2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
molecule tags Cell adhesion
molecule keywords YOAJ
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
1WC2A 2PICA 4JS7A 2HCZX 4FERA 4FG4A 3SUMA 1L8FA 3X2IA 3X2KA 3X2GA 2PJJA 3ENGA 1BW3A 4FFTA 3SUJA 1OA7A 4JP6A 4FG2A 3X2PA 1HD5A 3FT1A 4JJOA 2AE0X 3FT9A 1WHOA 3X2HA 2ENGA 5GM9A 2BH0A 4JCWA 2GAEA 2G6GA 5H4UA 4JP7A 3X2JA 5GLXA 2JNZA 3X2OA 2G5DA 3CZBA 3SUKA 2VXQA 1N10A 4ZM7A 2PI8A 2PNWA 3D30A 3X2NA 4L48A 3M3GA 1OA9A 5GLYA 3X2MA 3SULA 3X2LA 1WHPA 1BMWA 4AVRA 2KQAA 4ENGA 1BW4A
chains in the Genus database with same CATH superfamily
2R0ZL 3QUMH 2OYKA 3KYKL 4E9YA 5A3IC 4LCUA 1R3JA 5KUKA 4P3WA 3QCUH 3TF4A 2YJQA 5JW4N 2FL5B 1CXHA 2VQUA 5DEFB 5D7LA 3VXQB 4A7UA 4JW3A 2NQCA 5EBMA 1F3JB 4JFVA 3V4VA 5IKCB 2EIBA 1INQA 1VFMA 1IVLA 2BZDA 2UXVA 4FTVD 1KC5H 3CFDA 5HDRA 1FCCA 2OBGA 4OD3L 3UAJA 4ZNEE 5LG6A 3BZEB 3ECQA 5L4IA 1DVFC 1L7TL 3RWJB 1QLEL 1GGTA 4TQEL 3NCJL 2LLGA 3GDBA 4OF7A 3KYAA 3KPLA 3NGBB 1AGBB 2BOCA 3T0BA 5T1KA 2Y3AA 2XU9A 2YN3A 3GF8A 5BVPH 5KVFH 3QG6A 1JGLL 3OF6A 4BFBD 5FO7A 3BKCL 4PVMA 4KJYB 1OIOA 2X53A 1LNUB 1R27A 2ADGA 3L3DA 1HZHL 3QGVA 4NRXA 4XWGL 3RWEA 3WKQA 4EAEA 4BSWA 2NT1A 1C5CL 1MW3A 4H25A 2WLKA 5E6IC 4P2QD 3C2AL 3UYOD 5F7AA 3RIAK 5CU5A 2A3TA 2VABB 5KYWB 4XBGA 2HN7B 3N55A 3QR0A 3H6JA 4EN2A 2NZ9D 3BLBA 1RUAH 3EJCA 4NENA 3WUWA 2YAFA 4A2LA 2BVPB 4IK6A 4HS6A 1UM6L 1R5WB 3NH7L 4UTBL 2XQYG 3DOHA 4G6AD 4QAWA 3QIBA 4KFMA 3TLRA 3EBHA 4F80A 1HQ4B 4QXTA 3KPQB 1NINA 5I1GH 4XGZA 3VXSD 5ITFB 1JTTA 3UIZA 1I85A 4JGUA 2VT0A 3VD1A 1GGIL 3H85A 1VA9A 2GJ6D 3R06A 5AW2B 5IW6B 1A4JA 3L4UA 4ETQB 1OSEA 3P4LA 1WG3A 5IOPA 3W39B 2TSAA 2A0LC 3SGDI 4I2XE 1SIWA 4HGKC 4IRZA 1ZV9A 4BM7A 5IMMA 1SOKA 2WNGA 2C1PA 2Y25A 3PWJB 2B63A 2H7WA 3DETD 3JUZA 4IIQB 1BVNP 1SLUA 3BUBA 2VC2L 4PJEB 4I5BB 2CDFB 4A7GA 5JW4R 2X40A 3RE0A 5K9JL 5BZDA 1BQSA 1F8TH 1VF5C 3EOAA 5C0BD 5JHMA 1Z9LA 5GJSH 5A7EA 1BM7A 1IJ9A 2X4PB 3II2A 4K5OA 1RUPH 2GJJA 3NGBC 2YMOA 1S5HA 2QPFA 4ZX6A 5JMRA 4MS8C 2ZKYA 4MMZC 5E6ID 4LESA 1AQDB 3IAPA 3TBSA 1UOKA 5F3HB 5H94B 3V4VL 5C0CD 3TP4A 4F9PC 1EXUA 3ARGD 5I66A 5GS0D 2XQBH 2DQIL 4BKSC 1G9ML 1HQRB 5TE7L 1R3LB 5F9JB 1GCYA 5F96H 4KQ3L 4LSDA 3CZSA 5C70A 3DV4B 5CSZB 4NC1E 2AJUH 4LMQE 5KYUB 3ZDYE 4PJHF 1IBBA 2YAPA 1ITBB 4JRLA 5FHBL 2NY3C 4YBQC 1ZE3H 3HLKA 3FQXA 5AKVA 5CEZL 4K7PY 1JDCA 1NCAL 1A7RL 4CKVX 3O3BB 5HI3D 4Z8FL 2OXGA 4LSVL 4RISH 2X9WA 3FAXA 3RWGB 3QJZA 1A6ZB 2AF2A 2WN3A 1KCRL 3RVXD 5BOZG 3A24A 1HXMA 3CDCA 3UTQA 3EOBB 2L7QA 3KWUA 1J7VR 4G5ZL 2LFEA 3DGGA 3EOTH 4H8UA 2CO1A 3AXIA 2VDNH 3FCUB 2RA1A 4KY2A 1HAWA 3QXTA 4LU5H 3DVIA 4PJBB 2ZAHA 3QZWA 1N3NA 5DHYA 1U8MA 4K3JH 5DHMC 4MZRA 3PHQB 1ZSHA 2A73B 4ONGL 2XWBA 4QJ5B 5CEYB 2WQRA 4MCZB 1ZLWK 4FERA 5AVUB 4XCCL 1P5UA 1URZA 3DO7A 4ONGH 5KSAD 2MCPH 4ONOA 1A3RL 2G4EA 4TSBH 1F97A 2MWCA 4KY1L 3PIQA 4LLUB 2XZZA 1JUFA 2GBAA 2P7TA 2IQ9H 1RVFH 1ZHNB 2X2JA 1DVUA 2FWUA 4QRRB 2O26U 3CU1A 3GXIA 5EZOH 3VFWA 2HPTA 4LHQB 1FUNA 3N85H 4K9EL 2BNQD 5H37H 4Z7OE 1EX0A 4RFNC 1R3KA 1G84A 4UOW1 4R26L 1BAFL 5I2IA 4L0ZA 2DIJA 3NJXA 3M8OL 3E1ZA 5HVHC 4GI8A 4PM1A 3LKOB 4LLVB 1NCGA 1V7MH 1MRCH 5JUEH 5ALCH 4GKSA 3MRNB 5BRZB 5CFHA 3S37H 1LP9E 3LD8C 2GTWB 5E9AA 2Y7QA 4FMVA 1I3GH 4Z7WB 3RPKA 3H7BA 3QIWB 3JV0A 1OGAA 1XEDA 2HUHA 1O6SA 5DI8B 3FRPA 5TE6H 3MMEB 4GQQA 1S6NA 5C3TA 1MIMH 1S7TB 3IMUA 5IB3A 4HCRA 5F3BA 5T1LB 3O3DA 4U7MA 3RVTD 3GT6A 3NG5A 3EYSH 2Z4QB 3AREB 4APXB 5JIQA 1HHIB 1KDJA 4YGAB 2NUTB 3QO0B 4HWEL 4A7GF 4ZMZA 3KXFE 3PQYA 1F4WH 1A64A 3JTSA 3AU0A 4DKFH 4NHUA 2J6WA 2WKOA 3X13A 5JORA 2IAAC 2IOIA 3FQUA 3DUSB 2Y22A 5E8OA 4QJ4B 3MRCA 4JZNB 2P5PA 3PAZA 1TG8A 2K8QA 1IGYA 1IARB 3D3VA 1RZFL 1MCLA 4QRPE 5JPNB 4XB7A 5BRQA 1QAWA 3JV5A 4IBUA 2OZ4H 1S7XB 4UTCA 3IDXH 4UOZA 1SOQA 3MRHB 1J1XL 1SM3L 3ARSA 4Q2ZB 3CZFA 4YDZA 2NOYA 3W56A 3L3OA 5IW1A 4CU6A 2X10A 4LRIC 4PIBA 2B4CL 3GMQA 4XVTH 2IXQA 5E4EB 4OKVA 4LRIA 1UXSA 1XGTB 4WI3A 1SY6A 1E61A 4ZMLA 2DQGL 3B1TA 2AFNA 4GIAA 2NTFA 3B34A 3V10A 3TURA 5IHUL 3V0VA 4LOFA 3B7YA 3F5WB 1E9PA 5EO0A 3A6BH 2X4OB 3EFFA 1KIRB 2WBJA 3DX4A 4JPVL 3AXLA 4TTDC 3WN5B 3HUJA 2CKBA 1IL1B 1ZJBA 3EXLA 3ZE0E 3ASNB 4NHCL 3WL9A 1JRHI 2ZCHH 3NFSH 4G9FD 1DDHB 1XX9C 2DD8H 3QPQC 4YR6B 5J11C 5GGRB 3SYCA 4PRAB 1YEEL 1SDDB 3Q7JA 5D1QC 4DQOL 4NM4L 2EO7A 1ZT7B 3DMMB 3DRTB 1Z9SB 4HEME 4PY7A 5DWUL 5C0ND 3RX5A 5G4NA 4QRBA 1DBJL 1GGBL 4LO9A 2GI0A 2ESVB 2KH2B 2PI8A 1TQWA 4WNSA 3O11A 5KVFL 1C7TA 3TIEB 3RTQB 5E0FA 1U30A 1U3HD 1WGVA 4Y9EA 2BDNH 4JDVA 3ZSSA 1DQLH 1MJ8H 2WQWA 1YEHL 1LEKB 4OU3A 3EYVB 4WWPA 3QXUA 1PDKA 3QS3A 1L7TH 2LT9A 2ZNWA 1TJMA 3I75A 4OCWL 4K3DH 2A6ED 2ZUTA 4MJIB 5JNYA 1YC8A 5B1AB 1F1GA 3U9PH 3DMMA 2ATPB 1O9VA 3DRTA 3OKNB 2JSFA 4ZDHB 2XQYA 3FHAA 1U2CA 1BX2A 4JO3L 5FKAA 5SWQB 4IOIB 5HJDA 3Q6FB 5SX4H 3TEWA 2VPXA 1KT2B 3UBHA 4QOKE 2D2OA 2HJFA 1KUMA 2GJZB 3KNBB 2BC4B 2UXFA 4MQSB 1OHQA 1TFHA 4KZEH 5IMLA 5DVLA 1ZK9A 1KTLA 2G0KA 3MRLB 4YHOL 2YD7A 1ZV5A 3V9CA 5E6UB 3CN2A 5A7BA 1NMCC 2GJ6B 1RKRA 1TT6A 1N67A 4FABL 2ATKA 4MMXA 1UXMA 3L5WB 4E41B 