2BH0A

Crystal structure of a semet derivative of expa from bacillus subtilis at 2.5 angstrom
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords YOAJ
publication title Crystal Structure and Activity of Bacillus Subtilis Yoaj (Exlx1), a Bacterial Expansin that Promotes Root Colonization.
pubmed doi rcsb
total genus 45
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2bh0A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2bh0A02
3FT9A 4FG2A 3ENGA 4L48A 1WHOA 3FT1A 4FERA 2PJJA 3X2GA 2PNWA 2PI8A 2G5DA 3D30A 2BH0A 3X2LA 4FG4A 3X2NA 3X2PA 4ZM7A 1OA9A 2ENGA 2JNZA 1HD5A 1OA7A 3SUJA 4FFTA 3M3GA 5GLYA 2PICA 3CZBA 3SULA 4JP7A 2GAEA 3X2IA 4JS7A 5GM9A 1WC2A 2AE0X 2G6GA 4JJOA 3X2HA 4AVRA 1BW4A 5H4UA 2KQAA 1BW3A 4JP6A 1WHPA 3SUMA 4ENGA 5GLXA 3X2JA 2HCZX 1BMWA 2VXQA 3X2MA 3X2OA 3SUKA 4JCWA 1N10A 3X2KA 1L8FA
chains in the Genus database with same CATH superfamily
4GBXC 2C45A 2X4UB 2A6HD 3WI9A 4DTGL 1YVLA 1NJ9B 3QO0A 2DIEA 2NY1D 5HGAB 4ZUVB 1OSEA 2ZOOA 4Z7AA 5KS9A 3US0A 2E76C 4E41A 2Y06L 3PL6B 5BRZA 4RZCA 3ALPA 3B83A 5IHLB 1UG9A 3L45A 1FFPB 5G5DB 4YDVB 4NQDD 3PP3H 1YNLL 5EZLB 3FT2B 1U92A 1NCNA 3BUBA 1YEIL 3EYVA 4TUJB 3H3BC 1BAFL 3CN2A 5DJ0A 4JB9L 1Z6JT 3FB5B 4G43A 3NCJH 4UT9H 5IQLA 4ENEC 2WMPA 3PL6C 4OF3A 3V2AR 4LHUG 3MJ9A 4GS7B 4QYOB 3WEAA 2Q6WA 2VL5B 4LFHD 1BFOB 3QR1A 2GFBA 4U1IB 5GJSH 4DN3L 4ZD3H 3BZEA 1ICTA 3T3PF 2A9BA 1T04B 4PJXB 4AE1A 3Q7JA 4CVXB 1DBAH 2WLZA 3KCWA 2PICA 4BCZA 1RURL 2YRPA 3ARUA 4FYRA 3CHSA 4XO4A 2YAFA 3CIQA 2KMWA 3H0TA 4FTVD 4YIQB 3KWWB 2CO6A 5DJAB 4GS7C 5D6DC 2H6PB 4P0DA 3OHXC 2X0UA 2Z31B 3FPYA 2C8NA 4XBPA 4GMTL 1BBDL 4MS8D 1OT1A 4JO5A 3T6XA 4F5CE 5BQDA 4NWTH 3FO0H 4ADJA 1U2YA 4CILA 4QOKD 4L23A 3UC2A 3ILQD 2YSSA 4FKHA 1E4JA 3BDYH 4IS6A 4KQ4H 1CD8A 4ELKA 2B20A 4PRAA 4LSRL 1RZ8A 3O11B 1E4WH 1THCA 2XWXA 4Z7WB 2JLPA 4RH4A 3TTSA 2BW5A 2MCMA 4AM0A 4RGMB 4E5XG 5A2KH 2Z31C 2FO4B 3NCCB 1UOVA 4QXWA 3ZE0F 4AKQA 3OZ9H 4KU1A 1A8JH 1XO8A 5CD5D 1OF0A 3B9KD 1U91A 5LWYH 2F19L 3RFZB 1VZGA 4HPOL 5BO1L 4FQIH 2M83A 3RDTB 2IGLA 2X4SA 4H25A 4GY4A 5IKCA 3GXDA 3S7GA 5C2BH 3LZRA 3HBGA 3QVAA 4X99B 2A77H 2FQEA 1BMZA 4XAWL 3LEYL 5KOVC 1H15B 2I7SA 5I18H 3PCYA 1KLFB 4J6RL 4K7FB 3DSFH 1H8OA 2HKHL 3C09C 3HLAA 3N9GL 3RFZC 4KMLB 1SXCA 1NDTA 2DLEA 3RDTC 1A1MB 4RWYL 4WTQA 3NCFB 1VACA 5HHNB 1KZQA 1OF2A 3UC0L 4AYID 4KKRA 3CZGA 4WFFE 4HPYH 4E9SA 3T6QC 5E24E 3UTSB 3W0WE 1T20B 2BCKB 4OR1A 1GR7A 4P5TA 5ALCH 3A4FA 3M1CA 1HHHB 