 2D2CC 3QDJE 3IMBA 5C0IA 3ULUD 1UACL 2JV6A 4AZUA 1KC5L 4L1TA 2R4RL 1XGQB 2BMKA 2XZQH 4PLJC 4AYID 2PW1B 4X0KA 2A4ZA 4GQZA 3SYPA 2JI2A 2I25N 2YSSA 3GZOA 4MNGE 2Z7YA 2OA9A 4JRYA 3BN9C 5IQ7H 3SKJH 4CSZA 3ULVF 3CHRA 5DJDB 3IETB 3UTZB 1XGTB 4JZNA 2XQBL 4XC1L 5E9DA 2Z8RA 5LDSA 3OKKA 5IFJB 4MAYB 1KYUA 3MV8E 2F7QA 4L8SA 1A47A 1IAIM 4I5BA 1EGJH 4KKAD 3BP7B 2WINA 2X09A 3SDDA 1AD9A 2OMZA 4A2EA 3U4EA 3ARVA 3IB4A 3BH9B 4CVXB 5MENA 4NJAL 1AE6H 2CR3A 4QJ5B 3IR5A 3B9KD 3WKNA 1IE5A 2WKLA 5GGRY 3L45A 4FQ2H 1IGYA 1EJFA 2IDTA 1ZLSH 3IMWA 2X7LB 3FFCD 2K45A 1ZLVK 1HZLA 1EVUA 5CN1A 4Z0XA 5HDQL 2V45A 3F64A 4XXCC 1WBZA 4FKKA 2BSSA 1XGQA 1DQVA 4FNUA 2ICWB 1MJJA 2A5UA 5LGKA 3KVDD 1XF4B 4JPVH 3B34A 2H6PA 4PGBA 5D7LA 3OPZH 3MDJA 5TH2A 1KEGL 5BZWB 1D7DA 3X2LA 3U1QA 1OCRB 4JPVL 5JYLA 1GPOH 1CYWA 1OANA 3GSUB 2MTPA 3QWOB 2PW2B 4ZQKA 5GRUL 1UWGL 2FT7A 2G75B 2ZKMX 4L8SB 1MG2C 1T0MA 4MZIA 1Z5LB 5CINL 4JO2H 2J6EA 1AJ7H 5FA4A 5AOJA 4P3CL 1R5VB 4LPYA 4U31A 4OCXH 5E8NB 4I3SL 3EHBD 3V10A 1G9ML 1AQDB 3HBPA 4JFOA 1RVFL 2X6BA 4DQOH 5LNEA 1EERB 1E8ZA 4K2UL 4YZWA 4F3FB 4X4YA 4JE4B 3BUDA 1CE6B 4CVUA 1EGJL 2ZP0T 3DTXA 4PG2A 3PV7A 4WTZA 2R29H 4N86A 3V6FA 4BZ2A 4ISVB 3FBKA 2BXZA 5E4IA 5DHVB 4ETQB 3ABZA 3IJSB 3OG6B 4Q6YA 1LO2L 1NCNA 3CQPA 3FT9A 3HG4A 5IV2A 1FL5B 1IBHA 2NY5L 3N3EA 2VLJE 3ILPB 3QJFA 4AENA 1KGJA 2FYYA 1LO5B 3OF6A 4KVNH 1IU1A 4KMTH 4L2LA 2EUVA 4FTVA 3HB3D 1KACB 1MFVA 1B9ZA 2N4IA 2YK1L 5K69A 2Z0BA 4N5EC 4PJFF 1N8ZB 3JSSA 5I71B 1QFWI 2FT8A 4XO4A 4XPHH 5TE6L 1C16A 4N0YL 4KOBA 3RAJL 2V5SA 4P46B 4CRZA 1BM7A 1ZHBB 3QG7L 4PGCB 4BHUA 3C8HA 3ZSTA 1OK8A 4DAGL 1QLRA 4PJFE 5HJDA 2R69H 3PP4L 1HDMB 1WIPA 4XPGH 1IC4H 3QDME 1GC1H 1AGBB 5DR5H 3K6SB 2HKHH 3K6DA 3NIDB 3T8VA 2E74C 1Q72H 4ANKA 3ETBF 1DTUA 5F89B 4I4WA 4BJLA 2G30A 4OVUA 3GTLA 3VB9A 4PR5A 4I1RA 2FQEA 4C56D 3HC2A 1WC2A 2ZYIA 5IQLA 3WKMH 2Z91B 4CVWA 4PLNC 4JZOB 5DZPA 3Q6GH 4F5CA 2CKBH 3QIBD 4JFXA 4RMQA 4PW4A 3PDDA 3GPEA 1EHLH 5I26A 3ZDYB 2FYVA 2GFBA 3LMJH 3PGDB 4S1SL 4ZFOA 3RA7L 3P3RA 2DQUH 4XBPA 2YPKB 3MR9B 2QZQA 4G43A 5IK3B 2E7MA 3L9RA 5LJYH 2F58H 3U0TA 4QXGL 4TL4A 3CLWA 4PTUB 3E6FB 1INEH 1XO8A 3OX8B 4B7IA 1I1AB 4R8WL 3ORJA 5B1AB 1G4RA 3II2A 3CU1A 4JPQA 4MJIA 1Z7JA 2VM9A 5C6TL 4I3RL 4WUKH 1M71A 1NUDA 4NZTL 5DUML 3DO7B 3BPLB 1D5BA 2OL3A 1BVKB 3Q3GB 5EZOL 1ASQA 3VAEA 4E42B 2VLRE 1OSPL 4QY8A 4CU8A 5HYJD 4IBVA 3AG2B 1N0XH 5HYFA 1FVCA 3KYKH 1BGXH 5JYMA 4V1DD 4WFEE 4M6OH 2J2ZA 2WVVA 4JKNA 2BP5M 3MRRA 5C0AE 1ZV2A 35C8H 4PJBF 3RRQA 3FSZA 1N19A 2B4CH 4HIIA 3QEHA 1BZ7A 1ADWA 2BSBA 3FCTB 4RGNC 4PJ5D 1C12B 3QIBA 3IEAA 5LVEA 4DW2L 1KYOK 1XEUA 1YEFL 4PSPA 5K59F 3US9A 4M00A 3KH4A 1N59B 4DK6A 3CC5B 1BD2A 3V4UH 3JTSA 4UTBA 3UBHA 4HPYH 3RWCA 4HSQA 3HPLB 1QZ1A 1ZT7B 3D1MC 3LQAL 5B3NA 3IGLA 3WTSA 4ZDHA 4EI0A 3DX6B 3BPNB 3KYNB 5EIIB 3V4PB 6FABL 4Y9FA 2LE9A 3TC9A 5JIIA 3PY9A 2CIIA 1UM4L 1AO7D 4NQVA 5FLUA 5IB4B 5GS0H 1R5WA 2H26A 3TWCL 4B7LA 4AEHL 1WLHA 3D08A 2NY1B 2J12B 1GKEA 3PL6C 1E4XL 3IETA 3HNTL 5AAPA 3V0VA 1W8EA 3FU6A 1L5GA 1NSNH 