5HHXH 1UXWA 4F2FA 1QVOA 5JHDA 5CEZD 1SJVA 4HA1A 4J27A 5KSAA 1BREA 2YPKA 4MD4B 4AYMC 4DCQA 3T2NL 1GYAA 3ZTDC 2B16A 1JK9B 2BE5D 1TWAA 3KYNA 5IQ9B 2R2HB 2CGYA 1U8OB 2OQJA 5JR1L 3HBQA 3KL3A 3QHFH 3VD0A 5EU5A 2YMXL 2VR4A 2XHNA 3GHEL 4HG4J 4H44C 4XP4H 1NAML 3O3AA 2A38A 3EAKA 5EEZA 4EIUA 2NY6B 1KWKA 2YU9A 4LF3A 1KDIA 3BWUC 4GLRI 1LK2B 1RZ7L 2LOEA 3L7FA 4ZPVA 4ZAKA 1IKFH 3SPIA 2IV2X 3MRPB 2FK9A 5C09D 3TA4D 1YEJH 4I89A 5D8JH 4TUOB 1FL3A 2OMYA 5FA4B 2OW6A 2Z4QA 4XXWA 3FFDB 1D5XA 5GZOD 3R1GL 2QHRL 2VLLA 3FK3A 3NFSL 2DM2A 4GXFA 4TUJB 4UUJA 2Q6WB 1FC1A 5EU6E 1DQQB 3F12B 4KK9D 4P46C 3A6BL 4GRLB 1S9XB 3O6FA 3BVNB 1NGZA 4YLCA 1X7SA 1SQ2N 3GFUA 4PB9H 2C1OB 3GZPA 3PUUA 3C09C 4AKPA 5EZIH 4JFSA 1L9SA 3VFMA 1YY8B 3TIDB 3T2OA 5ACZB 4KJWC 3OXRB 5HYSB 5F9OL 1BZ9B 4KK6D 1EUUA 2OCFD 5DHVH 1NBZA 1K6QH 4J8RA 2OMWB 1DEEB 5D7LD 7FABL 4MMYB 5EUOA 2R69L 3IPFA 3V52L 3MO1B 4EDXB 5JW4M 1I1AC 1QUNB 2P45B 2WWMD 5EU3B 2DDQL 1JZ8A 5KZCB 3LMJH 3KPMB 2KT6A 2JA5A 5LLIC 4ZFOB 4LIQL 3VXMB 1IW7D 2ZWYA 5BV7H 1OD9A 4NI6A 3BP5B 5I0WA 4PGEA 1UUNA 2EIDA 3L5XL 3VG9B 2E7LC 4J8QA 5KVDE 2XXCB 3HZKB 4RGNC 3EO0B 4HIXL 3V0WH 1DEEA 1MJ7L 4FQ1H 4WV1A 2I07B 2Q9OA 1ET5A 4GO8A 4GO6B 4P99A 1OAQH 3L3KA 1MJJA 1YJDL 1GHFL 3X3FL 4XBEH 5TQ0L 1KNOA 2F58L 3B9EA 3A6CL 3H55A 3MOBL 2P8MB 4R7DB 2P3YA 1I1FB 1SLXA 4PJBF 3ROOB 2RFXB 1ZT4A 4Q9BA 4X80H 3VGAB 3FO0L 2XQYK 1KULA 3PP3K 1EXGA 3PJNA 2R1YA 4I8DA 4ODSL 5BMFH 1I8KA 1S7RA 1UZ6E 4P59L 3SGJC 5KANG 5HGBA 4DP6X 1D6EA 2WXRA 3ES6A 3KJ6H 2XV0A 4B7LA 2IPKB 4KO6A 3K5RA 4N8PA 1H3PH 5JDJA 1KBKA 3RX8A 1Q9OA 1RZ8B 2BNRB 3ROLA 2XN9E 3GSXA 4JFZH 2ZJSH 3MFFA 1T03L 3JYBA 1HH6A 3B9KB 1FHGA 4HD5A 3SE4C 1YG9A 5DS8A 5EOTB 4BINA 4AEEA 3ESMA 2P5WB 4Y1TA 1CBJA 1MCPL 1NMAL 1T5XB 4BZ1A 2ZCLL 5DK0A 4APQA 5D71H 1RP8A 3NIDE 3TBVB 1NGPL 3FONB 4YZFF 5ANMB 1M3JA 1ZXKA 3Q44A 1MFEH 1UD8A 1QQDA 1VAHA 2HRLA 5DVMA 3RUGF 5BUAA 1MHEB 1RY7B 3O0RL 1AGEB 4Y1AE 2ZTBA 1W15A 4Z7NF 4NXSA 3GWJA 1LO2H 1P5VB 1YZZA 3DX7A 1AR1B 2B5IB 1IB5A 3JZYA 4ADJA 5KVGH 4G7SB 1M7IB 3HC4L 2IH3A 3UAJC 4NBZB 2APTA 2DQTL 1ONQB 3HB3B 3PGFH 4BZ2L 3VFRB 4X7TB 2Y23A 5FF6A 4X4ZA 3LRMA 2VAAA 3MI6A 4XCEA 5DJ8A 3FCSA 3SDYH 1M2VA 4DPRA 3FW6A 4LU5L 5CBEA 5GZNC 2HWZH 5ETUA 5E2UL 4BFIB 4WFHD 2IWKA 4GBXB 4J4PC 4PJEA 5IG7A 1BZEA 4HX1B 2IBZY 1EPFA 2C3VA 3JXAA 5T3XL 5C8JB 1KLUB 3MRDB 3ESOA 8CGTA 3PWPE 1CR9H 2B77A 1NIAA 1V7NH 3WFHA 1NGQH 2W5PA 2CO7B 1XMEB 3CMGA 4PRBA 5ID0A 2X6AA 5C0FB 1GVIA 4QYOB 4YHIB 1WVZA 4UU9A 2P5WD 5C2UB 4M1CD 3REVA 3TTYA 3KWTA 5D7JB 4X9IA 5JIMA 1GGCL 3OGCA 2I24N 1SYSB 3H0GA 2KS0A 2X6UA 3AY4A 2J44A 1FIEA 1CPUA 1Z3GH 2EICA 3BGMA 2JF1A 3EJYC 2RACA 4K3EL 5CJBA 1X6LA 5B38A 3WUWB 1MNUL 3EYOB 4KVCL 3VRIA 1B0WA 2X2IA 2ITDA 3N1QC 3GIVB 3QIUD 1F42A 5INDB 3C75A 3AAZA 3HG1B 1I85C 4CMMB 4CVXB 2LGNA 3GD1C 4X7DC 5DJ6A 1C8PA 3O3EB 3MJ7B 4K94C 4OJFL 1CO1A 2E56A 2QZQA 1TWHA 3B2PA 3FU0A 1Z9SA 3EJPA 2F8VA 2D2CC 4BQ9A 5E08L 4HIXH 4M6OH 3V0WL 4BSWB 4HJJH 1RZJC 5HHNB 3W0WD 3GUFA 2IDFA 3WUWG 1YMME 2XN9D 4K8RD 2PO6A 4BH8B 2R4SL 3EDKA 2XBDA 2JFCA 3QXWA 1Z3RA 2VL5B 2VUMA 3WD5L 3WN5A 1ROWA 2FO4B 5C0EB 4W70A 4J4PA 2NY0C 2OK0L 5TE4L 3V0VB 3FFCD 1ZHBB 2X7LB 4J3SA 4X6CF 3PL6C 5IM7A 1TQCC 2C3HA 2X4RA 4GYBA 4JQIH 2G60H 4CDGC 4PRBB 5JPMC 3VDAA 2AANA 1UT2A 1KGYE 4O02A 5EDSA 5FLVA 1ECYA 5LXGH 5DJ2A 4LBEB 4XMLH 3U0PB 2CBPA 4U6TA 5E6RB 1KB5L 1L9OA 3UTSA 2NR6D 4HEMA 3P3UA 2B15A 1CZ5A 1ZOXA 5CJQL 1KEGH 2Y5EA 1KENH 3MNWB 5JW5A 1U3ZA 4MRBA 4NBXB 5I8KL 3GBDA 5CGBA 1YSOA 3D18B 2RGSA 3NACL 1DJHA 1YEJL 2F68X 4GUOA 4OFYD 4U7KA 5JORB 3A4FA 3FRUA 1N5AB 2DN7A 4R4ND 1E18A 5LNEA 2BP8B 1A3QA 1D5RA 2C9RA 1HZHH 1WBXA 2NLJA 4M7JL 4NUMA 3LSOB 2R0KH 1RJZA 2ZWKA 4RBPK 4NZ8A 3FF7A 4RMRA 1I4FB 1N2RA 1A4BA 3O3DB 1U8NA 4L37A 1JPGB 2Q86B 3BVUA 5F3BB 1OTTD 3FONA 2XRAL 5B1CA 3VX0A 1F6FB 3HKFA 4JFUA 4YUEL 1D5IL 2EO9A 1K8DA 4R2GB 5HHXL 5KS9B 4RZKA 2ZP9A 1UJ3C 1MCWW 2AMUA 3CZUB 4DN4H 4QKXB 4YDJB 1WUZA 3UG5A 3E8VA 1T1XB 2IBZX 2ZXGA 4Z95L 3QQNA 5JPMA 2XA3A 3WKML 4HK3J 4OY9A 5FUOH 3DURA 1L0XA 1TYJA 5BV7B 1JGEA 3V7MA 1OZTG 3MBEA 4GAYB 4P9HL 2BJMH 3JZ7A 1WAAE 2JB6A 4JZOB 4P4KC 4QRRA 4ZSOA 1FBIL 3DTUB 5LBSH 5J1AB 1DFXA 2K6WA 2P7TB 3U25A 2NYAA 1HOCB 2XG4B 3DHJA 4JG0H 2FSEA 5C09A 4N0UA 2SEBA 3BT2L 1WA2X 4JP7A 2FJSA 5DHVA 3U9PL 1T0NA 5ALBH 4I3RH 1XGZA 1H3WM 3MRBA 5HDOA 2QLYA 1BZ8A 2XWBB 3FN9A 4KROB 3HNTH 5AW6B 4TVSa 3UROR 5I1JH 3B6SB 4A67A 5I18L 4G7VL 1TUPA 2FDBP 4JPIB 4KKCC 5ALBL 1YEHH 3GSUB 1IBGH 1N3NB 5JXEC 2DYPD 5EU7E 4OLEA 4E2OA 2YARA 4F58H 5D1XB 1HNYA 3GMPB 5FLUA 5D6CA 1GS7A 5B7FA 1B3JA 3MN8A 4QO1B 3MV9E 1FBIH 5LBSL 5T8IA 3CZKA 2BVTA 4PRDA 4Q97A 2JJWA 5BRZD 4H20H 4OLZH 4XMPL 4IHOB 1YCSA 2EDFA 4FQJL 2XWDA 2NYKA 4DMRA 2AQNA 1UCBH 3APFA 3VQ1C 3K3QA 1L6ZA 4Z95H 1JCKA 1AXIB 2ROXA 3UERA 2DOCA 1G8KA 4V1DD 4Y2DD 1KLGB 4Q58C 4A2FA 2V6HA 4QOKB 4X98B 4FA8A 1PZSA 2HJLA 4HUKB 4PRIA 2X44D 1G43A 1IAKA 3DC0A 1CD8A 1M71B 3NJHA 1Y07A 1YYCA 2OR9H 2UUDH 3QULB 2EDYA 4LP4A 1WCMA 3NZ8A 3V0EA 3AMKA 3QEQA 5I66B 4LKXB 5ITBH 1TSRA 5DFAA 2OMZA 1GTFA 4C83B 1AQDA 