1KIRB 3CLFL 2A4ZA 3CGTA 1YEKL 2E9BA 2BSSA 1HQRA 3QQ4A 4OZGA 3S35X 1JV5B 3QULB 3TEUA 3MRIB 2WZPD 1KWGA 3V5KB 5DT1H 1A1OA 5AOKA 1YCSA 2Z1PA 4GSXA 3T0AA 4A68A 4AC4A 2EEDA 2A6KB 3NP3A 1NCOA 3MLRL 1I8LC 4EI0A 1GTFA 3ZUNC 3REVA 5DVMA 2NY1B 4XWGH 2LOEA 3QUYB 5JIMA 3OLEA 4HUWB 2V5TA 3RTQA 5CJ5A 2BMKB 4FQCH 4P9MH 1XF5A 4NQDB 1BJMA 1HEHC 4ZQKB 3QSKB 4XN4A 2DQGL 2X4NA 2DKUA 5IVXF 4TVPE 1MJ8L 4P49A 8FABA 2O5NA 2XWEA 2ZX8A 3L81A 3Q8FA 35C8H 3QCTH 5GGVY 2WIIA 2A1WH 3QUYC 2O6PA 5AVRB 2VE6B 2VLLB 1KLGA 1YSOA 1OGSA 3MFGB 4NZTL 3N2JA 4UOQA 3VRLE 1NCCL 4AQOA 4AVRA 1A7PH 1BOGA 1WWWX 3WJMB 1M6OB 1CFQA 1AG0A 3FZUD 3HG2A 1XGUB 4AMWA 5DI8A 3KPMB 3FQ4A 2WKGA 5E03A 2FEEL 1PZDA 3NDYE 1WJ3A 1Q0XH 1TMCB 1AZZC 1F3RB 4KJYA 1MRFL 1ETZB 2LE9A 1ZY9A 3MO1A 3ABGA 5AOJA 3UERA 1QPPA 5CEYB 1CXLA 5E5MB 1XZWA 4FTVB 4YOKA 3L5JA 2E7CA 3VGDA 3V0IA 4HUUA 1NFDA 5DUJA 2KZ1B 1II4E 2MPAH 2FX8L 3ULVD 1UGNA 4X8GA 4FKEA 1VEOA 1V8HA 1FL5B 4ZJ9A 4LEXH 4XP5H 2AITA 3N1FC 5JW3L 3QEQA 3VD5A 2V7HA 2VZ1A 2VM9A 4Y0GA 3CQZA 5BQ7A 1I9JL 3GINA 3VU1A 2W0PA 5ETUB 1F90L 2Y7OA 4G42B 5DZ9A 4R7LA 4C54A 2CDEB 4HULB 1UUSA 2AEPL 3CBJB 4MS8C 3FNKA 1K4CB 4PJ8D 2QVIA 4EUPG 1XD1A 3B9KB 2VDML 2DWDB 3PLYA 1YNKH 2AHIA 1WWBX 1HCVA 2QVKA 1FDLL 3FB6A 5BS0A 2VYRE 5DEZA 2QELA 4ANKA 1IKNA 4M7KL 1RUMH 2XACC 3BKJL 4GW5B 3MLVH 4M7LT 1N5AA 1RZKC 4HA1A 3O2DH 4O02H 1YEGL 2AQTA 2Y2YA 3U7WL 3UCQA 2G2PA 3KPOA 1T7XA 2X0VA 3NTCL 4FEMA 4ZO9A 4GMSH 1P5VB 3HC3H 2BNQE 5ANHA 2QR0A 4KGJA 1I9EA 2VQTA 2RCSL 2ZSWA 5I76B 2JKRM 2APBA 1FHNA 2JJTC 5I6NA 5JIDA 1KPRA 3MZGB 3FU3A 2A68D 4Q8BA 2QEJA 3VD7A 3GFUA 1PKQB 5ABAA 1A65A 1CGUA 2X6MA 4FFYL 1WT5A 3IR6A 1KTDB 1CF8H 3CFCH 3SE4A 5CP3H 5D7LA 1T4KB 2OMVB 1XF2A 5D93B 2VKWA 5CXPA 2Z8VC 3JWNC 1IBHA 1RZ7H 1WH0A 3DUUB 3DSNB 3U7AA 3IPEA 4CVUA 2Y1VA 5E99L 3RAJL 4IBSA 1F97A 4PGBA 3W5MA 3M86A 3QXWA 3T0WA 2W60B 4HKZB 2VO8A 3FFCE 4WI7A 1HCFX 3HW7A 4LCWE 4WUUE 1TLMA 1L9OA 3MJ7A 1VCBC 4XOBA 5IK3A 1EVTC 4KDTA 3T4AB 1KJ3H 2F8VA 3ZK0A 4GKZA 4TM9A 1M7DB 2EO7A 2IAMD 1INDL 2YXFA 3KPTA 4OM1H 3JVGA 1D6VH 3QJRB 1QRKA 4IJTA 3MV01 4XMVA 1KIQB 1WEJH 2ZP9A 3GSXA 3HVDA 2JKSA 3MRCB 3BVDB 3ELAT 3F5WA 2K8QA 4PWHA 4FHKA 1X5MA 5FCUH 5BZWA 1ZTMA 4CSTA 5FX3A 1QFWH 1UWEL 4GNKB 1UEYA 5TGBA 3VXNA 4XXWA 1DQJB 1G0YR 3KYNA 1EJ6A 1USQA 2QQQA 1JTPA 1KTCA 2JQZA 3FZUC 3DYPA 5HHOA 1NCUA 5I1KH 3LZLA 3PGFL 3V6BR 4NQSB 2XZAL 4E36A 5TQ2L 3PQYD 3ZIYA 1U8IB 4MDRA 5E0FA 5C0GB 1WBZB 2VN7A 2ZD0A 5JPMB 1YAZA 3CFEB 