3X11A 1VC3B 3LQMA 4ZXBA 4TUOB 2Y22A 2GBVA 1NEZB 4XX1E 5AUMA 1UWXH 2LVEA 2WBXA 4NZFA 1SJEA 1DVUA 1BMZA 4BFKA 3CGTA 4LOVA 2DICA 5I6NA 1SLVA 2HT2C 1AGDA 4FFYL 4IRSA 3WIFA 5AW9B 5E03A 2H2SD 3HS0A 3ZE1E 3MRIA 1FI8C 1KGCD 4IOSA 1JGDA 4LLQB 3BAYA 4P5MB 4RFNB 4DN4L 1HHHB 1NANI 3GK8L 4JO1H 1F4WL 3ISRA 3A5VA 3RUGF 4HFUH 4PB9H 1RZ8B 3IMSA 4HS3A 3X14A 4PV9A 2OL3L 2MQ0A 5KVDH 2B63A 4PB9L 4JKPL 3N0AA 1BXAA 1CWVA 2CU9A 2BWDA 2VM4A 5F7MC 2RTTA 4LRIC 4OF8A 4Q6IC 2KPWA 2D9CA 3DBXA 4DAGH 4DTGL 3RIKA 3M8OL 1CBVH 5ID1A 1P6WA 4F7CA 5TF1L 5IEHA 3NIFE 3VGFA 4AIXA 5FHBH 2P80D 4HWEL 3V5HA 1VGEH 5DVLA 3ATEA 4OSUH 1B3JA 5K9OB 3PHAA 3B9KB 1UJ3A 1A6AA 4JFFE 4Y4HC 4EIUA 4Y9CA 4JR9L 2EKSA 3L3IB 1HEZB 4KVCH 3SQOH 2A9AA 3X3GH 1E4HA 4LLQA 4TNWF 3CVHH 4WW2A 4HETA 1YRKA 2K4AA 5EEYA 3EOAA 3PL6A 2VERA 4L0PB 5EWIH 1AXSA 1TZ8A 3NJGA 4BSVB 4GW4B 2F8VA 2YC1B 2O6CA 4YNYA 2DMKA 3LNIA 5ITBH 3VGBA 4YDIL 2FJUB 2GSMB 2FQGA 4M7KL 4JFZH 1NCJA 3D69B 4CBZA 1XF2B 1T4WA 3OXSA 4YLBA 3RWCB 1Z3GH 3IS1X 3MCKB 2CNYA 1UA7A 1NEZA 4L29A 5ERWB 4DGYL 1G7HA 1QKZH 3V4UL 3HCVB 4WK0B 4FYQA 2YGQA 4X83A 2IWEA 2AEQL 2BOLA 5I1IL 4WW2F 1MFAH 4R26H 4G7SB 5FDWA 1NEZG 1COBA 4ZX5A 3G6DL 4CC1A 3QIBC 2DBJA 4XH2B 5DT1L 4N2DA 3BE1L 1QSEB 3MOAL 6FABH 2R39A 2Z31A 3IGAB 3K1KC 2F54A 1KNOB 2UY7B 3FW6A 2NY4B 3KGUA 3SBWA 1NZRA 4XP1L 5DRXA 2AKRB 1J5HA 1YPZF 1T04B 1XWVA 3P4OA 1THAA 1IL1A 2A6DB 2AJUH 2N3JA 3HE7C 4NO3A 5C0DA 1WCBB 4XP4H 3RX8A 3QDGB 3BUPA 1J0HA 4BCYA 4ORGB 3AQYA 2XQ0A 1XD1A 1CUOA 3LD8B 1GAFH 1FIGH 2WXRA 1PLGL 4JBSA 1MCSA 1D9KC 1U6AL 2ATKB 4X98A 2OR8A 4RAUB 3BEVA 1F0LA 3CX5J 2IANE 3AACA 2WZ5A 4XPAL 4GEJA 1TCMA 2JTDA 1V8HA 3FB8A 2DPKA 2AAVA 4ODSH 3GKZA 1P69B 2X6AA 4GSRA 3HVDA 4LLVB 3NN8B 4RGNB 3WFCL 1PTZA 5IWLA 4XBPB 4Z7WE 5I5JA 1FGNH 3LH8A 5ESAA 2XKUA 4MD5B 1I7UA 2FNWA 1LWHA 4HMCA 1OP5H 1F6AB 2OTWA 1BOYA 2PPFA 2FX8H 4XNBA 2XN9A 2ZUQC 4NENB 3OKOB 4PJ8B 3BRGC 1E4WH 1SDAB 4ZUUA 5HI4D 2WLIA 4UT9A 2QVFB 3WJMB 3BPNC 4W4NA 3WN5C 4UI2A 1W8OA 4K3JL 2R9HD 2EH7L 3BZ4B 3EHBC 4CGTA 4N0RA 1KPVA 4PREA 4PRIB 4UAHA 3RWGB 4YS4A 2BVOA 4PJ8D 3VXRB 1AQDA 1XR9B 5J9PA 2AI0L 4F15B 2WNXA 4Z1PA 4A04A 3IDXL 3HE6A 3NIGE 3VXTA 1R5WB 2H26B 5IB2A 4AMKH 3KJ6L 5MHSE 3DX7A 2AV1B 2NY3D 3MJ8B 5FYLL 3L5IA 1L6PA 1X9LA 4I1NB 4G5ZH 4NKMA 4Q74A 1KLUB 4XODA 2BVTA 5K9JL 4TNWK 2WYHA 5FUOH 3IPBA 3WUWB 3IXAB 5B4MC 4ZMPA 5LBVA 1J0JA 4N25A 2QBWA 1MOEA 2DDQL 2IPKA 3EJCA 2DIJA 3DRQB 4TNVK 2D7MA 1XCQA 4XHQA 5HPMB 2NVYA 3BZDA 3P0YL 4XN4A 2W1NA 3TASA 4E41D 1ZDQA 3CC1A 5I1KH 4H20H 2P47B 3PWUA 3L5JA 3SHSA 4FCAA 4JDTH 1OWWA 4K7FB 1PYQA 4NKDB 2NNRA 4GXVL 4P2QB 5EU6A 3IPFA 1Z9SA 3AS2A 3CN0A 3JV5A 4G8FB 3OC5A 4MXQC 5D70L 4FRWA 1BHGA 1EXHA 2EEBA 3N85H 3GTOA 3O3DA 4JM2D 4R5VA 3VWJB 1XMWA 2LT9A 3PHQA 5FECB 1M7DB 1BEYL 2HRHA 2VZ3A 3MLWL 3TBYA 2KI6A 5JDJA 2TSBA 1ES0A 4XNXL 3HR5A 3IF1B 3MV7D 2BNQB 3SZKC 1Z0MA 3EFDL 1INDL 3VWJD 1ZV9A 3NPZB 3P11L 4OGYH 5EBLB 4K94L 1K85A 2PI8A 2XZAH 3NFPB 5D7JB 5K1JA 5C0JB 5CU9A 3KDMA 2VDOL 1I8MB 4XAWH 5GGTH 1AA6A 2JLPA 4KDTC 1N18A 