1N0LB 4E41E 5K59E 1OD7A 4RIRB 3R7QA 3A0OA 4XAKE 4G3YH 1CDCA 4DAGH 3NCCB 3TS8A 5GHWL 1A9EA 5JQ6H 2YUVA 4GG6A 4X6CA 1AE6L 4Y5YC 5T33H 3U79A 4X8CA 4EIGB 3NACH 4WFFE 5IK3A 3X11A 5I1DA 4OLYH 4QYOA 1TQBB 5D96C 1J12A 1MKFA 5DFTA 4NRYB 1NWPA 3CFBB 3Q0HA 2CNYA 3CCHA 2X4UB 5B4MD 4P8QA 1DJIA 5I74C 2GJ6A 4OLXH 1AKJB 1DSFL 3VWKB 4O2CA 1FL6B 2WBKA 4MJ6A 3C6SA 3CFIC 4NZRH 4KRPD 1OK8A 1EGJA 1HL9A 2OTWB 4R7NA 5ESVA 4M7KH 4NYLA 3BKML 4WNJA 1KYOJ 3U7WH 4JX0A 3C6LA 2CO2A 4G43A 4QF1B 4WTXA 4EEEA 4I0PB 4HSCX 4ANUA 4TVPE 3VW3L 2O30A 1QBML 2X4SA 1SVBA 4KUCD 1XCTB 1JL8A 4HS6B 2FWSA 3BD3A 4R97C 4XP9H 5J57B 5DD6B 4KI1A 2GHZA 1OCWL 3UTTB 1KJMB 1P1ZA 2FLMA 2VABA 5IR1A 5KYWA 3D2UA 2OMVB 2DJMA 5KAQG 4FLHA 1YNTF 3U1QA 4LEXH 4QRSA 4XNQA 2X0VA 2WHVA 1HX0A 1MEXH 2BNUA 2OJZH 1T1YA 3KLAA 3WTYA 3S35L 1N19A 3NK4A 1Z9NA 5E2VL 4KI5F 4JFQB 2AAVA 5HYJE 1QX1A 1KY7A 3CZGA 3U0TA 4Y5XA 5JLZA 4CGUB 4JO5A 3MYJB 3NIGE 3QBTB 2VLKB 1D6VH 1FLTX 4K3EH 3RGHA 4DFHA 4TULH 1ORQB 4UU9B 1Z0NA 3ZDXB 2YKLL 4XC1H 2E3VA 2BMKA 1P9MA 2XXGA 1LM8V 1Y1UA 4HQQL 5D1QB 1U0QA 5E1AB 4CS0A 7CGTA 4WEMB 2NSQA 1CYXA 3ES6B 4U6YB 3FU8A 3IU3B 3M6DA 1HH9A 1I8KB 1S7RB 2FL5A 3B3IB 1X5KA 3DIFA 3QAZB 5L2KE 4KPHL 2BXYA 3AXLB 1A4AA 2Y1AA 4L3AA 3TBTB 3NTCH 2WINB 3C09B 3FUFA 4PS4L 5IZ7A 5GRVL 2XLLA 5HI4D 4GIOA 3ZR5A 1FVCA 2WTRB 3A5VA 4LGPB 1IGCL 2ZONA 4U6YA 1BW4A 1AZZC 1N59B 3EH3B 4PP2B 4AEIH 2GIYA 4F57L 1JXFA 4LSVH 1IQWL 3KCPB 4MXWH 4NT6A 5KBPA 2KZ1B 3FQRB 3MLYH 3JWNH 4LSPH 2VXQL 4LVNC 1RXLA 3MLPA 4KXZI 4B0MM 4BIKA 1UWYA 1XF3B 2YK1H 2KLSA 4WSJA 1JD7A 2DLIA 4BZ2H 2DKUA 4OJDH 4OCXL 4WI2A 5H4UA 1WAAA 2N7AA 1M7UA 2XWCA 1V5JA 1TVBA 2MOQA 4PS3A 4XC1L 4DOHB 1I9EA 3ILPA 1I75A 3HN3A 4P23B 5T5MD 3KS0H 3HR6A 2DBJA 3EYQD 4KQ3H 1XFPA 4XPFL 4R96B 5HDQL 2R0WL 2PKDA 2LVCA 1O6TA 5CD3B 1HHKB 2ZUVA 4F8NA 4LCCB 4H5SB 1HXKA 3GLZA 4MA8H 3DNKA 1ADQL 1CGSH 4IS6A 1HH6B 3D33A 3ABMB 4M43L 4DKAA 3GS0A 4AGNA 2O93L 4JY5H 2VPZA 2CG9X 5A6MA 5LDUA 1RUPL 1PW3A 4CVZA 2B08A 2A69D 3G6JE 3Q6GL 4UF7C 2ADJA 3HI5L 4B9IA 3CQQA 1HKLH 4P5SA 4M6MH 1RCYA 4ZQKB 2XFXA 3BP6B 2BSCA 2IPTH 3QW9A 3W11C 4OIFA 3B2UD 4BH7B 4L1BA 1ZEAL 43C9A 3GSRA 1KF9B 2GBTA 4M00A 1AA6A 1N6UA 4XN2A 3LXBA 4NQED 3DBXB 4DHLA 1TZAA 4ES9A 2X9XA 1QBMH 3X2GA 3B5GA 5BMFL 2VR6A 3PWPA 3ARDD 4NQCD 3VI4A 5EUOF 1VRSA 4JFXA 4DO6A 2F1AA 1R24A 4E9SA 4J3TA 3NK3A 1NGWB 5HPMB 1WLFA 3EO0A 4JM4H 3D3VE 5TQ0H 3RBSA 2E86A 3DMMC 4NRYA 2EUXA 2DTMH 2D3JA 1DSFH 2G2RB 1CDJA 1NGXA 2K3HA 2PPEA 4XN7A 4TQ8A 5JYMA 2TRYA 5G4OA 5IK3B 1AYOA 5FO9B 5I8CA 4G1EA 4ZSOE 4AUUA 2NTSP 1OP5H 4AG4H 3FTZA 1QNIA 4N1EA 3PWLA 4HSQA 5CEZE 3ZKMD 1YEKH 1GSMA 3P3YA 3PFQA 4QTIH 1N59A 5EOCJ 5J89A 4X99A 4LRNL 2OL3B 1KV7A 2OMWA 4TNGA 1IGMH 3KLSA 2XWRA 3F58L 4NQSA 3TBYA 4RCAA 3BW9A 4K23H 3CN3A 1E65A 1OQOA 4WI0A 1HSBA 3TO4A 4OCNC 5CZRA 2PW2B 1CN4A 1E6OL 3HVDA 2N4IA 5I73C 2FSDA 1J5DA 4LSQL 4YVNA 5FECB 3EBIA 4V2CB 3VGGA 3VFOB 2GUOB 4L29B 3H3PL 3M1CA 3Q6FA 1U91B 3THMH 3SBRA 3WNNA 5I1AA 3IXTA 5EZIL 1BF5A 4HALA 1PFOA 3SN6N 2VYRE 4K94H 2GAZA 5LBVA 4PJXA 4KOBA 3LKNB 1LEIA 5E2TL 3UTQB 2FX9L 2JIRA 5HHQA 4Y4HB 5E9DB 3O0LA 2VQ4A 1YMHB 3QZNA 4M03A 3QR1A 4NN5B 1NFIA 4O2EB 2G9HA 1N9PA 4Y5XB 5JLZB 3O2VH 3T6WA 3FQXB 2NY6D 3I6GA 5D8JL 4XNZC 3HN5A 2OYPA 5F71A 1DANT 1UCBL 3VSTA 1JPEA 4XAWL 3QZBA 4A68A 1R3HB 2PW1B 4OZHF 1KJ2A 1WTLA 2R0ZH 3P77B 5KANI 1OE1A 4ALAH 4HAKA 1CFMA 1YQ2A 4H20L 3IVKB 1YNLH 5FO8A 1MAJA 1IE5A 1GZPB 1RQ5A 3DHUA 4XNAA 1SDDA 1G6RB 1FGVL 4PGCB 2V2XA 3LNHA 3A4EA 3TNNA 2M8XA 3BD4A 5GGRA 4WUUE 3B43A 3RNKB 2NW2A 1H8NA 1WH0A 1PLGH 5AAMA 4G7VH 4B6ZA 3QT2A 1AHWC 1KQGA 3L95B 1K4DB 1KOAA 2EIZA 3E6HB 3EFFB 3RU8L 4EQ2A 4BWUA 5EO0B 3AY4C 4OZ4A 4NFBA 3OTTA 2YUXA 1KEMH 1ZGLA 3UGUA 4AE1A 4YHOH 1WS7A 4Y9BA 5B39A 5KVDL 2E7BA 3PY9A 1SNRA 4CW1B 3JT0A 4J4PD 3BWAB 3KWVA 2MIZA 5IVNA 4Q9CA 5IT2H 3T0EB 5JPMB 5EN2B 5J7CC 5FW8A 2VITA 3AVEA 3CK0H 3NSCA 4M8VA 3KPSE 4YDJA 1J0ZA 5CGTA 2NDFA 4U6HB 3SPGA 3X1EA 5KYYB 2X38A 2QQQA 2CUHA 1F58L 3PCYA 4HJ1A 3RRQA 1AR2A 5G55A 4WLCA 4FP8L 3P4MA 2YO3A 5ITFA 1KPUA 2PP9A 4KX7A 1SGKA 5ES4B 1PDKB 3K0WA 3S98A 4DH2A 5AG9A 3HG2A 3LQMA 4JDVB 3L9YA 4M8QA 4XHQA 4C56B 5AB0A 4HCIA 3ARGC 2IAMD 5GGVY 2FX9H 3BESR 3MRCB 3QZPA 4WGKA 1I3UA 1JHLL 3BN9D 2P8LB 2BDNL 5A16A 4NLHA 3RGVC 3IDNA 5I76B 3RLSA 3UADA 3UZEC 4HUUA 3SDXB 3P69A 1E5BA 1DVYA 4W9LC 5CFAA 2R7ZA 2E8YA 4HEPG 2Z35A 4MNHB 2NY3D 2Y36H 4QXUL 3VXSB 1BF8A 4FRWA 2PPAA 1I7UA 3LTVA 3W0WA 4RSYA 2DH3A 1IAIH 2YZ1A 3EFDH 4PVLA 4BZ1L 1GCFA 1WCQA 1TJHL 1EZLA 3ZL1A 4EIBA 3D69B 3IFNH 2NY2D 1C08B 3KW8A 3TONA 2P24B 2X0WA 4LK4A 4AK2A 2E9WA 3L16A 3IJYA 2BZCA 4XMWA 5H4ZA 4NQDB 15C8H 2ITEA 1J9CT 1JMXA 3MRNA 4E9TA 1U41A 2VXTH 1FORH 2QTVA 4OZHE 3VM5A 3VXRA 3T2LA 1EIBA 4F7PB 25C8H 3GSVA 3S4SB 4Z77A 2K9FB 3DPBB 4FEMA 4MNQE 4F7MA 1S7VB 2CO4A 3WFEL 4ZUVB 3HC0A 2VZTA 3JBG7 5IW1B 3F83A 5G5DB 3CAFA 4JPIA 1YLBB 3UZVB 5EZLB 4OGAC 4UIKL 4JGMA 3PP3H 4L3CB 4E41D 5KVMC 4R4FL 3RL2B 3U0TB 4WFFD 3UPRB 1NQBA 3IKCB 3W5MA 1RJCA 3CPLA 3Q05A 1RV6X 3OZ9L 2IFGA 1MAML 3LJ3A 3WEAA 1T4KB 3NESA 2JKSA 5L4MA 