1UQSA 4LT7A 5IBUG 3O3BB 5CSZA 3VB9A 3FKUS 5DDHA 5A6MA 3ZO9A 4L8CA 4MDIA 3WUWA 1J1XL 2Q76A 3IJ8A 4HGMA 1RUQH 3MR9B 2J4WL 4J7RA 1A2YA 5HHMB 1AGBA 2ED7A 1KB3A 3SDXE 1NM4A 3KPPB 2EDDA 1C5BL 3RJQB 3VXRE 4Z23A 5HGHB 5FKPB 5JPMC 1KCUH 4XB3A 4PJ8B 2J88H 1P6AB 5C07E 4MXWH 5KVEL 3HKZA 1N64L 3G08B 3GZQA 5GS0C 4JN1H 5G4NA 3DROB 1NGZB 4KX8A 3S48A 3DJRA 3KPRB 2HJKA 3L3JB 1I4FB 3GYRA 4O4YH 3ETBF 3B7RL 3V4PA 3AY4C 3KPSA 5KJ4A 3AAZB 4U3HA 3KM2A 5BVPL 5DF0A 2R2BA 4DW2L 1T1ZB 4NNYA 4WFEE 2BWDA 5HYJE 2F7OA 3IJ7A 3I2CL 3TX4A 2CHWA 4X9YA 1JYNA 5DJ2B 3MYZA 3ZDYF 3CVBA 4GP8B 4UT6L 7PAZA 1SDDA 3BSHA 3GRGA 3AY2A 4GUQA 4DGWC 5AAMC 3M46A 1YAIA 2IALB 1FYTD 2VDQB 2K6WA 1FO0B 1HSBA 1KIUB 5CR8A 1KXTB 5AW7B 5LBSA 3NUKA 3T1FB 3ZTCC 1MW1A 3VWJD 4M3HA 4HOWA 3S96B 3FTGB 3ARYA 1PZSA 1YZZA 1EZUA 4KI5D 1J9TA 5T5NG 3TBYB 2G9HA 3BUTA 4HIEB 5F7WC 1QBLL 2BHUA 4QYAA 1AQ8A 5D9SA 4MTMA 3GM0A 4QRPB 2DRUA 1KQGA 3FL7A 3VI3F 1EIBA 4G6MH 3IFOA 3OR7A 3F00A 2V9QA 4IMLA 4JFFD 2F54D 2AXFA 3LV3A 3SJVA 3VH8B 5EEVA 2BSRB 4HKJA 2HVKB 1MZYA 5JW4R 4HH8A 4WFGD 3VMNA 3FH8A 3GWJA 4HIPA 1GGBH 5B4MD 5IJBC 4N24A 5E56A 2XTJB 3SGDH 2C9RA 3NCJL 2WY3B 4UT9L 5IWLA 2WD0A 5F6HI 2Y1AA 5JTWA 2IAMB 1P9MA 1SN0A 3DIDA 1AXSB 4NRYB 2YD5A 3NGBC 4RBPK 2GBVA 5GJSL 4ZD3L 4UQ3B 4JFDA 3HZMA 4ZFFA 1VFMA 1YY8A 3HCVA 2VR6A 4WV1C 2PWDA 5EFIA 5E95B 1DBAL 1X9UA 2XTJC 5GRWA 5F72S 2EADA 3VD9A 1PEZA 3GEFA 2ZWZA 2J6WA 1Z9SB 3U9PH 3UXFA 1MPAH 2XOTA 1KYFA 1U3YA 4U6YA 5IHBA 1R0AH 2N3JA 2K1MA 3IMUA 3IAPA 3LPWA 1OP3H 4M43H 5LGKA 4BM7A 3S0PA 1CLVA 3PJLA 2H2SC 4Y19B 2X1OA 3WAKA 1W0VA 3MCYA 3FO0L 1F45A 3HUJB 3OKNB 3PQYB 4NWTL 5ENWA 4PJ5A 2LLNA 3RDJA 1WCBB 2HVJA 4KQ4L 3BDYL 3HAEG 1GMEA 3UTTD 1TITA 2CO4A 1VC3B 1E4WL 1LHZA 5JHDA 4DZBA 1EXUA 3GXTA 1ZSDB 3WEXB 3ETBJ 1YMMA 3OZ9L 5DC0A 4XH2A 2KS0A 5I66A 3QQDA 3RE0A 5LWYL 2CHDA 4FQIL 1EJOH 2HT3D 4MJIB 4BFEA 4FNSA 1FZOB 2XA3A 3BEVB 2FT8A 5C2BL 2EIMB 2AJVH 2WTRA 2A77L 4HWNA 3OAYK 2YHGA 3PAZA 4NFDA 1SQMA 5I18L 1DFBH 3EO0B 3MJ9H 3DSFL 3EZ8A 4RGND 4DESA 2V2XB 3D1MC 3O3EB 5IJVB 2GAZA 3WIAA 2W65A 2APSA 2VLJA 4QDGA 4X2UA 4FZ8H 5E2JA 1V7MH 1Y1WA 5E8NA 5EF0A 2D7MA 5BOZG 3K0YA 4HPYL 3IAQA 1E8WA 2OYPA 3EFFB 3F7PC 2OMTA 1FYTB 2ADIB 2IQAB 1XXFC 4ECNA 4B9YA 5FR3A 5ALCL 1S7RA 1REIA 4S0TD 3DX8B 4ZODA 3T3MB 4XNQA 2KL6A 4YLQT 2O5XH 4JRWA 2HG0A 3TCTA 3VWJB 4QHMA 1K83A 2H3KA 4K73A 3RY6A 1MY7A 2W9LA 4KJPD 4OGAC 4GI8A 3PABB 4MNGA 4OLXH 4P5MA 5DT1L 4PJ9C 1SYSA 1RSFA 1PZ5B 3EH5B 1AZRA 