2H47C 3U4BL 1KJMB 2OMTB 2UUDH 3TZVD 4UT6H 3M1CA 4X5PA 2B59B 4Z0BH 4FA7B 1HAWA 5IESH 3CVHB 1U3HB 2AF2A 2FO4B 1FNLA 2LTQB 4HFWB 4I2XE 1BF2A 4M48L 1TJIH 1LO4H 5C08A 2NLJB 3OWRA 2HMIC 3FCSB 3GJEB 4XMUA 3U9PL 4L0YA 4XOBA 4ZTOH 3ZE2F 3SGDI 3QUYA 1M6OA 3DOSB 2VL5A 5T5FL 5BVJA 1K83A 4MQTB 1UOWA 2R0WH 2WM0A 5CXPA 4NQSA 2FUTA 5HVFB 2WN2A 4OLUL 1I4FB 3NCYP 2YRPA 4NRZA 1OF0A 4YE4H 3GI9H 1GJWA 5B7MA 4N0FA 5A7EA 1MCWW 4YHYB 5JHDA 3IAPA 5DVPA 5T1KD 3BUIA 3B3IB 2OW7A 1R33A 3MA9H 2HSIA 3B2DC 2QSCL 2AE0X 4KPHL 4GS7B 1ACZA 1TVHA 4RMSA 2IAMB 4HBQA 1XIWD 3P4NA 2QVTA 2JIRA 3W9EA 1T66C 2ZAHA 3G5XA 2VLLA 4LVNC 5E6ZA 1I53A 1SMAA 3BQUC 2C7UA 3RTQB 4AQOA 3SCMD 5I75B 4WSJA 2BSTA 3MYZA 2VDMB 3CN3A 2HFGL 1EEZB 2WINB 3SDDB 5C9JA 4I0PB 1FRGH 3I75B 1S9VA 3DETC 4H4NA 2JKRM 5B1JC 1GY2A 5G4OA 3NCFB 5DMIH 2VT0A 3QCTL 3FTVA 3MFFA 2AV7B 3S96B 4CUCA 1CBJA 4QMEA 5EU3A 5FTLA 5DJCB 4GEIA 1XR8B 4LHUD 1XGPB 1D5MA 3V79C 5E99L 1VZGA 3FQXA 4I0PD 1CXIA 2IDSA 5FYKE 3KPNA 4H0GA 1T5XA 4J3OH 2X1QA 4JHZA 4R4ND 3W0WA 1ET5A 2Z64C 5EUOF 4PGBB 3EH1A 2N7BA 4P4RB 4L4TD 4QRAA 1KOAA 1ILSA 3CFMA 3I50L 4RBPK 4JRFA 1XCTB 3DYMA 3RIAK 5IMMB 3KJ6H 5DQJB 1ZY9A 2Q2EB 3VFTB 3X2IA 1USZA 3QDGA 1M2VA 1UXWA 2F74B 3FO2B 1NL0L 4AM0A 4L4TB 4XNQA 5DS2A 4LQFH 1A02N 1ZS8A 1CGVA 1P6FA 3QHFH 4OT1L 4N9GB 4FEMA 5JIMA 3JWOH 3ATDA 4P5RA 5T1LD 3SDXB 3G6AB 4MQ7B 4WENB 4OY9A 4YHOL 2YR3A 4U1HA 4PVNA 1IGCL 4JRXD 2Q86A 4FG6C 2EYSB 2OXHA 4HV8B 5IBTL 1E9QA 1OAZH 3V0DA 4Z78B 4NYLB 2VE6A 1H15A 3OXRA 5KUMA 3RVWC 5E0FA 2EILB 4CA4A 2WBJD 4U4BA 4YSUA 5I74C 2CLVA 1F2XK 1P7QB 4JZJC 2ENYA 3FQUA 3LX9A 4I48A 5F8RC 2ENPA 3UABA 5BVPH 4DK5A 3ET9F 4GSQA 2BPBA 3VG0L 3BN3B 2NTSP 3V9CA 2PJJA 1GS7A 4OZFG 2NXYC 3MUGB 1I8IA 1OSZA 3VMPA 3C9NA 1ASPA 4JFHD 3ZMEA 4OUUA 1MVYA 2IQAA 5E7BA 1BEYH 3DK0A 3OGCB 4JQXA 1IC1A 4KBPA 1OWRM 1FL3B 2AEIT 2R83A 3ARFA 5D1ZB 1DL7L 4V33A 1DVSA 4YDNA 2DIEA 1DE4A 2C4XA 2FUQA 3AROA 2H7WA 5FOJA 3LKOA 1Y07A 3Q01A 2BOBB 2ITEA 4OJFH 1P4BH 4PLKC 5IESL 2MRYA 2AJZB 1OHZA 2Y7MA 4P9MH 1KYFA 2ITFA 5EFIB 1G6RH 2ZP8A 2VE6B 1G7PA 5EOTA 3H9SB 1P84J 2L7JA 5HGDA 4GG6B 4PY8J 4DJMA 3U9UA 4X5XA 3IFNH 2QGBA 5DUBA 3NP3A 4KI5F 3NSCA 1RZGA 4O2CA 5C71A 3D4YA 3T77B 2DEWX 4L37B 4W9CC 5EF0A 4W6YB 1BVNP 4ONHB 5IB5A 2UYLA 5EN2A 2AQPA 5DJ2A 2VDKH 4KDIA 3NK3A 3VX0A 4EE2A 4GI8A 2BIHA 1OB0A 2J25A 3IWVA 4D0CA 4UIKL 4UT7H 1LHZA 1GGCH 1U8CB 4LLWB 4KI5D 3WS6C 4JJ5B 1UXLA 2FWLB 4JANA 4MCYA 3VH8B 3IGAA 3NBNA 2XWBA 2B59A 3I6SA 2TAAA 2X4RA 2X0VA 4HSCX 1L6XA 2FCBA 4L3AA 1A3RL 2WPGA 4R4FL 2AQ1A 4R6UA 3P9LA 2NY3B 1JPTH 3M7OA 1NCHA 2UXTA 4X5QA 5CS7A 1DVFB 1KYAA 2OYLA 4LOUD 3QUXD 4WI3A 3VWKA 1U36A 3NCWA 4JR9H 2P24B 2Q6WA 4BFOA 1YN6B 4D7PA 1BFOA 4UM9D 5CSZB 3S9DB 1MNNA 3HI6L 5EEXA 3JTBA 4YHLL 5FYKU 4HV8A 4K71B 5DEGB 3L3DA 1RUKL 4JS7A 4P04A 5CCHE 3BISA 3OQRA 5DA0B 2CDEB 1IAKA 3W2DL 5HHVL 7FABH 2WVVB 4AJVA 1F4HA 4PH8A 3OB0H 1J11A 1S46A 2Y69B 1RJLB 2KLTA 1HD5A 3OJDA 4NJ9H 4GW1B 3WD5L 4B9PA 3R0MA 5ADOH 5BCAA 4JKPH 2KT6A 5H8DA 1ORQB 3FUFA 3D3VA 3RWDA 1TZIB 