5EIVA 4U3SB 2HMIC 1RJYB 5KVEH 3O2DH 4Z3JA 3FQUB 3FO2B 2IPTL 1CLOH 4QHPA 2XWJA 2V33A 4HXBH 4NNXB 4XAKD 2VDQB 3S5ZA 5HYQB 3H6AA 5FYLD 3I3EA 4J1UA 3E8UL 1XQ4A 3NJKA 1ZPLA 1VGEH 3KYMA 3L45A 1YNND 4P0DA 1ICTA 3S7GA 5E1QA 3G5VA 4M43H 1UKQA 1CGSL 4LKCB 1TPXB 2HYMA 4FEIA 5DD6A 5F7DA 1EEZA 3QQ3A 2PXYD 1SJEA 4MDRA 4P23D 1MCBA 1TTAA 3HPLB 2F7RA 4LGRB 1KELL 5F93C 1IX2A 2HA1A 3Q1SH 1BZOA 5DO2C 1YN7B 4NC2B 4P5KA 4U1SB 3ZDZE 3GXPA 4DF9A 2B1HH 1CFSA 2MQ0A 3I9GL 2OTWA 2CZNA 1SHSA 3T08A 3G7TA 3JWOL 2K9UA 3MRKB 3FH7A 2YK1L 3P73A 2ZCKL 1I3GL 4XCFH 3MV8D 1W8EA 3B2XA 3GIZH 4HZLB 5GZND 5LQBH 3WEBA 1N8ZA 4Z1PA 4F7KA 5HVWA 2A9BA 2H47C 3KWWB 2NQDA 4Y16B 2W60A 4MJJA 3TH2T 3UYRH 3VI3A 1T7XA 5I1DB 3BP4A 4F24A 4UDTA 4MNGA 3EJQA 4X6CB 4OZ4B 4BFIA 3G04A 3CXFA 4D9RD 3DJSA 3KEHA 4QRRD 5AW4B 3I9AA 3J07A 4A7TA 3VXPB 2GK0B 3P4NB 4KTEH 1E42A 3V0DA 1S8DB 1P4BH 2JKNA 3P2TA 1NCOA 1HDMB 2NCMA 2LW3A 2XKUA 4KFZC 3QCVH 1QI5A 5C08A 3ISRA 2I69A 4YXLH 3SDYL 1F4AA 4FFZA 5CIPA 4AITA 4QI3A 5EEYA 5E4OA 1WFUA 1ASPA 4KQ0A 3D08A 1OCRB 3HMXH 3TZVA 1KV3A 3CGTA 3WSQH 5TJWK 1T5WA 1PQHA 3VXRD 1O7VA 4S1RL 2O5YH 3ZO0A 3EIFA 4P57B 4QOKA 2XVBA 4U33A 4LCWD 1CT8B 4PH8A 3WG7B 4ACTA 2WNWA 2HUEA 2X5PA 3EOBA 4DJMA 5IVXF 1CL7I 2Y0SA 1JTOA 4OCSH 2EDKA 1QTYT 1NEUA 1CFNA 2Y2WA 3E80A 3RWGA 3LS5L 4D0DB 1NGPH 3T4YA 3CSYB 3GPEA 3KPQA 5K69A 2G3MA 3II3A 3S35H 3QPQD 4Z5RB 2VAJA 1MCPH 2ZKWA 4LBAA 1VGEL 5IHWA 3H9YA 4YIQB 2X41A 2V5YA 3D07A 4Z6AT 2EDXA 2A9AA 3AREC 4Z8FH 4JFDE 3ATBA 1T5WB 5JOFB 1U91A 2WBJD 1E7VA 3HNVL 1CICC 1AG0A 4M5YH 2QPEB 2A6KB 3UTZB 2DY2A 3O2WL 4A6YL 4Z7WF 2ZE0A 1OTUC 3CX5K 3KDMB 1RK1A 4H8VA 3MVSA 1UXLA 3QR2A 4LCYA 4XNYH 3UC0L 5AVSB 4R4FH 3ENGA 5E9DD 4G42A 4WW1B 1PKQE 4MAYD 3RWEB 4MNQB 5EZJA 1T0NB 1AHKA 5F9DC 2C9AA 2Z8VC 1BVNT 2ZXCA 4IMLA 2DQIH 1S5HB 1HEZA 2JXMA 3DETC 3PJLA 3RDTB 4NQEA 5CGYC 4PYHA 1BQKA 3WFEH 1OCCB 4OLXL 2E6QA 2F5AL 3MV7D 2FEJA 3NSYA 4GQPH 4GPVA 5D93B 1X7QA 4O4YL 3QNYA 1E30A 3IGAB 4GUCA 5EC2A 5AW7B 3MBEB 5IJDC 2O6CA 2M83A 2OR7A 3C60B 3MUY1 3N1PC 2FGWH 3QHTC 4DUXA 4LHUA 5J06A 2K0RA 1FAIL 3QNZA 1NWOA 1QUPA 4MMYA 3OKOB 4H8PA 3V7AE 3SE8L 2H1LM 2NX5A 3FSOA 3OKDA 4R97B 1NEZA 3GEFA 5GISH 1JNJA 3BKYL 4YSOA 3SJVB 3FUMA 4PJXE 2WXPA 4NPYA 4POUB 1N0XL 1YMMD 2NY7H 4YHYC 1BW8A 2WUBH 1DJYA 3PABB 3ET9F 5DD5L 1XR8A 3JVGA 5H35A 3D4ZA 3HI6H 1DQVA 1XL6A 5LDSA 3JVGC 1AFVH 1PJWA 4TLSA 1H8OA 3PGDA 2VE6A 4LXFA 5E56A 1NUGA 3UBXB 4KMTL 4GRMB 5LBGA 5F7DB 3WGUB 1FGNH 2HCZX 4MZIA 5C7ZA 5I6LA 2GB2A 3RVTC 1KTRL 3LQAL 1A7OH 1D7FA 4HUUB 3SGEH 4J1UB 1ITCA 4NO5A 2BP0B 4OT1H 4CC4C 1DBML 4AW4A 3CHRA 2E7DA 2C7FA 5IFAH 5FYLL 3R8BB 3R1GH 1C1EH 1U3YA 2HP4A 4XP1L 3UBXA 3UBXG 3DJRA 4XPHL 5FHAH 3ZTNL 4ZX3A 5LUMA 3VD3A 1CYGA 1YEIH 4HHWA 4BXSV 3KW7A 2HLAA 1QWHA 4XWGH 3P30L 5CHNB 2BSRB 5F44A 4BDVA 5DZNA 2R2EB 4OV6F 5D7SL 5T5ID 4UQ3B 2D3VA 2YMXH 5EOTA 4GKZB 4K8RL 2XWEA 2DLGA 1NEZB 2VW6A 4S10A 4TUUA 4YSUA 5HHOD 1MQKL 3G3LA 3SDDD 3L5WA 5IF0B 3K2IA 3RJOA 1CFVL 2VXUH 1WD9A 1LILA 2NXYB 3L6FB 1P4IL 2EP6A 1JG9A 3F84A 4Z7AA 2R83A 2EJ1A 3D34A 2XXMB 3DSNA 1BFOB 4YEFA 4PCKA 3Q2CA 3SDXF 1C8QA 1NIBA 4W9DC 3FSWA 1UT1A 4KK5D 1FNFA 3B3IA 4G6MH 3QCUL 1VC3B 4XBPA 1JBJA 1YNLL 5EG6C 3IU3A 3IJHA 3WNLA 1U92A 5FKAB 2H2PC 4FKKA 3I3BA 1MNNA 1P6FA 5JA9A 3W5NA 1Q8MA 3NFPB 5DQ9B 3VFUA 2FEDD 2VDKH 3OJDA 1ACCA 4XMVA 4X4ME 2K3TA 4YHKL 4HKZB 4MXVF 4B95C 2O6PA 4PRHA 3VGBA 3N41B 3TN0D 5CN3A 5I28A 5KTEH 1ACYH 2OI9C 5A16B 2QGCA 4FXGC 3P02A 3TJPA 1FNGB 1VERA 3HG1A 4ZX5A 3F7VB 1YDPB 5IVXE 2PLTA 3BVWA 3MV9A 4Y2NA 3V6OA 4DP8X 5K59F 3RDJA 3LV3A 5CS7A 3QDME 5E2TH 4OCLC 4OH2A 3RA7L 3OGCB 4TNVF 5ACZA 1ZLWH 1J9RA 1EFXD 5AB9A 4JRYA 1FFNA 4X0KB 4KX9A 2VERA 1R5IB 2WGXA 2XKSA 2AEQH 3BHBA 5AAWA 3N06B 5IJKC 4PY7B 4FXGB 1CXIA 1A66A 5DF0A 2E47A 5I24A 1WJ3A 3SQBB 5EORL 3WFHB 4NLAA 4AXWB 4W9KC 2UWEE 4PJFF 4H0LC 1A3LH 3N91A 3VDCA 2MOVA 1E4XI 1WT5C 3DO4A 4R83A 3ULAB 4D2NA 4HFWA 4JRXE 3FQWB 4PGDB 2BP5M 1CYWA 5F0PB 3WXVL 5B4MC 4BQCA 4DKEH 4RESB 3OHXA 5BO0D 4DP1X 4AGMA 2NNCA 3HHSB 3KCWA 1UM4L 2EIZB 3E6HA 1ZRUA 4NZJA 3ZKXB 2OMNA 1C5BH 2P48B 3LRSA 1DBKL 3N0PB 3VXUD 1TWGA 4DUVA 4P3CH 3IETB 4YHZH 4UTAH 2OL3A 3ARUA 5DZAA 4GXVL 1WZKA 3CCHB 5IF0A 2CNZA 2JQZA 4JFOB 1TYEB 1BLIA 1GR7A 2H32H 3GRWL 4LEOB 1RIVL 1INDL 1KFGA 1A47A 3L7EB 5DJAA 5I8CB 1JK9A 2X87A 2ZXDA 4X8XA 5FOBB 2MTAA 4Y16A 1P5VA 2DPKA 2X89D 2DQDL 3NIGB 2QV2A 5JPNA 5IUSA 5JYLA 1GC1L 2ERJC 2H3KA 2IC2A 3C9NA 3SQOL 3QE5A 2Q0ZX 2I85A 2OZ4L 3ATAA 3UFIA 1JZ2A 1DYZA 2K4AA 1JSYA 2R4SH 2H26B 9PCYA 5I8OH 1G0YR 4XR8C 4Y4HA 3VNZA 1O7DC 2BP0A 2H32A 3OBAA 2QVKA 4M9OA 1TQUA 3BLKA 4BH7A 3TVMC 4HFWB 4CAGA 2HJKA 4WFED 4F9LC 2XX0A 4M7ZB 1HJBC 4JAMB 1ADQH 1NJ9A 1S9YA 3HC3H 4FL4C 4PB0L 3EHBB 2XZAL 4E9WA 2FR4A 1H0HA 2H6PA 4WW2B 3QUZD 2R0WH 3P11L 5AB1A 1YYML 2H2SD 5H35B 2BFVH 3DJZA 4JM2C 1EGJH 3GXUB 3CLEH 3K6IA 1QP1A 1AS8A 4OZIA 1V10A 4CKQA 5DEGB 1UCTA 5TE6L 2AS5M 1V3KA 3HE7A 4MDIB 3RTQA 2Y5TA 1ZPUA 4LPWA 1WLHA 3L54A 4MXQC 5KBNC 3HG0A 1CLZL 3AWEA 4U6XB 5AWNH 2KZKA 5M95B 4AQ1B 4NUPA 6PCYA 3VRLF 4PGJA 1JTPA 