3TBVB 4ALAC 3P3UA 1IU1A 1JPFA 4FQPA 4XWGL 3V5HA 3VXUB 2ATPA 3DIFA 5IB1B 4JFFB 4ZW7A 1TSRA 2YAQA 4LLWA 1BZEA 3NZHH 2IH8A 3EUUA 3D34A 2WLIB 4FQCL 4NN7B 4P9ML 5ERWB 2HUEA 2XN9E 4HJ0D 1OTUD 3T3PB 2R56H 3UL4A 2ZSVA 3RQ3A 3DARA 2MHAA 4F7TB 5C9JA 4NOHA 4K7PX 35C8L 3QCTL 3CFUA 1DJIA 2A1WL 2VB5A 5AVWB 4L3AA 5SV3A 3RWCA 2CKBB 2XFGB 3C9NB 1T66D 3W9EB 1A7PL 4DVRH 3MJGX 4NN7C 4JR9H 4RFNB 4GIAA 5HPOA 4QRRA 4LU5H 3E0GA 2BVUA 1Q0XL 2NT0A 5KVGE 3B34A 5F7DA 3BH9B 1B9KA 3VD1A 2H8PA 4FF9A 5CN3A 2KUTA 4GIPD 2PCFA 3CCHB 1A9EB 5JDSB 3BVNA 1F02I 2JKLA 1GMIA 4XNXH 1M05B 5FC9A 4MJ6B 3ZE0B 2O6EA 4G8GD 2E8ZA 2MPAL 4PJHE 2F74A 4PJEA 4BXVA 5L2JA 3NJXA 1L3NA 1FJ1B 3P77B 4LEXL 4XP5L 5K9QG 4PREB 2VXQA 3ZZ1A 1K5WA 1K8DA 2B1HH 2WNGA 3TYFA 2VDKB 2ZWNA 3JUZA 5CAYB 2IBBA 3UTTB 4EZLA 1BFSA 4Y1AA 2E4TA 2G30A 2GCYA 5J3HC 4BZYA 2N01B 1NC2A 1WG3A 3P69A 3VFWB 1NC4A 4ZRGA 4XNAA 3CAFA 2X3CA 1Z66A 4B9JA 1YNKL 2ZUVA 3SPIA 3OPZH 1HOCA 1BQLH 3N55A 3GUTB 2FZ3A 3J8F7 2LU4A 5F9WB 3WDJA 4PVBA 1RUML 1OZUA 4HDIA 1U8PA 1TQBB 3EIFA 4WU7B 3VQMA 3MLVL 2PP8A 4JRYD 4GRWH 3O2DL 4O02L 3RL2A 4RGNB 3DI3B 3UH8A 3P0YH 4O2EB 2B3IA 5CEZH 2ZXGA 3IMRA 4N2FA 4GMSL 2HT3C 3BSZA 5J6GA 1TIUA 3EFOB 3HC3L 1MZZA 4MNHB 1DO6A 1PJWA 4A2EA 2NT1A 3PNWB 2VMDA 2VAAA 2V9UA 4NB7A 1KELH 5F9WC 3SKOB 1TQBC 4BQ6A 1QLRA 2BIQA 2Y24A 3RNKB 2AJSH 1OAQH 2UY7B 3EJZD 4PV1C 1CIUA 3T2NH 4FYTA 1D7FA 4P3WA 3NCXA 4L4VD 3QJFA 2J20A 3QIWB 1CF8L 3CFCL 2V3DA 3QUXD 2OZ4A 3U0WH 5AVTB 4QO1B 3GBDA 3FUKA 5IVXB 4NO0D 1RZ7L 1WO2A 4LF3A 4M4RA 5D1ZC 3T0BA 5JW4Q 3AU0A 1VKXB 4CNIA 5KSAB 2Y1YA 3LKPB 4MJ4A 4WQOA 3VI4E 3WLWD 3FT4A 3P9LA 2H1PH 2B8OT 3QIWC 5F21B 3ZE2E 4ZQTA 1MDTA 3BHBB 4AUUA 1JHTA 1IC1A 3OMZA 3IDJA 1XR9A 1TOXA 3VNYA 4KJPC 1JYXA 1ET8A 1PYQA 3PWPE 2JJVA 2AEOA 5KSAC 1KJ3L 2MMXA 1DBKH 1UD6A 3BEWA 1CQYA 4HW6A 5FA3A 3RVXD 1HL9A 1U8QB 4RAVB 1ZXQA 3MLPA 4JANA 4RX4A 1NPUA 1R47A 4Q6IB 4KWUA 2IDCA 3QYCA 1D6VL 2CKNA 2R0KH 4MAUH 4I0PA 3OSKA 4N68A 4ELMF 3TEZA 1DJHA 1WEJL 2CK0H 3PGCA 4G1EA 1EEZA 3SDDD 2FLMA 2CO7A 1AZVA 1G4MA 2YC1B 3FOLB 3ZSTA 1G84A 5F89B 3J27A 5FCUL 3UROR 4CC4A 1QFWL 4K15A 1XAUA 3CZEA 4E9TA 2VPXA 7TAAA 4OV6F 1R3JA 3MV8D 3LKSB 1L9RA 3ZZSA 4Q6IC 2I9TA 4GKNA 3LNDA 2IXQB 3F65A 4KKPA 4OKVB 2PYEE 5F3HB 2NVYA 3ASWA 2E7LC 2WLHA 3ZVVA 3VQLA 5I1KL 4XP1H 2GK0A 4U1GB 1O7DE 3MA7B 2WINA 3CVCA 2QVFB 2EXYD 3AUWB 1ILUA 3KGUA 2GI0A 4NXKA 3UYRH 4LE8A 3FQNB 4YSPA 2IO5A 1IMHC 4HJTA 5HDBB 1AQKH 1QA9A 2OTPA 2XFXB 2XXMB 3KGRA 5EV7A 