2ICEA 3TO4A 1ND0B 2ALAA 1JHKL 1ZT4A 5IR1B 2I9LA 1PZCA 5DS8A 5DHXB 4YQXH 3ZIYA 4NQSB 2BCMA 5F7EL 2DWEB 4XP1H 4Z76B 3DURA 3CSBA 2V5TA 3DX2A 3HE7B 5MI0C 2J71A 5C97A 2HX9A 3SN6N 4Z7NF 2VUYA 1H3VA 3NIGF 2P44B 5DD0H 1HINH 3L3DB 3BEWB 1XB8A 5IBUG 1GGTA 2QGEA 2XVGA 2WXKA 3OSVA 2GSGA 3UOAB 3VFPA 4AH2A 5CLYA 3EYUH 3HRZC 1Q1JL 4MD5A 5ANHA 3QZNA 2V5RA 4FFTA 4IU3A 3O3AA 3HI1B 1YNJD 1VRSA 4JRYB 2JA7A 3BZ5A 3H54A 2EIZA 3FFCB 2NNFA 3OHXA 4YC2B 5F2FA 3NJKA 3WNKA 3RPKA 2IV8A 3EOBB 4R90H 4JFEA 3GM8A 5F7LB 3OX8A 1LD9B 3QPXH 2FX7H 4FAAB 1QPXA 3VXMB 5J6GB 2ICEB 4N22A 3Q7JA 4KHXL 3HUJB 4LL4A 4MCYB 1XGRB 1WC7B 3MPCA 3VXSB 5FF6B 5I1AA 3RVTD 4U2YA 5BV7B 1UURA 1JV2B 4XNZB 5KTEL 3ARSA 3MGOB 3K4ZA 4PV9B 4WW1B 1RD6A 3BKJH 4XCYB 1BFVL 2XSKA 1S7QB 4N8VA 4NI3A 4MNQD 1TCRA 2ARWA 4GKLA 3ZDZB 1G9EA 2DQFB 3VXUD 3QI9D 2B77A 5F89A 3VI4A 2DMHA 5ACZA 3BESR 4OI9A 4XXCA 4F2EA 4N6RB 5EC1A 4CRPA 4HIEA 3EDJA 1SYVB 4LRNL 1DQDL 1HSBA 3FQTB 1ZCRA 2CLRB 3APNA 3KPQA 3KLAA 1FG2B 2AI0H 4LCUB 2BJMH 3ROLB 2NNAB 2Y5EA 2OSXA 2CKBA 2Y9RT 1G1CA 3BMWA 4XOEA 5E8DL 1ROCA 3ALWA 3LRLA 9CGTA 4CMMA 1BFTA 4U3CA 3OJDB 5E8DH 4O02B 3HFFA 3BCFA 1VSCA 5I15L 5DO2C 1MQ8A 1CGSH 1PKQB 4NN6C 4FQIH 4TL5A 5A2CA 3HS8A 2YC1A 2CGZA 5EA0L 5D55A 3R8QA 2B5IB 2VUKA 3DJ9A 5EUKA 4N3TA 3SGKC 3GBDA 1A6VL 3MUUA 4WKZA 3RTLA 3T2LA 3ZE2E 2F68X 1R24B 1UZ8A 1CDBA 4QYOA 5HVGB 5TK2A 4MMXC 1IW7D 4U1NB 3DWTA 2EUXA 2FH8A 2JKTM 1XTMA 4K94C 2VDQL 3FUEA 4PJIB 5KS9F 2FEEL 1ZLUH 1NM9A 1RZGB 3ARRA 4ZTPL 1NDMB 2FZ3A 2IDFA 3UJJH 1GGBL 5DLMH 2GJJA 3VFMA 3Q8AA 4Z7VB 1UB6B 3OKLB 1H3PL 3Q2LA 2O61A 4FOMA 3PWNA 2KQNA 1CR9H 2C3HA 2HWZH 5DEFB 2UZYA 4RV0A 4XVJH 5FYJU 2YD5A 4A2MA 2KHAA 2C4FT 4FNLL 5L8LB 4FJZA 4J8QA 1I7UB 4DERA 1IL1B 3WGVB 2KS0A 4GO6B 1RZ8A 5HHQB 2BJML 4D8OA 1I7ZB 2OLDA 4OD1H 4JM2F 5E23A 2E75C 1YC7A 2E3VA 4K07A 4PRPD 4GKSB 5KYNA 4GINA 5DUBB 2VDPH 3O9WB 4PJXB 4PRBB 3RAJH 2A9MH 5IB1A 3RNQB 3GTPA 4K8RH 1VADA 2VAJA 4IRJC 1U8QB 1Y5IA 3FONB 1MDAA 1J0ZA 2FAUA 3AMLA 1JPGB 3NCEB 2CSPA 3U0PA 3QO1B 1KIRA 3QQ4B 1CDUA 1UZ6E 2NUPA 2MTAA 3RVWD 1ZHBA 3T0ED 1XL6A 5FEBA 2XIDA 4FI6A 1FYTA 4UQCA 4LAQL 4Y2NA 3UTSB 1CD8A 3BUYA 4W4OC 4LDCA 4UU9A 3S35L 4HZ1A 1ZMYA 4OIIH 4TQPA 1GJUA 4V1DB 3UDWC 5FGBA 1QZNA 3O6MH 3IFLH 1T2QL 4YHKL 3CD4A 1VIWA 3QRFM 4QD2E 4WWKC 3HN5A 1U93B 3ULSA 2E6QA 4X7TA 2V37A 5IBTH 2VR6A 4U4IA 2ZCHH 1DSYA 3DVFA 1NGPL 3UERA 4AIOA 3Q6FB 1OZTG 2KH2B 3NSDA 4JKMA 5B8CC 3ZPDA 4HCFA 4Z8FL 1NBVL 4MB1A 2R27A 4BDVB 5LO7A 4FMVA 3S5ZA 1J8HE 1HQ4A 1R3LB 4X5WA 3WIIH 4MAUL 1DJYA 4I1PA 4H88H 1BAWA 5IB3A 3C60C 3WO4B 3X13A 1OLZA 5C0EB 1P7BA 4X9YA 2J2ZB 1BP3B 1TZGL 1MCPH 3QUXA 43C9A 1ITBB 1FC1A 2Q2LA 3QJOA 4N2IA 4UTAH 1J8RA 1M05A 3LEXB 2A73A 1AC6A 4HZLB 4UV4H 5EEZA 5DRXB 3RU8H 1BOGA 3VE0B 1LM8V 3JWOC 5KVEE 1TQSA 2IGLA 4NQEB 5IW6B 1NLBH 4IRZL 2B9BA 3I85A 1IM3D 4FG4A 2BHFA 2DWEA 4Q6IA 3CZUB 5I30L 3E38A 4QHLB 4WI9A 4V2CB 2XYBA 1FYHB 3L7EB 4NQDA 2WZPA 3P77B 4NC1C 2GPZA 4U7MA 2FX9H 4M7LT 3T0VA 3ZHKA 2YMOA 3SUJA 3N55A 3TBVB 4KZEL 4ZW3A 1DQQA 2Z35A 