3QEUA 4MA3B 4PRHB 4LL4A 4XT1C 4YE4L 5IFJA 1X7QB 3GSUA 3PP4L 1FFPB 3DPBA 5MENB 4N2GA 3FB6B 3N85L 3VO0A 3BCDA 2ZWLT 5TDOA 4HG4K 1QKZH 3BUYB 3ARXA 4CJ1A 1XSIA 1YC7A 5D1QE 4XBPB 2H1XA 3MBXH 4KX8A 1BW3A 3VI4B 1Q1PA 1D7CA 2V37A 3CVHL 3QUYB 3MRRA 3NN8A 3QDAA 3GMNA 3ARGA 5C0CA 1U8MB 2XBTA 1S78C 4FQPA 4JZOA 1ZLVH 1A9VA 2BVOA 4AV0A 5M7QA 5DT1H 1OGTA 3CFCL 1YEDB 2PWHA 3AT0A 3HW7A 3VXUA 3MLUH 5D7JD 2VSMB 1AG6A 4UV7L 5GRVK 3HC4H 3QDMB 4YL4A 1QG3A 2H2SC 4IRSB 2X0UA 2BMKB 2W0PA 4WZ9A 3IS0X 4Y4FC 1HXMB 5DD0L 2VDNL 1G1OA 3CZFB 3QORB 4Z7WE 2ZX9A 3KBHE 5KYNA 3QRFM 1JXGA 4L2LA 1TO4A 2P8LA 4X42A 5C7XH 2ZCLH 1LK2A 4HC1L 2HLAB 3ZDXF 1I53A 3HE7C 4K7FA 1MEXL 1EAJA 4XRCA 5E8EB 2JE8A 4XO4A 5FCSH 2W1NA 4NQXB 4AJ0A 1CT8A 4JZNA 4FHJA 2JA6A 4JRFA 5CNHA 4AEFA 5HXMA 2XPGA 1U8NB 1G1CA 3TT1L 3TYGL 1W72B 1JYXA 3WNKA 3WTVA 4WAFA 4D7ZB 1LXMA 1W0WB 2F7IA 1UT9A 4GW5A 2J5LB 3FUEA 1RUQL 5C0NC 2OV0A 4N28A 3T0EC 2IANB 4JE4B 2WIMA 5ABZA 3H4HA 3FQRA 4L3EE 1GGYA 2XWZA 4FZEL 4UINL 4FKEA 1KTDA 3U7WL 1NTDA 2Q3XA 1MI5B 3QEGH 4L8BB 4EZKA 5LNDA 1JNHA 2ADIA 5CP7A 4U1MA 2DIEA 5GRUH 4B5ZA 5B39B 1R75A 4YX2L 3US0A 1A6UH 5PAZA 3VXPA 4KKRA 1JOIA 3SGKA 5C92A 3MSPA 3FZUD 2WINA 2MH4A 4OZGF 3GRBA 4X6FA 4XC3L 3K74B 3N50A 4NKMA 4RRPM 4YK4C 4G8GD 3KNBA 2ZX8A 1B0RA 5DR5H 3ZKND 4ISVA 4O2CB 4LQFL 1A9BA 3D05A 2EUVA 3RZCC 2C1PB 1DFBL 3D0LA 5BV7L 3V6ZA 3NZSA 3LKOA 3K1KC 1UGNA 3PL6D 1OW0C 4Y4KC 1AO7E 4UNUA 2D8KA 2WXJA 3V52H 5FK9B 1H3VA 3U9UA 5C1MB 5J13B 4OF8A 1OL0A 4NO2A 2ZXWB 4CA4A 3L4VA 3WY3A 4PREB 3ESNA 2AGJL 2YRLA 2DBLH 2WUCL 3LX9A 1FFRA 3HE7B 3S4SG 3MLWL 2P80D 4O9HH 3TIEA 1CZ8L 3O11B 4C83A 5AKTA 1DBBL 3U2SB 3OKLB 2BNUB 2WBJC 3NH7H 2ROYA 2NQ3A 3K2UH 4G72B 4AH2A 1UWXH 4G70B 4N22A 4QEGA 3RWDB 5FGBA 3ZUCA 3DTXA 3QEQD 3GKWH 1L9TA 3EYFA 3D2UB 2X2HA 1BAGA 2ADFL 4MAYC 5IR1B 1NJ9B 3FPYA 4U3SA 2EVIA 1QFWL 1E43A 3OKKA 2FLRT 4FQJH 4HIEB 1B2YA 1JYVA 1J8HD 3QG6B 5I71C 3CWGA 4K2UH 3WLWD 5HHMB 2CGRL 3UG4A 5IJVB 1G6RL 1SEQH 4OQ1A 1HSBB 3SO5A 3HB3D 4C8XA 2F74B 1RZPA 1ZGLP 3BW9B 3CNKA 2JH2A 3O4LD 1ASQA 4FXTA 4H4NA 5KJ7E 4LVEA 2BOLA 1N6QL 1XGTA 1CDHA 1BXXA 2FNBA 3DUUB 3L4ZA 5KYUA 3OG6B 3SOTA 4TQEH 2ZWNA 3PWLB 4ABQA 5ANHA 2ICWI 4JFHD 3VXTB 5K39A 2EDHA 1ZA6A 4X6BA 1RLWA 2VIRA 2J4WH 1Y7VA 1NPJA 3MA7B 4Y9GA 4FABH 2GBUA 1EZSA 1LO3H 2CA4A 2VR9A 3WLBB 5JW4Q 5IWLA 2VN7A 4X6FB 4BBWA 4OLVH 2WXOA 5ETUB 4WTWA 3C6EA 4WEUD 3EG9A 2V3VA 1A14L 3L9RA 2YPLA 2BIMA 2GQHA 4S1SL 5F7MC 2EYRA 4I1RA 4P4KD 4PJAE 5D4JA 5DGQA 1E90A 3LRSB 4AV5A 5GS0L 1OAUH 3ULUH 4DO4A 5DFVD 5FC9A 3CBJB 5A1AA 3QEQB 2MCMA 4JO3H 3F6IA 3WTXA 3WIIL 4PJ5A 2FJFA 4CMHB 4DP7X 3DXAE 4M1DH 3IDNB 5D5ME 1AD9B 4QXGH 4FCAA 1AD0A 2F08A 3L9EA 4IEFA 4IIQA 5CD5C 5F7EL 2YEVB 4KJQD 1JXDA 4JL2A 4QY8A 1MG2C 4WWKB 5AOIA 1JZJA 1TVDA 1WS8A 4M7LH 1Q9WB 4IOFD 3SQBA 2VR8A 1KBPA 1GOHA 4K3DL 4ZPTB 2Y5QA 4PWGA 4PI0A 4ODVL 4PJHA 4NQXA 2EIKB 2A9DA 1IGFH 4ZK8A 1RURH 3MRQB 1MJ8L 3GC3A 3HE6D 1A1MB 5KS9A 1FSKC 2Y7QB 4KITB 5MEND 2DW5A 4XGZB 1JPST 4JFPB 4QXTB 4Z3EA 3AU1B 1Z0MA 4XPTH 4KODA 1P53A 2QTEA 1X9QA 2L4OA 4TRPL 1YMMB 5LVEA 2Q86A 3BGFC 2JKWA 3AY2A 5BXFB 4PWEA 2H1PH 2YD3A 3GK8L 4QY8B 3TGXA 3EDEA 1F00I 1YECL 2NCEA 4LPTA 2IO5A 3LZOA 1NFDA 1E4XH 1BVKB 1YN6B 2F1BA 1T0MB 4MDJB 4JHAH 1ML0A 1QYGH 1ZS2A 4PRPB 2CLVA 3QFDB 2WTPA 1SFOA 3QIUA 3CH1A 3GRGA 2VDRL 4BFFA 2V17H 1HE8A 2B4CC 1KZQA 1N4XL 1OTUD 2EH8H 5T5NF 3WMSA 5EF0A 4G6JL 2B3RA 3CZLA 4O51A 3MV7B 4RETB 4E42B 2F7OA 1CI3M 2CALA 2FX7L 4OFKA 5EOCL 2ZSVB 5LGJB 3GBEA 1NPUA 1SN0A 2Q7AA 2DLHA 5DMJB 1U36A 4ZS7H 4Z18A 5KJ4A 3SSGA 4AV4A 3HI1B 4JNXA 4ES8A 3VXME 4A7SA 4G6AC 4XX1G 3TPUB 5J6SA 2N56A 3S2CA 4L1LA 3AQDA 3OB0K 1MFMA 4B5EA 3B1UA 4EDXA 4U6XA 2FQDA 4CSSA 5L7XH 3V4VB 2J2ZA 4HIIB 4ODTL 3X1BA 1TOXA 5D1QA 3S3PA 1OZUA 2MEJB 2ZG3A 4RDQG 3GZQA 1FZJB 4N0CC 4R7XA 4I0PC 3WXWL 4XP6L 3D50A 3MV01 5LCVH 4MA1C 4PY8J 4HJJL 4LL9A 5HHQB 4HD9A 2R39A 4R2GC 2P24A 3LHPL 3RIKA 4PWHA 3LKNA 3PWUB 4X9HA 2HLFD 3BUPA 4Y9FA 3QDMD 5D4HA 3QDGB 3EYFB 1MDTA 5I23A 4HW6A 1B2WH 2H32B 2PW2A 2GCYA 3B2VL 1NL0H 4TNWK 3TU6A 1ZA3A 1Z3GL 3O3EA 2VMCA 5CIPB 5CXPA 2FH6A 4ZPVB 2VUKA 1NEZG 2A9NH 2FYVA 5C08B 5LCVA 2APFA 5C3IA 1JGVH 1XD1A 2XYBA 1HDMA 4BHUA 3IPEA 3Q48A 1S8DA 3FB5B 4YHYB 2XN1A 4HK3N 1E2ZA 5AAMC 1J0JA 4P04A 1HK6A 1Y1WA 4AVKA 4FTVE 4J7RA 2DV6A 4IGBD 3HOGA 2G2PA 5FGBC 1ETJA 4BFNA 3IKKA 2OP4H 3QJRB 4S1SH 1AW8B 4QT5A 5FK9A 3VWKA 1ANUA 3PWJA 1A5FH 1IC7L 4WHTB 4XOAA 2X4UA 1HCZA 1UZ8A 3IU4L 3W39A 4AZ8B 3AQZA 4N1CA 1NDTA 3IETA 4LAJH 3SE6A 3VCLA 3MRLA 4IBTA 3TV3L 3TEYA 1BPLB 5DJCB 2BHUA 5KOMC 5F7HA 5IBTH 1PY4A 3LKPA 43C9B 5C0EA 2Y06L 4NN7C 3IPBA 1K4DA 3BUIA 2VXVH 3WNIA 4KNTA 3BP6A 3EF7A 3RY6C 1OB1B 4P5TA 4IOIA 4RRPG 5BS0A 2HRHA 2ADJB 2XKNB 3BZDA 1EAQA 1BYNA 1NGYB 5JIPA 1AIZA 4FMKA 4G8AC 3MTXA 1BIHA 4MASA 2CCVA 1MCEA 2BSEA 1J5OH 4YAQA 4XNBA 3VNYA 3QWOB 3MXWL 5I30H 4K0OA 2UWEF 4RNRA 4ELDA 4H1LG 5I1CL 4NXKA 5C3LD 1BBJB 2ICWJ 1WEJL 1QPXA 5I17A 3OB0H 3GS7A 3OMNB 2CJUH 4TVUA 4NRZA 2NX5D 3RDTC 1KLGA 1RD6A 4ZM7A 3OZLA 4FXLA 2UV3A 2BOCB 4FG6C 4PD4K 2V45A 3QHZL 