1CDIA 3WY3A 2J8UA 1R5VA 1BQHA 1RUQL 1FLTX 1IAMA 4IRJA 4MCZB 4N3UA 3JYCA 1SJEB 1A6TB 2F2HA 3QUMA 2XG5A 5CZVH 4HGKC 4XGZA 5IB2B 1KCUL 2J88L 4OV5B 2QPDB 3QFJA 3FONB 1H6FA 1UTDA 3FU0A 4G6JH 4K7PH 5EOCH 3UX9B 2OCFD 3OF6A 3WJLA 4JN1L 5E6YA 5C3LD 1U8MA 1G6VK 1NAMH 4K94C 4ZDHA 4O4YL 2GG1A 2D0FA 1A6AA 2JCCA 3C60A 4HX1A 4PJDF 5KTEH 5L2KA 3PRZA 2R2HB 4JL1A 5GRXG 1DBJH 3FYEB 3MRFB 2ZCZA 4J3OF 3KXFE 3HN3A 2B4CH 4YZFF 3M6DA 5DJXB 4NUJA 1RL1A 4LHUA 1ILSA 4DZ8B 2A83B 3LPGA 3FT1A 4WWKD 2KBGA 1KF9B 2X1PA 2A9NH 1B2WH 1SLWA 4K9JA 1LWJA 1A6VH 2O30A 2XZQH 4L4TA 4UQEA 5GS1C 1ZC1A 1JXKA 2CHZA 2YD0A 4QRTB 1PQZA 3E1F1 4JPSA 3MV11 1W8OA 5IG7A 4HUVB 2PYFB 4L4VB 4N2KA 3VH8G 5SWQB 5A3ID 1R46A 5FM5M 3HHRB 2EKJA 4LVEA 2NY3C 3IETA 1EAJA 1RSYA 3F7KA 3QUXB 3OKKB 5D70H 4I18B 1VGEH 1CICD 2QZQA 4FNTA 1TYJA 1ORSA 1F11A 2UVEA 4UIKH 3RWFA 4DGIH 5FOBB 4LLAA 2HT4D 3ZTEA 4H7VA 4G6ML 1H8LA 2VWEE 2OJEA 2ZONA 4QHUA 3ROOB 5DA0B 2W38A 4E5XA 3HRPA 3QDGE 2VDPH 1FNAA 1OLLA 4Y2LA 3E38A 1WC7B 4I18C 5TE6H 4BELD 1LP9F 3FHEA 1SMYD 1GGBL 3JZYA 2H2PD 2ZE0A 3V4PH 4LIQH 1FI8C 4F3FA 1J1PH 2QTEA 4FQJH 4GAAA 4N4YB 2JIRA 1N6QH 2NYYD 4S1DD 4JFHD 3BVXA 4L1BA 2HLEB 3HG1E 1DDTA 4PP1C 2LVEA 3U0TA 5JIIA 3PDOB 2Y6SD 1UM5H 2G5RA 3TIEA 3P3TA 3D30A 4N1HB 3CDCA 4ZSOB 3SDDB 3L3DA 3OQ3B 1OA9A 5HSFA 3II3A 1CG9B 2YAEA 1IJ9A 2FYYA 4HZ1A 3U9PL 3QWRD 4NEHB 1MPAL 3MV8B 4LLYA 4X5WB 5LBSH 1R0AL 4M43L 4BFIB 1FNEA 1ZGLM 3BWAA 4AT6B 3SDDC 3DKHA 3PWUB 4KXAA 1JHLH 4DPCX 5FDWA 2ARWA 4H40A 1S9YB 1BXAA 1Q0YH 4W4OA 3CX2A 3IGFA 4WVRA 2E47A 4HJGA 3FT3B 1BXUA 5GGRY 1O6SB 3AT9A 3CFJA 2D0HA 2F7RA 2CK2A 4MB1A 4KNUA 3RX5A 3MRBB 1DVFA 4AK1A 1BF8A 3IMBA 2EH8H 2ZX9A 4D7PA 4OJAA 4U6HA 4XVOA 5E1IA 2KI6A 2VITB 4W93A 3VXMA 5JXED 1PEWA 2EXYC 4PJFE 3PPSA 4HKBB 1PU0A 2R7EA 2R15A 4L4JA 3ZDYB 3S9DB 1EJOL 3MX0A 3FCSA 3X2QB 5I0WA 5EEWA 2EXTA 5ACLA 2WM0A 2AJVL 4ZUSB 2VQ1A 4PRBA 3AUVA 1D5XA 4V1DD 1IZJA 1PX3A 3V0DA 43CAB 1NGWB 1L9TA 5JIQA 2FCBA 5EZJA 3GTNA 3A0OA 5TK4A 1DFBL 3MJ9L 3MYJB 3TVMA 3VFUB 1ZGLA 4D0CB 3RZCA 4ZMLA 5HHPB 3IE4A 4NO3B 4I13B 1NBCA 2PW1A 2DS4A 1QQDB 4FZ8L 2XTLA 1XGTA 1V7ML 4XBMA 4NKMB 1BFTA 2OV0A 1QUNB 1D7BA 3DPDA 1CN4A 1FVDB 3A21A 1TU2B 4GKOA 3N44F 3HE6A 2CCWA 1HHIB 3DX7A 3Q1SH 4PRID 2O5XL 3JVFC 5KYYB 1MLBA 4YXLH 2VN3A 4ZTOH 5BO0D 1O6TA 2NUPA 5FUZH 4YVNA 3C2AH 1XF4B 4OLXL 4LLDA 4I3SH 4B60A 3QORB 1T5XB 1QSEA 4EEEA 1AANA 1E9QB 4L1HA 1MEXH 1N8ZB 5D4IA 5AVQB 3NIGE 2UXTA 4N1CA 4PI2A 4FMKA 2OMYA 1P2CA 