3MUJA 2QV4A 4PS8A 5AAWC 4BZ2H 4ES8A 2QFPA 3FUKA 2WLYA 1E2VA 4WEBL 3CZSA 5G5DA 4X4MA 3TN0A 1SXZA 5JW4M 3VD4A 5DQDH 5FUZH 4HCGA 5JIQA 2X4TB 1SOXA 3MXWL 2OCCB 4LLMB 5I16A 1WD8A 2QADD 5EA0H 3GMOA 3N5AA 5ANMB 2A7BA 3S2CA 3T0AA 3W1ZA 1CGSL 4QJ3B 4OLXL 2WV3A 5I6MA 3V4VA 5I73B 1FO0L 4DFIA 4F33B 4HOWA 1G9NH 4H2CA 1YMMB 1U8OA 1WWWX 3A6CL 4YGVB 1JWSB 4NUJB 3WS3B 1P84K 1HHJB 1URIA 4CS0A 1SNRA 3WHXA 4L9LB 2QVKA 5J11B 2X2YA 1IC4L 2WTRB 3KWWA 3QEQA 2W0KA 4YBQD 4XP6H 1OCWL 1WFTA 4CC0A 1KTKE 1DQDH 2NYKA 2BIMA 5JHMA 1NPUA 1DDTA 4PWKA 5KSVA 1DZ0A 5DQ9B 3OJVC 4U6VL 3UP1A 1E7VA 3D0VA 2WVTA 3TYGH 2VW7A 4Y1AE 3EXJA 4KY2A 3FN9A 4KO5A 3X2KA 4QCIB 5DVMA 1AKJD 5ACZB 3RNKA 1EPFA 3R06A 3TF7C 1DL7H 5L2KB 2RALA 1S9KC 1GYVA 5FA3A 4OKVB 1M42A 4NKMB 5SWSB 4WV1C 1PQHA 4FFWD 4NO2A 4FXGA 1BOGB 2XCMC 4JPKH 3BJLA 5KSBB 3T6QC 5AD0A 2V2TA 2W07A 4A55A 2J4WH 4AUYA 1KY6A 3SJVE 4AM0Q 1AO7A 2PPAA 4EUPB 2LU3A 3EOTH 4HK3J 4LOEA 1IRAY 5J9PB 1SYSA 2AQTA 2FHFA 3RX9A 1PYWB 3U2IA 3O45B 4N87A 1F1DA 1FV1B 3MVSA 3WEMA 2XPYA 1XZ0B 3NFSL 2XTJD 5IHUL 3QZBA 1CFNB 1MDTA 1U92B 3DETD 4Z7OE 3UBXG 5D4HA 5JUEL 2QQQA 5AWNH 5IJDC 3K5SA 2DL2A 4M4RA 5K5YA 4X6CB 1ZTXH 3TN0D 4AYDC 3VFOB 4PV8A 2GI0A 3L3OB 2XWTA 2P80A 4KUZL 4KXCA 5HHXL 3TP4A 1CLZH 3BZEA 1J0YA 2N1KA 1INQA 5E8EA 1XCQB 2JKLA 2DYSB 4JFUA 2PWEA 1JWMA 5DMGD 5CEYB 2Y2TA 2ADFL 4LCWE 3HMXA 1DCLA 2BRRH 4LVOB 3G08A 1V3JA 2M26A 2VQUA 1DBAL 1IM3A 5F7EH 2IG2L 4LL9A 3LS5L 4PLOB 1W2KT 12E8H 3PJSB 3L7FB 4KJPC 5IB2B 3EJYD 4L9DA 5H35B 3E3QC 1ZKAA 5IVNA 2A77L 3ME0A 5JHLA 1JN6A 1WGVA 5HDQH 2EE3A 2YQ2A 3TA3A 5KSVB 3ZTDC 3V6ZA 3I6GB 5T3XH 1E43A 1HHKA 5IFHH 3FT2B 3O6KH 1FZMA 1ZANL 1TF4A 2FEDD 3GO1L 4H5SA 1GYAA 5D8JL 4GXUN 5L2JB 3LRKA 2WLLA 3LKQB 5DI8A 2YBGA 1ZIAA 1JNNL 2A68D 2UY6A 2XZCH 2XDHA 2CA4A 3B6SB 1PU0A 1T7WA 4G6ML 3VGGA 3WLWC 3ZO9A 4A6YB 1R5IB 3FRPA 5BZXA 2V9RA 3GSOB 2A4EA 3ARGC 4PJ7B 4WJ5B 4H25A 3NABL 1S8DA 3NFPA 1SVZA 5D7JA 3KCWA 3GMQB 2FHBA 1F97A 1LYQA 2WUCH 2GHWB 2H6OA 3V5KB 1B4TA 5ECGA 1N64L 3B7SA 4QRRE 3GTNA 5ICZA 2HJLB 4GAFB 1HXYA 3ARDC 1OAYH 4LEEA 2QSVA 5GJSH 3NN8A 1AY1H 1Z9NA 4FQXB 3VXRD 2HYMA 2YLKA 4QRPB 1A5FL 2BP8A 2ZAGA 4X6CA 3QFGA 1RHHB 2DQIH 3BT0A 1DJSA 1AQMA 2XTJC 4NZDA 1IZKA 4F7TA 1I75A 1MFCL 4LIQL 5DZVA 3UZQA 1YMHA 2GT9B 4FQXD 2BP0B 5AW0B 1YYMH 1X5IA 5CJXC 4JG1L 1YEDA 1QEWA 2P7TA 4BKLA 2LW3A 3W56A 4YPGA 4HG4K 4FQQB 1WITA 5GJTH 2ERJB 2Y36H 2YUWA 3KCPA 4OLEA 1BSIA 3D4CA 5F9JB 3WU1A 4X6CF 1ZHLB 5HJBA 3F7PC 2Y36L 1IGIL 2R0LH 1MVUB 1UD8A 5DHVA 1K5NA 4KJYB 2R8SH 3DROB 4NC2B 3MUHL 4X5XB 3VXTB 2R0WL 3SGDH 3D39D 3PE9A 3QZLA 2I07A 1QNIA 1L0XA 2WLMA 1W72H 4H5SB 1NM4A 4WNJA 4CADA 4FX5A 4X4ZA 3LVEA 3MREB 5C0NC 5T1JA 5EOCH 3FTGA 3KLAB 4HAGA 5CJ5A 4AWJC 3GNMH 4W9ZA 5CZVH 1YEGH 3OLIA 2FJHA 2H41A 5T5NG 3MOAH 2Z8VC 1S9YA 1T1YA 3K81A 4AK1A 3G6JA 1OZUA 3H3BC 4H8VA 4YX2H 4ATWA 1C16B 1URLA 2G4GA 1JWSA 3AVEA 1Y18B 3ZE2B 2A38A 4M56A 3TA4D 1CT8A 2C1OB 1QWNA 1OD9A 2P48B 3QNXB 1VCBC 4LP4A 5FO7A 1SF5A 3U4BH 1A7PH 1OGAA 1MJ8H 1HH9B 2WSPA 4HKZB 4C4KO 2BSTB 