3TO4C 1CXKA 1H0DA 5EULV 1IMHC 1XXFC 1MCDA 1XF3A 2WUCH 4FFZH 5IHLB 1E27A 1JGUL 3KLLA 3NSXA 2CK2A 2A68D 1ZT7A 2V9RA 4DWHA 1B6DA 2L3BA 2GITB 4JRXB 4XCYA 3ARBD 3FS9A 5GGQH 1B9KA 2LE9A 3MPCA 4U1GB 4K5LA 5IP4A 3H9SA 4TVPD 4P06A 1QZ1A 3A6CH 5E8PA 4XN1A 4HFUL 4GQ9L 2VLME 4L29A 1L0PA 2EE2A 3SDAC 3VXUB 3SE3A 4YFEA 1IRAY 5C8JA 2NDGA 4U1HB 1XGPA 2F2HA 2VXSL 3T4AA 2CKBB 1UHEA 3QIWC 3VGHA 5BQDA 1Z32X 3TO4B 4XMKL 3I02A 2HSIA 5LGJA 1JNLL 3QUYA 5I5RA 3D69A 3HAEG 1FH5L 2Y9RT 3C5ZB 2P1YA 2VDLL 4F2EA 3SEPA 3TBYB 3DYMA 2D7TL 3LNFA 3RBGA 1A2YA 3HJEA 2E7MA 4GFTB 4ZOBA 2IDCA 4OKVB 2F61A 5IVXB 3BP5A 1H3UA 4YE0A 4UDTB 2VLRA 2ZOUA 4R4BB 2X70B 3BFOA 4XE0A 5E9DE 2XG5A 3QWRA 2X6VA 2R8SH 1FNAA 4RAHA 3OKMA 4TXVB 3FUIA 4N1HB 3UOAB 5EUOB 3KLDA 2WK2A 4GP4B 4XN8A 3D1MC 4CL7A 5I6MA 4U6VH 5T3XE 5I1GL 3QHZH 1M6OB 4PQXA 3FUKA 2Q5BA 3R4DA 3SKOA 5FPIA 4F1SA 4N87A 5CWSA 1UM6H 4MJ2A 2ESVD 1CF8L 1XD0A 1CGWA 5IROC 4I18A 3VSUA 5A2FA 1HL5A 1OSYA 2QQKL 4XPAH 5D5MA 3OHMB 5F21B 2ICEC 3HTLX 1OGAE 1OGYA 1IC1A 1KXQE 3O2DA 3AM8A 3HPJB 1IKFL 2IPKA 1DHKA 3MX0A 4AE0A 4F93B 3HNSL 3MKGA 4J5VA 1PNDA 3GO1L 1GL4B 3L8QA 3F05A 1AD9A 5C07D 1SN2A 2EEXA 3A4AA 2XPYA 4GQRA 3GHEH 5KSBE 4IS6B 4WCYL 4LCCC 3RI5K 3ROOA 1XF4A 3VYPA 3LZRA 2X4TA 3GSWA 4W4OC 4LCCA 1WP6A 2E8ZA 4ZBJA 2AKRB 3BPOB 5CZKA 3MV9D 4OFPA 1LEGB 3ALWA 3QZLA 2EYRB 3NCJH 3GJEB 3BUYA 1OT2A 4TYUA 5CZVL 5JW5B 5L4JA 2HX9A 3X2NA 3QWQB 4QRFA 4PRHD 1MLCA 3QFJB 3KYNB 5IQ9A 1AOZA 1AR1D 1OOAA 3VFPA 2E5EA 1FDLH 1QKZL 2B5IC 1DQJB 4DGVL 4IMKC 1PU0A 2YBRA 4GG6B 2QKIC 3HG4A 1IC7H 1JHTA 4KVNL 3MUZ1 3QQ4B 3O6FC 1B88A 4QMEA 3WFBL 4ATWA 4EUPA 2DF3A 2H8PA 5I16B 4YE4H 3L3IA 4TPRL 3FU7B 4IRZL 1I7ZA 4LEBA 4U1IA 1U21A 3K1DA 5LHDA 3K4DA 1NM9A 2ZNXA 1N0LA 4YFLI 1GTNA 1JF1B 1DQKA 1E8ZA 2H45A 3OXRA 4ZT1A 5HYSA 3QARA 3MUGB 2ORBL 3LZFH 4NO0B 1T3FA 4R7LA 4XMUA 5J3HD 1A0QH 1X3DA 1DL7L 3ARBB 3LPFA 2WZPD 4U1JB 1HCYA 5E4IA 1EEUA 1PTZA 1LEIB 2R27A 1HH9B 3F7LA 3MLXL 3OKKB 1J9TA 3CXDL 3O6FB 3G9VA 4EDWL 1WRFA 2BFVL 3E6FB 4UT9A 3F12A 2BY3A 2DJ4A 4LDOB 2MFNA 1LP9A 2FZ3B 3SDXA 2WQXA 3OX8A 3EW3B 1IEAB 1T3FB 3GTTA 2DMRA 1HNGA 1RZKH 4N8UA 2JTDA 2H0FA 1HSAB 5LGKA 1G4RA 4MX7A 2HMID 3EYVA 3LHPH 1N5YH 1SXZA 4YXHL 4FQQB 4L0PB 1IC5L 4R3SB 3R7RA 4LSRL 2WO2B 2JCWA 3N1MC 4RGMC 4NP4H 4H88H 4NM4H 4NNPH 2YFNA 4FKHA 4A2GA 2YIHA 2V3EA 4NPKA 2XTLA 1F3DH 1MRDH 3NABH 3QWOA 3AWGA 5HI5C 3US9A 4PHZA 5CN1A 5GGUB 4OF5A 4PLJC 1WO2A 3SCMA 2CIKB 4J39A 5FA3B 3MLZH 1BD2B 3RZCD 1BM3H 4U6HA 5AVZB 3V0AC 1ILUA 5DZPA 1FVEB 1UA6L 4NQDD 5E95B 4Q9QL 4RGND 2HFEB 3WKPA 4AEHH 3KHOA 1KIUB 1QO3B 3WNPA 5SX4I 3QPXL 2HVBA 2VDPL 3RZWA 2EVGA 1B0RB 4JQVC 1MLBA 4NCC2 2G5UA 5CILL 1HOCA 5FTLA 2XG4A 3R18A 3VXNB 2Z31C 2ZOKB 4DP2X 1PZ3A 3F7RA 4ZSOB 4AEHL 3NDYE 4MS8D 5BZDB 2XIDA 3QIBD 4APQC 4YHZL 2I9TA 2EE3A 4NYLB 1BFSA 2ITFA 1UA6H 3ARWA 3FB7A 1NC2D 3X1NA 4JY4B 1JZ3A 3FOMB 3LDBC 2CR6A 2KYIA 1KTDB 4A2EA 4Q9RL 1BX2B 3LH8A 5F1OB 4F5CE 3EHBC 3UAFA 1BJ1J 5ACLA 2V2XB 3NIDF 3NZHL 3ZTCC 4LOUD 4JO4L 3L3OB 4S11A 2VDQH 1OHZA 2D4FA 3H56A 4Q2ZA 3GK8H 3FU3A 4M29A 4JDZB 3OGOE 1N12A 1OAKH 3PQYE 3D48R 3FN0H 3NJGA 2FQEA 4YXHH 1U3HB 1XH2A 2AXFA 2IDUA 3H9SD 3HE7D 4GP5B 5T1DH 2FO8A 5ANMA 2VZSA 2VLKD 1RK0A 4QAMB 4WSKA 1DDTA 3LRLA 3X13B 3GUTB 3BUQA 4UT9L 3SPHA 4XBGB 2RTTA 3OQ3B 4MB1A 1D7BA 4BUHA 2AV1B 3OPZH 4DGWC 3MLRH 1D7DA 1JIBA 3VD4A 1V05A 4A63A 2ZX7A 4GSXA 5HVFB 1OPGL 3H2PA 4HKZA 3T1WA 1FRGH 3IFPA 3P9LB 3TZVC 4PJXB 1KTBA 2GAZB 4KQ4L 1CJYA 2DYSB 3FRUB 2ZG2A 1S2EA 3ZU8A 2HJLB 1NBCA 3K6FA 3O4LB 3P3SA 3UACA 1T4KA 3G08B 1FNSH 1LWJA 5IB3B 3PV6B 5EO1A 5LWYL 5A40E 3IKCA 3RFZB 2VDKL 2BVOB 1BCIA 4EOWH 4IBLT 3CSTA 4G7YL 1DCEA 3D39D 4KRNA 1CZ4A 3WJJA 2Q3ZA 2ZF8A 4QLWA 1BAFH 3N5AA 3DSNB 4OCRL 2FECL 2GY7B 3MACH 5EBWB 3LH2L 3T3PE 2Z92B 3S3BB 1WFMA 4YHPB 3GYRA 1WC7B 2QADC 2J20A 2XIBA 2ZPKH 3MUUA 4UQIM 3P9MB 4XVOA 5EA0H 3TV8A 4FA7B 5I1LB 1S7VA 3BE1H 3FB6A 3VQMA 5BZXA 3O5AA 1PIGA 3AW5A 2QSVA 2WSDA 1F3JA 2PETA 1JHTB 4EUPB 5IEHB 3CN1A 4K07A 5I8EA 1NOAA 4NKIL 4Y88A 4XPBH 4TQPA 2F8IA 2Y2TA 4ZO6A 1V54B 5IESH 3IR5A 2AHIA 4KTGA 2G2RA 4YZWA 5C0DB 4HWBA 1E4KC 4KHTH 3GEWB 1EFXA 5E4AA 2AJZA 5DQJB 5B21A 1ETA1 4AENA 4PRIE 2YZ8A 3VG0H 3EBGA 3M45A 1K72A 4F1ZA 2RCSL 1H6UA 4JEGB 3DBXA 3HUJF 4WW2F 1DQML 4NHUB 2MJWA 5D7IE 4XPHH 3C5ZD 1PZBA 4ZMYA 5J1TC 1PYWA 1WE5A 5HDBF 1CTOA 2OR8A 4ZW7A 1U33A 3RVXC 4LPVA 1XIWA 2BSDA 2B14A 3BZ4B 4XPAL 4G6KH 4P5TB 1O0VA 3STLA 3JTTA 5J6GA 4O58L 1JF6A 3HPJA 2VLLB 2WAHA 4GT0A 1M6UA 3PFUA 3BUDA 4K3GA 1Y5IA 3QDGD 4LPYA 5D7IB 3I6KB 1L4IA 1R4XA 3FUDA 2MKWA 3LXAA 5D1XE 4JFPA 2KQAA 4X5XA 3P4MB 4U6VL 5FV1L 3SJVA 2AXGB 3CDZA 2DMKA 4UZSA 3SKOB 3ZHDA 1ES0B 1FYHB 4APQD 5F96L 2I9LA 2D4DA 5KJRH 2H41A 4ZPTA 3T0EA 3QNZB 1DN0B 4WJKB 5KWYC 2PYEB 2GY5A 3ZRSA 2JJVA 5ILTL 2CHNA 4DCQB 1DVQA 3VXOA 3GTOA 5J5EA 1ID5I 1O5PA 4FZ8L 2X05A 2CK0H 3G6DH 2R59A 2VKXA 1KTCA 3IWVA 2BOBB 2JCCF 3DO3A 3LKRA 3QNXB 4BSJA 3S3SA 1QI3A 1EV2E 1YAIA 5FTNA 4PW9A 2YGVA 2IADA 1CLYL 1ADWA 1RSFA 2BLFA 1HWGB 2CJSA 1VJSA 3C6LC 3D18A 4O4YH 5H2BB 4HU8A 3CMOH 1H8SA 