2YD3A 3P40A 3FC8A 3GJFA 2PW2B 2V5RA 3UTZB 5MEND 2Z0BA 4XVTH 3NZHL 3OC5A 5E1HB 3D25A 3FFDB 1OCOB 1NMAH 1XSIA 3SKMA 2PWEA 2R56L 4EI6A 2A9MH 3QORC 4Q4EA 5TF0A 1I8KA 4EUPA 4AWJC 3TONA 5EORH 3QQ9C 2WQWA 2EE9A 4JY6B 1CXFA 2BJMH 4AE0A 3APCA 1TDQA 1BFVH 5KAQF 2E8YA 3BO8B 1H3PH 1N9PA 4DVRL 4RMVA 4JR9L 2PCPB 3PWJB 3NACH 1UVQA 5E2VH 3ZHDA 3TBWA 2DIBA 5IB4B 2WPGA 3GQFA 4LU5L 1ZHNA 2ILLA 1RPUA 3WS3A 5CIPA 2C5DC 4KKLC 1XCXA 2GTZA 1JYVA 5D1QD 4WK2B 5L6YH 3OAUH 2BVOA 2XKSA 1UZ6E 3G04B 1E5CA 4DOHE 2P5PA 1EAPB 2MH4A 3VXSA 4XNXL 2FGZA 4MKTA 2D31B 2AJZA 1CQKA 3II2A 4CKVX 1HT6A 1M2OA 5AZ2H 1ZVNA 3GMNA 5MEPB 3DMRA 2R9HD 4I9WD 4X8XA 5JW4N 3HMWH 1FZKA 3QIBA 4RVBA 1OEZW 5C0BA 4ZMVA 1XEUA 2B1HL 2UXFA 5PCYA 2EVIA 2N0MA 1ZGLP 3S3DB 1AD9B 2VRAA 3NPSC 4X80H 1GS6X 3PHSA 2X70B 2NX5D 4L3CA 1FZMB 1TKWA 2BHYA 3AW5A 3BWZA 1PBYA 2YLKA 3IDUA 1PMYA 4UU9A 4YHLH 1MQKH 2CUIA 3WIFA 5I1AA 1JZ2A 3MRDA 1MI5E 4RDBA 3OPZL 4RSYA 3GSUB 3V79C 2WQAA 1BQLL 2C3GA 4IIQB 2V7NB 4JNXA 4V1DB 2D3LA 4NKDB 3M1BB 4K3EH 1ERNA 1HNFA 4HC1A 1HCZA 3MROB 4XHJC 1FNGA 1NCJA 4P2OC 4ZS6C 5FTKA 3ES6B 3P0YL 1W91A 5CEZL 3ATDA 3P1VA 5DRZA 3IDXH 2FH8A 1ZRUA 2NUTB 15C8H 2KI8A 4MXVE 2UZPA 4PD4J 4TLTA 3T77B 3VU2A 1UD2A 2UXVA 3L5WB 4IIQC 3L17A 1F8TH 1KELL 4MNQE 2YJLA 4IJ3B 4Z95H 3NA9H 3VFMB 1KLUA 2AJSL 1OAQL 4HWEH 3T2NL 4RA0C 5C0DA 2DN7A 3L3GA 3BDXA 1IEBB 3KS0H 3QNXB 2ICEC 4FYSA 1B90A 3LHAA 2NR6A 4PRIB 3O8XA 3OJVC 1PG7W 2VXQH 1UGKA 3KLHD 1WIPA 5EG6C 3FCGA 4YHOH 3U0WL 2GITA 3QG6A 5BW7A 3WFHB 3R7RA 4XZUA 5HDQH 4AVKA 2QJDA 4YDJA 3UCRA 3TPUA 2H1PL 2CLVA 1S7SA 2F1BA 2IADB 1BM7A 5I71B 5JOPD 4MHHG 3ZKNC 1OSYA 1RZIA 2DWXA 3U6XA 3U4EB 5F8RC 3K6NA 4JFED 3TIDA 1TEYA 2BVEA 3KWXA 4LCUB 1IAII 4KVCH 4QF1B 1YC8A 1XCTA 4NDMA 1DBKL 5CS7A 4OZIE 3MRKA 5BMFH 1HXYB 3B2DC 4Y4KD 2XWZA 4J3TA 4KKAC 4Z76A 3SIKA 4MAUL 2Y5EA 1NA8A 2R0KL 3EZJB 2HJLB 4AVIA 1KYOK 4D9LH 4GBXA 5F0LB 4MA3A 3FQ2A 3KD4A 3IMVA 2CK0L 2KC0A 3BSZH 3LTVA 4M6OH 4P5KB 1D9KD 1UHVA 4QWWD 2HRPH 1N3NA 5FPIA 5T1KA 1QSFB 2EYTA 4GFTB 2APXA 4HJUA 4FEIA 4X9FA 2AV1A 4YR6B 4CMMA 4DCQB 1R5WB 4GINA 5JZ7D 5LVEA 4UZSA 2VLRB 4N2HA 1PVHA 2AEIT 3KEHA 5IBLD 2X4UA 5AKVA 4U31A 4J8QA 1NJ9A 4XP1L 3PG2A 3LIZA 5HGAA 1X4XA 1X5HA 2ZNXA 5C0AA 2OZ4H 3PL6A 3UYRL 4X6DF 5G5DA 1CK0H 1FFPA 4YDVA 5D8JH 2J57A 2OSYA 2MEJB 1QX1A 1AQKL 1IARB 3GM8A 3FT2A 3P30H 3D4YA 3Q9PA 2ZKMX 2AABH 4OJCA 2ZJSH 1AO7E 5J12B 5E1GA 5C0CA 2IC2A 3FB5A 3RRQA 4KROB 1QDNA 5F7EH 1MAJA 5CZVL 3IFNH 1G0DA 