3HE6B 4JLRB 1QHQA 3ZO0A 2PXYB 5L2JA 5DRWA 4JQIL 3IJHA 5DJ8B 1DJWA 2V33A 4FQ1H 1M7UA 1OAXL 5AW7B 5I9QB 3HRZA 4J3VA 3QS3A 1P7QA 3C5JA 5TDPA 4U49A 1DEEB 3QNZA 3MCKA 4K4KA 2IO5A 3RZCB 4ODXB 2XTLA 1CZ8L 5C0IB 3ZT6A 4HS6B 2I32A 3OGOE 5T3ZH 1U8OB 4FD0A 2X2JA 1KC5H 1J87A 3W9DA 3U4EB 1KTCA 3EBAA 4MX7A 2AK4D 5C0JA 3O4LE 2F5AH 4G83A 5GIRA 3C6LA 2VJXA 3H4HA 4PJGE 5JNYA 1SLXA 4ZFZA 2WWKO 4OLVL 4XAKD 1TTCA 1YEEH 2DRUA 2IWFA 3L3OC 4JFED 4NI6A 3IRCA 5F9OL 3TYFB 1U3HC 3SE3C 1HC1A 4YHKH 3M45A 1G8KA 3TEWA 1SIWA 4AGLA 4C56B 4NIKB 5HHOA 1AGFB 3RBGA 3Q44A 3E8UH 3FTSA 3NJLA 4DVBA 4CGUB 3WV0A 1WDAA 4QRBA 2VQTA 4QHUB 4WCYH 3CHQA 1HCVA 1MFDH 4OR1A 3LOWA 3BQUD 1HEHC 4XXDA 2VYRE 5E6UB 3N1GC 2E8YA 4J8RB 1FVCB 4WU7B 5HHPB 4ZMAT 1MW2A 1P4IL 2FBOJ 2WQAA 4WIQA 3BVXA 4K5MA 4MA3B 4X8XA 3ARXA 3ARFB 3AB0B 4ODUB 2A83A 4JG0H 4KY1L 5B1BB 4O2FB 3NJMA 3IJ8A 2YD0A 5CUSH 5L9DH 4XN2A 3CFJA 4IRJB 5AKSA 2QPFA 4L1HA 2DQGH 3ISWA 4YSEA 2VQ1B 2ZUTA 2QADC 4EBQL 5HHOE 3MUGA 3FU9A 1NSNL 3BVDB 4E5XG 4HCIA 1NJ9A 2XN2A 3PFUA 5HYJB 5KYUA 4F8OA 5ISZB 5E08L 5L2KD 1BD2B 4PJHB 5GGQH 5T5NF 1J9CT 2QQKH 5SWSD 2D7NA 4WI4A 2DQTL 3HHSA 4ZUTB 1QQDB 2WZ0A 3WLBB 2GABA 1FIGL 1HL8A 4S0HA 1JZFA 4X80L 1KTJA 5D7IA 5IZ7A 5C2BH 4PS7A 3Q8BA 1DDHA 5C0ND 2WWKT 3NMEA 2NY7H 1P5VB 1XIWA 2R0KH 4OCLC 1I85C 1YEKH 4I8DA 4WKXA 4HJ1A 4GAGL 4N3UA 5GGUB 1TYEB 1SXNA 4NP4H 1LEIB 3VWKD 4R4BA 2W59A 1X9QA 2A9DA 4DH2A 3N2JA 2PWDA 2UZPA 1G9NL 4JGMA 5E94B 3A21A 3OAZH 4OF0A 5LQBL 5DVOA 4EMZA 1J5DA 3I6KA 3MBXH 1DO5A 3MUY1 4JO8A 3VSUA 2DY2A 2NNAA 4TVSa 1PL3A 4XHJD 1VFBA 3HZKB 5DS1A 4AEEA 1P7QD 4P0DA 5ACMA 5HYJE 4K5OA 5CIPH 5K1NA 4R84A 5KBPA 1KPVB 4PREB 3RWGA 2QL1A 5FGCB 3FAWA 1TPXC 4NQDB 1N0XL 1ZIBA 4HWBH 5FHBL 4HOMA 4W9KC 4QLRA 5F3BB 2G60L 1T5XB 3M8OH 1CBVL 4KRPD 4H8HA 3MRDA 1BG1A 1CFQB 3OHMB 4H8WL 5F88A 4ZX3A 1MAML 4PG9B 4ZFOB 2ZZUT 2PETA 2AMUA 5EOCJ 2XI9A 4WFFD 1J1OL 4RGOH 25C8H 2PABA 3SZ6A 3LKNB 3KYOA 5HGBA 3QAZC 4NOBA 2ODIA 4TNVF 4GFTB 1X5LA 1CO1A 3EOBA 4W9DC 3AQXA 2VW4A 3CFKB 1TJGL 4AUUA 2D8KA 5G2NA 3X3FL 1ULVA 1YSOA 3O45A 4Z7OF 1OAQL 4JM4H 4OM1L 2WANA 3FUHA 2UZIL 5GZOA 3ENGA 4W70A 2LFGA 2P5WE 3D52A 3JV0A 2DLIA 4UDUB 4XN9A 4MJ5B 4NCC1 4DSYA 3KPOB 4RVBA 5D2NB 3QC8A 2VH5L 3GD1C 3UMNA 4APQA 2WXGA 1AYOA 4W9JC 5D93C 3MRCA 5FDYA 4A2FA 3QFJE 3V0IA 3N9GH 4N5UA 1DANU 3ILPA 2JH2A 1BV8A 3QO1A 2CMRL 2D73A 3O3EB 5EZLB 1NC2B 3PAYA 4XB7A 3N42B 4Y16D 4EVNA 3RFZB 3K5RA 1RU9L 2QQLH 4GAGH 4BKSC 2MCG1 1NDTA 5H35A 3LS4H 4PM1A 3MBEC 4HISA 3LZNA 2EDLA 2RGSA 4Y4FA 4AEFA 5I6KA 3WTTA 1EQWA 3RJDA 3OHXB 5HY9A 3EUUA 5LGJB 3HFML 4X6EA 1HYSD 3W57A 4UDUA 5A3ID 1LDPH 4Y5XC 1PEZA 2Y1AA 2LV4A 4BQ9A 4ZS6C 1JWMB 3VU1A 1X44A 3LQAH 4NOFA 4JHBA 1H3GA 4X2UA 1FUNA 1C9SA 3UZVA 4A7GA 1IGML 3CFEA 3NDZE 3W5MA 1ODUA 1KF9B 1MWOA 4WSGA 3D7PA 4IKKA 4JUTA 2DM4A 4ZNEE 5KEZA 1X5KA 1O9ZA 2EACA 4O4YL 3IXTB 4YAQA 3TWCH 1O75A 1EVTC 1X7QB 4RDQF 3Q0HA 4IRZA 2ROXA 2JIOA 3DX9A 1R0AH 3UPRA 4G9DA 4G8EA 2AXGA 1VACA 2ZKHH 1DJIA 3QORC 2EXWC 4X9HA 2W5PA 1A4JB 3ESMA 5FUCE 2IGFL 