4OGXL 2ENSA 4P2QB 4UQ2B 2E46A 2PP7A 1NIDA 2JJSC 4LB8A 4LSTH 2DQMA 1IT9H 3NCYS 4Y2DC 1LL1A 3D9AL 3OQRA 2VIRB 3F65A 3KWWA 5AKRA 2FHCA 2XTJB 3DX7B 3O9WC 4DGYL 2VDMB 5C2BH 4PGZA 1CTNA 4HS3B 3IDJB 5D96B 3SYQA 4HF5H 1W0YT 3TBWB 2CBTA 2P46B 1S3SA 2WSKA 4N3TA 1H6FA 3UMNA 1D5ZB 2GITA 4JRXA 2CE6A 4XCYB 1JFQH 4NUQA 1KBWA 2NVYA 2IAND 4ZFZA 1CURA 3IR6A 5E51A 2YLKA 1BYOA 3TYGH 4LQ1A 4BA0A 1O9WA 5AOLA 2FHBA 3CDFA 1H5BB 1QFHA 1X5MA 3X1GA 3PS6A 2LTQC 2QHLA 4GLRH 3SBQA 3O3BA 3LZLA 3ZQ9A 2AV7B 5I1CH 4HKBA 4IOSA 2PXYB 3MLSL 5I6KA 4JKKA 5MI0B 4BH8A 3JV6A 3FBQA 1YUKB 1XR9A 2EIEA 3F7VA 4NS0A 2E59A 2FD6H 3IJEB 5F1NB 3LEXA 2ESVA 3B7SA 3DI3B 3L4XA 3DDFA 1WA0X 2R1YB 4K7PH 1G5GA 5DLMH 3E1F1 3H9HA 1I1FA 1I1YA 1ZVNA 2WZ0A 2XBZA 3ILQD 4DSYA 4P2QA 3KZ8A 3QCTL 4PBWD 3IFOA 5CLTA 8PAZA 4M1GL 5A2IH 3FAWA 5F89B 3MV7A 5DHVB 2ZKHH 5JPNC 5MI0C 2AJSH 3WI9A 3LVTA 4KI5E 2YD1A 2R51A 2YWYA 2MTPA 3NDZE 3CXHJ 4JCLA 4HCRL 1BAWA 1VZHA 3RX7A 1K85A 2X4PA 3FUHA 3MBXL 1KGWA 3VX1A 3ZGIA 3WKNA 5ADOL 2XZQL 3WEOA 2WQVA 3IAQA 5GZNA 1P4BL 4ABWA 1DN2A 4MDJA 3VI3B 1T83A 1FL6A 4MJ6B 3U9UB 5IEHA 3AC0A 4FGMA 3RG1C 4AZ8A 1UXSB 1TZ8A 3KYKH 4L4TD 5L0QC 2W9EL 3AQYA 3T09A 2KLTA 4G7YH 4HZAA 3VXRB 3VXQA 2O5XH 2YHGA 4JFXB 3W1ZA 1R3IL 4ZW6A 1RAMA 2NR6A 2XA8L 5EBWA 5F0JB 4A1RA 6FABH 3RY4A 3GIZL 1M7DA 4Q89A 3OSVA 1IAMA 4R6UA 4RMUA 2Y7SA 5CJ8A 1E40A 3QIBB 4UNVA 4AYDC 3FCSB 4L5FE 5DJ8B 4ZFGH 3BVNA 1BXAA 4GRLA 5AYTA 5I6NA 4FNLH 2F19H 5D7KE 1HC1A 3BZ4A 1DQQA 3Q1SL 2NSMA 3STLB 2YGNA 5BS0D 4KK8D 3PPSA 3DIDA 4UT9H 2YAMA 3JTSB 2DQHH 1P7BA 2A1WH 1ZMYA 1XL4A 4B9KC 1XAKA 2AV1A 1HWHB 3L7FB 3S97C 1L6PA 1AGEA 4MKMA 4TL4A 4NGHH 4LF3B 3WO3B 5D6DC 2MCAA 2ZCZA 4MZ2A 4GAFB 4GRMA 4Q6IC 2CKBL 3PWUA 4HXBL 1K3IA 3NIDB 1ZLDA 2X3CA 3RL2A 3O4OC 4K7FB 4IBWA 1FZOA 1UD6A 5K33A 4AIOA 5T1KB 3Q5YA 5JTWA 1JNNH 1TMOA 2HRGA 1JHKH 6PAZA 2R4RH 3KM1A 5L7XL 2F8OA 1UVQB 3QG7L 4N5ED 5HYFA 5K39B 3SYOA 4GB9A 2DQDH 4DK3A 2EAEA 4LPXA 4B9YA 1IBDA 2B1AL 2VDKB 4WU7A 4L8SC 4XO5A 2AQTA 5I2IB 4LHUB 5C1BA 35C8L 5I6XC 2AXHA 1JWUA 3B3BA 1R3KB 1INDH 1WUNT 4K15A 5CKAA 4URKA 2RQ8A 4EZMA 1R3JB 3M17B 2N59A 1XF1A 5IJVA 4OW6A 3RDTA 1EDQA 4N3UA 5DUJA 3E3QC 4OFDA 4OGAD 2DM4A 1QZNA 1HHJA 3ELAT 3VGDA 4KH2A 5ESQB 3NCFB 3NIFF 5DJ0B 2IPUG 4XTRC 3TNNB 4ADIA 1E4XL 2JI3A 5E1AA 4UTBA 2NXYC 1QFWM 4PJEF 5LN4A 1OP3K 4DOHE 3HLAA 3ARPA 2XOTA 1CQKA 3IFPB 3P9LA 3KGTA 4NP4L 4ZYKB 5DYOA 1D5MA 4QCIB 2EC9T 4LSRH 1VCAA 5BPPA 3DTDA 5LGHH 1DMRA 4AQ1A 2AJVH 1X5AA 5K9KB 3OKLA 3IM1A 1R1CA 3ALPA 4IJ3C 1TETL 1G7IB 3FTSA 5JA8B 1E2VA 1ZLUK 4HDIB 2APSA 3ZDYF 4P9MH 1I8UA 4AYGA 2AV7A 2ZOLA 2GIXA 2K6YA 4NKDA 4PREA 4ODVH 3FUJA 3UTPE 2AQRA 1QR1B 5CF3A 3K8MA 4HIPA 2P8PB 2W9DH 4PJ8B 3OX8B 4NWUL 5BCAA 2TAAA 2AQPA 3NRFA 5F7EH 1YVLA 4S2SA 4XOEA 3QJFA 1JNNL 4LEEA 4Y4FD 4N9GA 1PIFA 3M86A 2ORBH 1JERA 2JKIS 4WWKA 3JWDH 4TUJA 3FOMA 4JO2L 4LVHB 2A9MH 3LIUA 4JFEA 4BCZA 5IG7B 1EJ6A 3HUJB 3UO1H 1MWAB 2BHYA 1BVZA 1NDGB 4L5FL 4NWTL 3WFCL 3MFGB 5GS3A 4TM9A 1G7HB 1XGYL 2AI0H 4N2AA 2DQFA 3ARFA 2NTFB 4AQAA 4UQAA 2H8PB 4DEUA 4PG2A 1NC4B 3EDFA 2F8XC 3U4AA 3IGUA 3NCYP 2AERT 2CDFA 1TCRB 4ZFGL 2CJ3A 3GMMB 5FO8B 3L1OH 3H53A 2YPKB 4LCWB 4MD4A 1W0WA 4KUCF 4NKQB 3W3BA 3HJ0A 3SPJA 3CFTA 1AXTH 1F18A 4WGVB 2PYEA 4HMDA 4LNRA 1MRFH 1TJGL 4D9LH 4G5AA 2FWLB 2HKFL 1S5IH 2AP2A 3K91A 4WSGA 4AMXA 3P30H 4MGXA 1WFJA 3GXNA 4S0SD 2WQAA 1U93A 5FKPA 3CC5B 4HMEA 3BAWA 4HOWA 4XAWH 4FG2A 3I6KA 2R69A 4U3HA 2ZYHA 4YN3A 2DI7A 2X1QA 3AG3B 4N2BA 4OM0H 3TVMD 5DO2D 3ROLB 1TVHA 4ZQKA 4FQCH 1EEZB 1OWWA 2QQKH 1WBZB 5I26A 3SCMC 3VI4F 1MI5E 1T6WA 2NY4B 2PNWA 1D6EB 1OW0A 4LVOC 2JQAA 4MJ5A 4PJDF 2OSYA 1KGUA 4N6QA 2XVKA 4Z0BL 4JREB 3TX4A 3GTPA 1RHFA 5ISZD 4Z3TA 1A1NB 1DVTA 2FT7A 4NO0A 1QR1A 1S7SB 3THML 1BJ1H 3NN8B 1HFUA 1NCCH 4NJ9H 5INDA 3TJHD 3ZT7A 2EE6A 2XT1B 1TNMA 1FNHA 1LMIA 4IHOA 1BZDA 1FZMB 4ODXA 3QQ8A 1V3MA 1HI6B 1QNZH 2VSKB 3CSGA 4G83A 3VVVA 5L4FA 2OAAA 4FI6A 2FD6L 1QATA 4P2OC 5D1ZC 2JJUA 3DGDA 4Y2LA 2XG5B 3NJMA 3HS9A 4L18A 2PR4H 4JREC 5HYEA 5GQBA 1TZOA 2X70A 3CF2A 1RIUL 1UOVA 2VLRB 1KMGA 3LH9A 1NGXB 2I5YL 1RZJL 1P84K 5AZUA 1FZKB 3EJTA 12E8H 4F2MB 4M6NL 1TTCA 4LOUC 5CKGA 2W9LA 1GIGH 2Y1YA 1RH8A 4ORZC 1E4KA 2I7SA 2R2BB 4R4NC 4YBHA 3B8SA 3TBTA 4LAQH 3UEZA 3QEGL 4WEEA 5DJZB 4X5PA 5ICXA 4C4KO 1Q9KA 5IJKA 4KKLC 1AKPA 4JN1H 3JQOB 2H9GA 1S9XA 4KJWD 2ZAIA 3VGEA 2XYCA 4X7TA 3S48A 3H9SB 3MX0B 1C9SA 1R6VA 2V3DA 5B39G 5I1IL 1D5XB 2VLJE 3J2PA 2WLYA 3I84A 4I9XA 4XXCC 3TM7B 2WLLA 3O9WA 4NZUH 1WAAF 4J12A 3S8WA 3HFML 3P0VL 4TKWA 4UQ3A 1BQRA 3GZOA 1F6LL 1EQWA 5L8KB 3ASWA 3U48A 2EDDA 1FZOB 2F7QA 5FFGA 5CD3A 4TTGA 1J5OL 3C8HA 4PI2A 5C7XL 4NRZB 4R96A 4PJIE 2C3WA 2F1EA 3HZ3A 5AW3B 5F6IC 1JPGA 3ILPB 1ED3A 5K9QI 1QNZL 2PCPB 1G8JA 3APCA 4NKOB 1OV8A 4HP5A 2ERJB 4NO3B 1ZSDA 4AUJA 4KJQC 1CFQA 3QORC 4GSRA 5F9JA 3UJIH 1QOKA 4WO4D 4H2AA 4S1RH 2DQEL 4ZXBC 5TPWH 1AGFB 2Y06H 1KJMA 1G5AA 3FKIA 1P1ZB 5CM1A 4FYSA 4UBDC 5FM4A 3CVBA 3D6GA 3LIZL 4YSRA 4V1DA 1W91A 2P42B 5EBLB 2H9GB 4UV4H 5IW3A 1J5CA 2VJ0A 4JG9A 2CLZA 1IQWH 1J5HA 3U46B 4G6KL 4JL1A 5IMLB 