3Q8CA 4HPHA 4S11A 5I0ZA 5IESH 4FXTA 4WTXA 4KO9A 1QZNA 4K7PL 1VSCA 2YD7A 3QC6X 5EOCL 2QTVA 1URLA 2VL5A 1BFOA 4U1IA 3IGUA 4MASA 3BPLC 1NAML 2DIJA 3BH8B 4PJXA 3I6KB 2DI9A 3RTLA 1JIBA 1F41A 4NQCE 4CVXA 5SWZE 3F7VB 4KROC 5KTEL 3JV5A 5HVGB 4O2CB 1DBJL 4FA6A 3OVUB 5CN1A 4LPWA 4HWBA 4GIOA 1GGYA 3LH8A 4KFZC 4F9PA 4ZFGL 2ENYA 4M48H 2B4CL 3IXTB 4YIQA 4BH7A 4HOMA 1ZLEA 5DMGD 4N0CD 2H6PA 1GKEA 5CWSB 2DBJA 2Z31A 1PW3A 4X6BB 3I74A 4NC1C 2IV9A 4XMWA 3V7AE 3OMIB 3MNWB 4N85A 2A9NL 2N7SA 1B2WL 1TQVA 1TXKA 2B5IC 1L5GB 1A6VL 2XZQL 3UZQB 4E9LA 1E4KC 1UXWB 2VUMA 3DX0A 4HXBH 3O11A 4TTDD 2GUOB 1LDSA 1COBA 3L8QA 4HEME 4F2EA 2BPBA 3C6LD 2FO4A 1JDAA 3HE7C 5FYLE 3QUZC 5D70L 5AUMB 1UXMA 3VGFA 5T3ZE 5L8KB 1VGEL 3MUGA 3U2JA 2JQAA 3O6LH 3RFZA 1EJ8A 1S9VB 4DGIL 5HHXL 4UIKL 3DC0A 4X6CE 3RDTA 1BPLB 3HAEA 3QUMH 4QHNB 4X99A 2DWTA 4OGQC 1K72A 1H15A 4ELMB 2VDPL 4BJLA 4PJBF 1KLFA 4K7FA 1FIGH 1F00I 2PLTA 3BRFA 1BVLB 2E7BA 3K8MA 5EU5B 2DD8H 5TE6L 3RWHA 3WS6C 5F9JB 1N5YH 2BXZA 4AIEA 5EO1A 1J9CT 1R33A 3V4PL 1A1MA 3LRLA 4LIQL 1J1PL 4FQJL 1N6QL 3BMWA 5HHNA 1URIA 1ZEAH 5JNYB 1NBYB 4RIRA 1V3KA 2OP4H 4GAYB 3LKQB 4Y89A 1UM5L 4BWUA 1WFJA 3D08A 1T20A 2BCKA 3Q5OA 1D9KB 1HHHA 5IQ7H 2VLKD 3RVUD 1XR8B 3QULA 4RGOH 2N56A 2EICA 2DQCH 3KL5A 3MRIA 4JPWH 5HJ3B 3V5KA 5JQHC 5LBSL 2DMCA 3GPSA 1JGVH 2A6KA 4XN7A 4MZRA 3UBXG 4WY7H 3J07A 1JHLL 3QUYA 1CE6B 3BMVA 4MA1B 3TU6A 4HUWA 1Q0YL 1OE1A 1J12A 4Z0BH 4S1SH 4OFIA 1A1NB 4NQDA 4ZQKA 5E7FA 2F15A 3MRQB 3UTQB 1SHWA 1A5FH 2J2ZA 1SXNA 1GYWA 2X1XR 2WXFA 2E5EA 4J3XA 5D6CB 1T6BX 2EH8L 2OR9H 3KLQA 2RMNA 4PJDB 3H2WA 1FZJA 4KAQH 3U4AA 2VE6A 2VLLA 4JO8A 3SBWC 4MA1C 4HIQA 2ZAIA 4YQXH 3WJMA 1M6OA 3I9AA 4V2CB 3HU3A 3L3IB 1X5GA 2YPLD 2NY6D 1WYJA 5A1AA 3D3VD 5FA4B 3KPMA 1DLHB 3VG9B 1TTAA 1CBVH 3OLDA 2R69A 3B5TA 2IH1A 3Q6GH 4XNMB 1CTOA 1PZ2A 3NZ8B 1ETZA 4LAJH 2VMJA 1OXYA 4J3OC 4KK5C 3SE6A 3O4LD 3L16A 4UOZA 4XVUD 2MKLC 4FTVA 5AENA 3EH2A 5DD0H 2QLYA 2ZAGA 5KZCD 1HHGB 2D2OA 4KRMB 3ABZA 4NQUA 1FL5A 3GBEA 3C6SB 1N0LA 4JGMA 4UAHA 3RIAK 3P3YA 1NPNA 1QEWB 1T89C 3B5GA 5IBTH 5ETUA 4NQVB 3REWB 4G42A 3Q1SL 5A2FA 3N1GC 3CSYB 1TMQA 3FQRB 2CDEA 2VCOA 1RQ5A 5CJQH 3C6LB 4YXLL 4ZTOL 1KULA 5FUZL 3C2AL 2XDHA 4I3SL 4KKZA 3GBNH 3B9KA 1CZ5A 1MEXL 2DWDA 3MUUA 4JRXD 4ZX3A 5GZOD 1RJYB 5SWSA 2XN2A 1A66A 1DQDH 4XP6H 3WNPA 4BQ8A 1SXZA 4XVTL 2DQEH 1SUHA 2JJTA 3C6LC 1DUYB 1MCEA 1NMAL 2KERA 4IBLT 2A9ML 3H85A 2VL4A 1GL4B 3NJFA 5EORL 4I1RA 3AQZA 4LLQA 1P5VA 2BJML 3PWLB 1BFVL 