3MV11 3DGCR 4TKWA 1S5HA 5F0PB 1OCOB 1YO4A 1HKLL 5FTJA 1IIKA 3VRIA 4ZNCD 1HQRA 5FIEA 2F53A 4HXAH 4Y2DC 4CVZA 4OUOA 1T7YA 3HC4H 3QR1A 1IQDA 4JRYD 3QFJD 5CZXC 1AH1A 2FX7L 1WCMA 1MCJA 4XVJL 1ILUA 3KVQA 4M93B 5CKAA 3WD5H 1TUPA 1P4IH 3KJ4C 2EC9U 2K0RA 4XMPL 1ZSDB 2NY6C 1JGEA 4OVVA 1TO4A 2YMTA 3H9ZA 3KW8A 5E6IC 3MJ9L 2PCYA 3C8KA 4KJQD 4OCWL 1CICA 2OMYB 1IAMA 3ZT5A 3D3VE 3RWFA 1KN2L 4I13B 1GMEA 2VDQH 3DX9B 4TULL 2VQ4A 3OXRB 4AI7A 3NJJA 4F7EB 3T0EA 3IU4L 2A4CA 2K9UA 5BQ7B 3MRRB 2XOTA 4NRYB 4PRID 2PYEE 4M7JH 4TNEA 2VXQH 4P99A 1TKWA 1YEWA 5DU7A 1IAOB 2NR6A 1L7IL 2O1AA 4WEUD 3VXUB 4DKTA 1YEEL 5J57B 3QEQE 5FDWB 4KC3B 4BKLB 1IBBA 1Z5LA 1LK3L 1N4XL 1HAUA 1GMIA 1BVNT 3CC5A 4MB5A 2CMRH 3GMLA 4PS4H 3HUJA 5CEXA 4WZ9A 4Z77A 1FFOA 1DBML 3U0PB 1CFTA 1IBGL 2C4FU 2R7EA 5BPPA 5B3SB 3S5LB 3K2UH 1DUYA 2WW8A 4TSBH 3DIFB 1PLBA 3QXVA 4BGDA 4GG8A 3EJTA 1KUMA 3INOA 2YGPA 5HYEA 3QNFA 1XCWA 3OZLA 3TVMD 4D94A 1PPYA 2P26A 3GT6A 3S48A 5KG9B 2ZOUA 4PW3A 1J9TA 4FA8A 1YHPA 5C0BB 1R3KA 5DHEA 3FHQA 1T6VN 2WK2A 4KKQA 4KFMA 2UZXA 4MLSA 2BSRB 4DOHB 3B2VH 4URKA 1AS7A 4RIRA 5FGRA 1N6VA 1LMIA 1AGCA 5SV3A 3LEYH 4BUHA 3OB0K 2JI1A 3BT2L 1E4JA 4Z7OB 4MGXA 3TPUB 4BK5A 1I3RB 1LK2A 4PRNA 4AQZA 5E8PA 2I85A 5C7XH 1SXCA 2KBGA 5EOCL 1TQTA 3MV7B 1NL0H 3QRGH 2R7EB 4HIQA 4N2GA 3FS9A 1A4KA 3HZVA 1TTFA 2G4EA 5D7JD 3QBTB 1H6EA 3WN5A 2JA5A 3ASNB 3SJVB 4JVPA 1R19A 3NRPA 4DUXA 2X4QA 4KZ0A 5EU7C 4YZFE 2HFTA 4X80H 1WUZA 3D25B 1MJUL 1N68A 1AHMA 4B6ZA 6CGTA 2XPGA 3RFZC 2WLIB 4G7VL 1HINL 4O00A 5E95B 4J5VA 3U7YL 4KI1A 1X6LA 1QRKA 2BLFA 1WWCA 4GQQA 4G82A 2AJVL 3NCJH 4RIRB 4BFIB 2AEWA 5FO8A 2Z1PA 5K9OA 2X05A 1VKXB 2FEEI 3QCTH 4NM4L 4X6DF 1I7RA 4OJAA 3RZCC 5D1QE 1IVLA 3T5WA 1A9VA 4KRMB 1T7VA 2XG5B 3QQDA 3UAFA 4ABQA 3BAXA 1D9KA 4CKVX 3L95B 3NCYS 1ZA6B 1U8IB 1QSZA 3U79A 2J1ZA 3V9EA 2ARJQ 2HTLC 3D85B 3B2MA 4XB3A 4F80A 2YRLA 1AVAA 2BHUA 4GKSA 4R4FH 1LE5A 4PJ5A 2WAQA 2DI7A 2BSRA 1B0GA 4I77H 1E6JH 3STLB 3KM2A 1QATA 2CO2A 3EAKA 3D85D 1Z5HA 2PPDA 1CLYL 2PNWA 3HI6H 2HT2D 2UZYB 5E8OB 4YHZL 4Z7WB 3HC3H 1U4EA 3FFOA 4BYHA 1M7DA 3FKUS 3E8VA 4HALA 4RGNE 4G8EB 3F6IA 1QSFB 4QCIA 4ZFFB 3UBFA 3ZHNA 3PP3K 3WL9B 2EYRB 4YHOH 1C5BL 1ETZA 2R4RH 3G04B 3ILEA 3K6NA 4MCMA 1ORSA 4FFZA 5SWZA 2KC0A 4KY1H 3EGDA 7PCYA 1SJHA 1T5WB 3P9WB 4L29B 4Z7AA 3TN0C 3D48R 2BNQA 1CXLA 1C08B 1KB9K 1TTBA 1BG9A 4XP9H 1HIML 5IMLB 5IQ7L 1TSHA 2K3HA 4NUGL 3D3VD 1QRND 4FZ8H 2W94A 3GYRA 2QSCH 2ROYA 15C8H 4OZGE 2O5ZL 5I17A 5E4EB 4JN2A 4CSTA 1T83C 2EDRA 2QHRL 1T1XA 2P49B 4G6FD 3GSVB 4ZPVB 1CDCA 3THML 4RRPA 1U8PB 4C4KT 3MCG1 3GRBA 1Z2KA 1JDCA 2Z7UA 4FYSA 1GCYA 3HG1A 2J4WL 5DDHB 2LU7A 3SDXF 1JZ2A 3D09A 4JPKL 5I1JH 1TJMA 1QWUA 1NGXA 3OM3B 3QIWB 3OAWA 1UD2A 4XMVA 5DF0A 1PDKB 1XB3A 4YOKA 1I4FA 4XI5C 3EO9L 5F3FA 3U9PH 2R2HA 5EN3A 1CB4A 3VD7A 4D9QE 1DHKA 4AQ8C 2HKFH 2B9AA 4HJGB 5ABZA 4GSUA 3IFPA 4GYBA 3VGAC 1BQSA 1JXDA 1CFVL 2E59A 3LQZA 5ADPH 5DJCA 1NWPA 5CJQH 1NMCC 4B9CA 1HE7A 1T21B 4M61B 5D96C 1USQA 3ILQC 2H0JA 4F8NA 1FZMB 4OV5B 3C5ZD 1SFHA 4S0TD 5JUEH 