3SKNB 1HILA 3WCYA 1NCDH 1Z9PA 1UFUA 4PVBA 2E2HA 3BPCB 2RMNA 4WUKH 3DIFB 2GJZA 4PRPD 3L3KB 4R5VA 3C6SB 4GKSB 1MHPH 5FUCE 1J8RA 5BRZA 1P7QD 1EO5A 1KGJA 1P7QA 4W9JC 5KW9H 3HB3C 2NY5H 3GHBL 1R17A 1FVEA 3ZZLA 1E3XA 4W4NA 5B1BB 2X42A 1ZWIB 3C60A 4HPYH 4QT5B 4ELKB 3BI9X 1R5IA 4FLQA 5DK2B 4BWTA 2ZCKH 4XCFL 2VLKA 1QDNA 4FFVD 3GSNH 3LDBB 1LK3L 4NZDA 5HHOE 1QUNA 5T5FH 3TEUA 3DRQB 3KBPA 4GBXC 2FO4A 5IOKA 3SDDA 4YFLF 4KAQH 2YD2A 3KDPB 3QYNA 5DJDB 4XPBL 1ZT1B 4U0RB 5ID1A 1WISA 1ZGLM 3DO7B 1HS6A 1U4EA 4JFQA 4JFDA 3P11H 4QKTA 4YDMA 5F89A 4EUPG 1BZ9A 5GRZA 3IFOB 4X6CE 3KLAB 1FFOB 3FPXA 1QEWB 2Q7NA 4UQDA 4YXKL 3ZO9A 1U3HC 3IE9A 1CXLA 4S1QH 1H9VA 5F1KC 1AQKL 5FWQA 1K83A 2QGBA 1HN1A 4X5RA 1NC2A 2GSGB 4HUVA 3IXTB 1JZ7A 5F9WB 1OB1A 5EZPA 1N64H 4UUJB 4XO8A 1EHKB 2QQLH 2WO3B 3PQYD 1CLOL 1N70A 2OMYB 2WJ5A 4Z5RA 4GP8B 4MVBD 2OYLA 5DRWB 4L1HA 1SYSA 5L9DH 2HRPH 3CSYA 2ZYRA 1S4IA 1ZLUH 4Q6IA 4KGJA 1VFUA 2PYEE 5KVGE 3CIQA 5JDSB 3EBAA 1S9WA 3SQRA 3WIHH 2IOOA 3BEVA 3O3AB 2DI8A 5FW7A 1OB0A 4N2CA 1PVHA 3BFQG 2B59B 3HR5B 2COQA 2A4CA 3QQXA 3BKMH 4XTRD 4QNPE 1JXKA 2BRRL 2WJ7A 1QLFB 4A39A 1KLUA 3MRDA 4CNIA 3KPRB 4RAVB 1DQJA 5CJOL 4LFHD 4GXVH 2NYZA 3X11B 3ZKNC 3ARQA 4G6JH 2RB8A 1L0QA 5KBLA 4BDVB 1F2QA 1FORL 4D7PA 4NC0B 4W6WB 1UXWB 1UM4H 5CBEB 4JHBA 4HUMB 1GPOL 2C4FT 1Q9LA 4OGYH 4YC2C 4MWFB 5JQ6L 1NLDL 1KZYA 1H15A 1GOFA 1MWAL 4G8IA 3FQNB 4MD0B 4BRVA 2HT3D 4AGPA 4BZ1H 3GSRB 4PRPA 2DLFL 1NFDB 1YN6A 4PN6A 1F13A 4D0CA 2Y36L 1OE3A 3PRZA 4TOYH 2A4ZA 3HRPA 4MAYA 2W8CA 1TXKA 2FX8H 4UZGA 1MW2A 4AIXA 1FE8H 2VUOA 4GT7A 35C8H 4FXGA 2KQMA 3RILA 3MMEA 5E1IA 3OD3A 3RZCB 3NSJA 2VXQA 4DW2H 4FAAB 5KSBA 1N7MH 3QZOA 1ZY9A 4EI5B 5J6HB 1YN7A 3LD8B 3M1BA 1K8DB 5HDBB 5I0XA 3L3HA 1MCNA 3QRGL 4CSPA 1FJ1B 2HRPL 1P4UA 2QPSA 3PV7A 4Y1AA 4C4UA 5DUML 4CRYG 1SMDA 2BVPA 3FYIB 3OKOA 2J2ZB 1IM9D 4AMKL 3QRBA 4ZAKC 2HX8A 2CU9A 3M46A 3ULUL 1RJZB 3CK0L 3WN6A 1FL5A 3ULSB 2R29L 4PJ7E 4R4BA 1C12B 1D5MB 4QCIA 4ECNA 3HG3A 5AFAA 1CB4A 4P5TD 1JJUA 1AP2A 1Z5LB 4AQEA 1AOHA 5DJ0A 2DQHL 3DX1A 2ZF9A 4F58L 4O51B 1ID2A 4D9RE 4FG6D 5DQJA 4AENB 2SEBB 1XGUA 4J3OH 5K9OA 3RHWF 1NFAA 2FEDC 4L23A 3VACA 3W9DA 1JYNA 1AGBA 1YNTB 3FT9A 2ZX5A 4NAMA 5FWRA 4GAAA 1XGPB 3BT2H 4CN6A 5JHLA 2A6KA 1T0MA 4XZ4A 3DX9B 5T5FL 2E9BA 3U0PA 3L6FA 1FGVH 1QHPA 4HU2A 3LZFL 1IC4H 1S7QA 4MB5A 1QTPA 1NANH 4P2RA 4KTDL 2OZNA 3DUUA 4K8RH 3S4SA 4IIZA 1FC2D 5EC1A 3IEAA 1E27B 4WTQA 1CFTA 1U8JA 1VKXA 3SKJH 2R2EA 2OCJA 3DA0A 2YOAA 1MHPL 2AQQA 1X4ZA 5D2LB 5JW3L 3FSVA 3KWXA 1G0XA 3ARVA 4JANA 5FYLH 3P4OA 5EU4A 2JIMA 2PO6B 1CVRA 1Z2KA 4TSCH 4N20A 1BBJA 3LQZA 5INCA 1D5IH 2JLLA 2RH0A 5KBMA 3LQAH 3DX2A 1NSNL 4ANVA 2GT9B 1XIWC 5IHZA 4KRLB 4O9HL 4QRSB 4L1TA 3HAEH 3MYZA 5L2KB 4M1GH 2FJFB 4GQZA 2K8MA 4YQXH 1DUYB 2Y72A 1TQBC 1U2HA 5DJ6B 5TPWL 3B2DC 4HWZB 4CMMA 4PV8B 1HAUA 2D0FA 1NDMA 4UM9B 3U1PA 4HHAB 1V3JA 4M7JH 2WQ8A 1WIOA 5I0VA 4JFFE 4P5MB 2X4SB 2QSCH 3MOAL 2YPLB 2OSWA 1CVSC 3L5HA 1OTSD 2EDQA 1CUOA 2D7PA 3VU1A 3H2QA 2OQJB 5JOPD 3F3HA 4L0YA 2VN6A 3BSHA 3UJJH 2AVFA 3LPWA 1FAIH 1OXYA 4NCC1 5F8QC 1SXBA 4DN3H 3VXTA 3HIZA 1KEGL 1J8HB 1T20A 3P0VH 4P07A 1J5IA 1J1OL 1CF8H 4HZLA 2L0DA 4B9GA 4HT1H 3I6LE 3VSQA 2F5AH 1JFHA 1SF3A 2C3VB 4CADA 4KRPC 4L9LC 4H1LH 5JMOC 2CGZA 2EDMA 3CN4A 4JM4L 4ZJ9A 4DGIH 4P5KB 1PMYA 1R9FA 2WZ6A 1MCRA 5I1KH 3W37A 4JQIL 3QJOA 2R8SL 4HIEA 1MI5A 1DJGA 2Q8AH 2WB7A 1BJ8A 5FGRA 3AUWB 1K8IA 1A65A 3PWNB 1JN6B 4DP0X 1I1YB 4KRPB 2FBJL 2DQCL 1WWCA 1HKLL 2A74B 1SJMA 2ZUXA 3DVFA 4AH2B 1AQMA 1SHMA 4CBPA 1IAKB 3RGVD 1JPTH 1LO5A 2DWYA 3AAZB 1JI1A 4CVXA 1R3HA 2PW1A 5D2NC 5EO9B 2E9IA 4Z7UF 3FT2A 2E75C 3LS5H 1F3RB 2B0SH 3L3GB 3AGVA 2AK4D 4WK2B 4BE5A 1CGVA 3ETBF 4M4PA 1DJZA 3EO1A 5EZLA 3K0YA 3KM2A 5I5IA 3BKJL 4O00A 4D0DA 3QQ9C 2HVKA 3N41F 5G5DA 3BRDA 1NCCL 4UV7H 1UA3A 3OC5A 3BZEA 4YHIA 2VR5A 2VPYA 1R5VB 2KDYA 1I8IB 2R9HD 1GW6A 1RUML 1SXAA 4P57A 5D2NB 2G75B 4XMTA 3ZMRA 3WS3B 3RX9A 1HVXA 3NCBB 5D1XA 1A9BB 4PJ7F 3ARBA 4YOKA 3UC2A 4WWOA 2ZAGA 4B97A 4LCUB 2XN2A 1J0KA 2FIRT 3AJ7A 2VKWA 1V7NL 3W9DB 4FF9A 4PJGA 5CJ5A 1MDAA 3ELQA 3TN0A 4G11A 3VTTA 3TCXA 3TBSB 4YHLL 2VJXA 2LABA 4R7VA 3NA4A 5FYKD 2OMUA 5H2BA 1YYLH 3EO9H 4MKTA 5CINL 2KERA 3S8FB 4N0UB 4Z23A 5I16A 5HJBA 1XDTT 3MJWA 1A8JH 3PHAA 5IBUG 1F86A 2Z34A 3V0JA 4GH7B 3R19A 1A6AB 3F7YA 3SHSA 1SVCP 2B3IA 4UILL 1C12A 3T04D 2EDOA 1Y4ZA 2EXWC 3QEUB 4H40A 5TDNA 4BFOA 1RPUA 4CRPA 3MRHA 1BVKA 4OD1L 1PG7W 3D25A 4FADA 1KIPA 5SX5K 3JWOH 5J11B 3DURB 1KTKE 4NFCA 3MR9B 3I9IA 3GI8H 4GUQA 1DJWA 1EHAA 5KVGL 4M8QB 4C56A 3TA3D 3RKDD 4OZHB 1FNLA 3D4CA 1RIHL 2ZUQC 3DUSA 1ZCRA 5KOVC 5HHOA 1BIIB 5J6HA 1OTTC 1XCQB 1YY8A 3QS2A 3TIDA 2R0LL 2Z1PA 1HHHB 1ACXA 3G9AB 3WV0A 2ARJQ 4KZDL 2F5BH 3BPOC 5B8CC 3BDYH 1MF2L 1EFQA 2VM9A 4GJTB 4NUGL 4ADGA 3GSXB 4PG2C 1QWUA 5C07A 4F8LA 3GBNH 2BSBA 5HGHA 3V4UH 2HN7A 1T03H 2PJJA 3KVDD 5I76A 2DYPB 3NJVA 1FNSL 4FA6A 4X0NA 1X9LA 1OGTB 3T65B 1WTGT 3WDHA 3L17A 4HOZA 4H25B 1EBPA 1HL4A 1MAMH 4P2OB 3BUTA 4G8IB 3PDDA 1N5AA 1J9QA 4NPJA 4JQXA 5EHFA 5G2NA 1LNUA 2FIKB 2NY0D 4Y19A 2V7HA 3SGKC