2NY4D 2BVQB 2Y4SA 1INDH 1NIAA 3V52H 4NLHA 4C83B 1HNYA 3ARDD 4K94H 3D0AA 2BIQA 3GI9L 3G04A 1D5XA 1QRNE 3QT2A 5EPMA 5BW7C 3C5ZB 1MHEA 3RG1C 3S5YA 4LIQH 1CN4A 5E8OA 3G5VA 4OM0L 2R1WA 1NGZB 3DVNB 5D2NE 5EORH 4GJTB 3VX1A 1NEPA 4MDIB 5CILL 4GB9A 3F7VB 4IW4C 2WNWA 5JHLH 1QUNB 4BFNA 2IVFC 1JNHA 2HB0A 3LZOA 5IEKA 3LNDA 1DEDA 4F9LA 3H0TA 2MQGA 4MQSB 1JZGA 4RETB 2HH0H 3DX7B 3MJ8A 3L3GA 4NS0A 3ZE1B 3LH2H 2PCFB 1CFSA 1YJDC 3MLXL 1MCKA 3MUZ1 1JDDA 4KMLB 4JFQA 4G1MB 5IJVA 2ENJA 3ZRSA 3O5AA 4J3TA 2VMEA 1KGCE 4R5TA 2EDWA 3BP5B 3C8DA 5E9AA 1CD9B 2C9QA 3L1OL 2DMCA 4Z7NB 3BN9D 2WO3B 4OJDH 2CQVA 3QWRA 2YN3A 1I8AA 3ATAA 3IRPX 2CM6A 1U8PA 3QORD 4FZ8L 4UYPA 1CK0L 1KTLA 2JQMA 3RDTB 5EO0B 3COOA 4M8VA 1DQLH 3WUZA 1X5AA 2F54B 4PJIF 4WTQA 1AXSB 3P9MA 2VPWA 1BW4A 2WB1A 3T6WA 4ZNEA 2NXYD 5HHQA 5IEKB 1KB5L 1KB5B 3H3KA 1OAUL 2P8LB 4JUSA 4X4XB 1NPNA 3KR3H 3LQAC 4OD3H 2F19H 3TO4B 1QFUL 2QVIA 4HOXA 2DIBA 1QFOA 3WN6A 1ZPLA 4P4KD 2ADIB 2V2XB 3SGKA 3GUTB 1DUZB 4LNRB 3VW3H 1U8JA 4EIGB 1BF5A 4U6XA 1E9QB 4IK6A 5HDBB 3NABH 1NIEA 1YECL 2E7BA 3BPLC 3EJJX 4W9LC 5DYGA 1FV1A 3ARZA 1FFPB 3O3AB 4C2MA 4MJID 1MCPL 1IGMH 2FDBP 2L7QA 4WLCA 4EKJA 3LNEA 1PG7L 1AC0A 3BGFB 4FHBD 3ARGA 4Z95H 1CDYA 2WLZA 4PD4K 2C3VA 4KRLB 3CDZB 1CXKA 2XWTB 4HGWA 1DVZA 1K2DA 4LAQH 5IFAH 1ETJA 1HILA 2OP4L 3QUZD 1PJ9A 3VFGL 1SXBA 1AOZA 3QR2A 2APFA 4PJDA 5CAYB 3L5XL 2GJRA 4M1DL 3B8SA 3D4GA 3H42H 4TVPL 2O30A 1JF1A 3QRGL 1OV8A 3MJ7B 4AOFA 4ESKA 4G7YL 4LASL 4G6KL 4XZUA 1XGPA 4RWHA 4B9FA 2XZAL 2JJTC 3T4AC 4ZMOA 3RPIB 3DPBB 3ESNA 3ZDYE 1T1XB 4ZPVA 1JGIA 5IIEB 3P0YH 2QDWA 3R7RA 4O2CB 2VIRB 3LKSA 3S3SA 3T6XA 2F54E 1EEZA 1LO3H 3LJ3A 4ZSOE 1BVLB 5HYQA 3II1A 3ML8A 3NQIA 4KO7A 3P69A 5SV4A 5CGMA 2BIPA 4DO6A 1DN0A 2ALWA 3HLAA 2BH0A 3VGAB 1H6UA 2PO6D 5HDOA 3Q1SH 4WFHE 1NMCB 4OGXH 4XI5D 3KWUA 3QYMA 3JVGC 1T22A 3NQKA 2MOVA 4G3YL 4FJYA 1AKPA 3VXQA 3IDXH 1JXJA 3OKEA 3QI9B 2VXQL 2YWYA 4BE6A 3ARBB 5EBWA 1E5AA 5EO1A 2FIKB 2VWEC 5I0XA 5ETUB 1JFQH 4XCCL 4E9WA 5JW5B 3AU1B 4RISH 5IF0A 4OAWA 4Y4HA 3EHBB 3ECVA 1MN4A 2JJTA 4PCSA 3GLDA 5A2AA 4NXKA 4OV5A 1DLFH 2HTLD 1BQ5A 3MLUH 4KFZC 1L8FA 1KJ2A 3RTQD 1KY7A 1BW8A 5G4NA 2EUZA 2B1AH 1S7WA 1DJHA 3BWAB 3CZBA 4D0DA 4HDIA 4PN6A 4G9FE 4X9IA 2YXMA 5IQNA 2E2HA 3FSVA 4J8RA 1D5BB 1K3ZA 2B1AL 4KXBA 4M3HA 5BV7H 3K2UL 3HU2A 4NZUH 1EFXD 3KVPA 2NX5A 1FE8L 3SO3B 5JMOC 5LDUA 3EF7A 4B27A 1P5VA 3GBLA 4JFZL 1UZ6F 4P07A 5AW5B 2YMXH 1LK2B 4PRNB 3D33A 4AQ8A 4ZMTA 2JK5B 4M1GL 4U1HB 1EO5A 5A2JH 4J7RA 3CIAA 1PQFA 1A2YB 2PF6A 2J8UE 3BHBA 3BSGA 3GB7A 3KYAA 3VXQB 3ZZ1A 1MZZA 2AJXL 2QFRA 3VI3F 1EFXB 2VMCA 2YGOA 1UM6H 3JTTA 4HKXB 5F7UA 1TVBB 5KSAA 2DQDH 2OMXB 4FXTA 1RZKL 1WE5A 2YD7A 3KGSA 2V2WA 5DJ8A 3IJ9A 3S37X 1OQXA 2OTUA 5KBKA 3T6VA 1UT9A 1QBBA 2YAEA 4JL2A 4F57H 4Y89A 1KJ3L 4IRSC 1R47A 4XP4L 5GLYA 1BPLB 1SUJA 1CQKA 4N2MA 5B39G 3ASWA 3QIWD 4CDHA 2CIKB 4OCSL 2UWEF 2ADJA 4KK6D 3CXHJ 3V0FA 2D4FA 2LOEA 1E90A 3TEXA 5B8CA 5J7CC 5FYLD 1EEYB 2Y5TA 3VI4E 5CZRA 1JE6A 1VCAA 3VXNA 4K9JA 1YNKL 2OBGA 1Q1JH 4YFLI 2E2IA 1OTUD