1J5IA 1H3PL 3TJHD 5FTJA 5D4QA 4N0RA 4CDGC 4JPVH 1S9KC 3NACL 4WUKH 5E2VL 4NP4H 1GCYA 5B1KA 3SPHA 2BZ7A 1PKQA 3MI6A 5T33H 4W81A 5JQIB 3K7UA 1PZUB 1KTDA 2A99A 2K6ZA 5I2IB 3MUJA 1U6AH 1T4KA 1HEZB 5BXFB 5L6YL 3X2NA 3KDMB 3OAUL 4OUOA 3VD0A 4B7IA 2DV6A 3DUUA 5AAWA 4LPXA 4K4KA 4ZOCA 2W60A 1WC2A 1Z5HA 3MV9B 4HKZA 5AZ2L 1CZ4A 4U1LB 2BZDA 2C1OB 1N12A 2DQFB 3HMWL 4NRXB 1NKRA 4AIOA 5INCB 4F33B 3FDWA 4WEUD 3TS8A 2WW8A 3GJFH 4AH2B 2WTPA 5JW4M 5L0QC 5B8CB 2XIDA 1ML0A 4X80L 1KT2A 3JTSB 1H6UA 2FH6A 2ZAHA 4BHUI 1TVHB 3OR6B 2ZKXA 1U33A 4YHLL 3EBAA 2D4DA 4EUPH 1MQKL 3IS0X 1QHQA 5EU3A 3LB6C 4D94A 3FUNA 3B6SB 1KIQA 4Y5XB 5TDNB 2YPLB 1BW3A 2NY6B 1X7SA 2AVGA 3D3VB 1IBFA 3W5NA 5B8CC 3Q8EA 5E8OB 4ZNEA 1P69B 3TCXA 4K3EL 4J8RB 4L3EE 4F7MB 1LWRA 3ABMB 1DQJA 3N44B 3A4DA 4C4UA 1EZVX 5D2NE 2YD4A 15C8L 1K2DB 5FS5A 1HCYA 3MLWH 4Y5XC 4FFVD 1BZDA 1N18A 4JFQB 4WNQA 5B1CA 3LZFH 3WENA 4C56A 4NQSA 1TQUA 3V6OC 1IC5H 2ROYA 1U8IA 5KZCB 1F8TL 4M1CD 5JPMA 3CFEA 4Z95L 1QO3B 1VIWA 3NA9L 1L0PA 4G7VH 4V33A 2NZ9C 5EU6B 4HWEL 1Z0MA 3O3BA 2DLFH 2WXLA 2WC7A 4KDWA 2EQDA 5IVNA 4HUNB 1H0HA 4NN5B 1X7QB 3CHQA 4Y7MA 3MR9A 4XVUC 3VRLF 5E9AA 4AGLA 1K9TA 1TWHA 2VXQL 3KPPA 1SVBA 5B38B 3DVGB 1MN4A 4YHOL 4QMEA 5HGHA 4ACPA 1TJMA 5FKPA 4AEEA 3LD8B 2X3AA 4B95C 2Q9OA 3RIFK 1BV8A 4ODTH 2Z91B 1YLBB 3G08A 5EO9A 2XXCB 5HDQL 5EBGA 3DROA 5C1BA 1EZSA 1NGZA 3KPRA 3L3JA 1I4FA 1JXGA 1HJBC 4I89A 2ITDA 1J8HA 1BIIB 2VXSH 4R4BB 4XOCA 5AAMA 3ARSA 3AAZA 1LDPH 1WFTA 5LNDA 3MBEB 5GLXA 1IM3D 1BMWA 4ZXBD 2WXIA 3MRNB 4N2DA 4KVCL 1QUPA 3KPQB 5D4HA 4F37K 5DJ2A 1MQ8A 1E5VA 1CPUA 3IDGB 5BMFL 1O7VA 5FGCE 2DM2A 1UOLA 1SF5A 5JPNC 4XX1G 1JG9A 1BVZA 3BUYB 2QLVB 4FLOA 3L5IA 4DP9X 2VC2B 1THAA 1HYSD 3RBSA 3ZQWA 4D9LL 2IALA 1QPXA 5L8JB 3MBEC 4MRBA 2HG5B 1FO0A 3BSZL 4M6OL 3JV6B 1KIUA 3DX6B 2HRPL 2YPKB 1KXTA 1LE5B 1LNUB 4F2MB 4P4KC 1F6FB 3FO9B 3S96A 3N04A 3Q2WA 3I6LD 4IYKA 4QTHB 4RRPG 4N0UB 3QS3A 4OZ4B 4NCC2 3TBYA 3SHSA 2R7ZA 2IF7A 4UINH 4OFPA 1OE3A 5F7AA 4QRPA 1I3GH 3GSOB 2XUWA 1RIUH 1TTBA 3ARDD 2F7PA 4GQRA 3QJSB 3FAXA 4ZTPH 1RPQA 1NFDE 1UA6H 2OZ4L 3L7FB 5FYLH 1XV8A 3VH8A 2BSRA 2HVKA 1CK0L 5D8JL 5ISZE 1PLAA 3QWQB 3LSOB 3GTVA 4QD2E 3IMSA 3VVVA 2YMOA 3P30L 3B8YA 1MAKA 4I9XA 2AABL 1PSKH 1E27B 2ZJSL 4PCSA 5D7IE 2P46B 4DKFH 4LP4A 3IJHB 4UIMB 5F7EL 1CXEA 2GPZA 3HLKA 3IFNL 5IESL 2OZNA 4QHLB 1S8DB 5JXAH 3D4CA 1AXSA 1U4FA 2X4OA 4TN9A 1Z9LA 4UQ3A 2P8PB 1YEJH 1X4ZA 1JN6B 1LGVA 4M93C 5CM1A 1DVYA 1JXJA 4HG4K 1MCKA 4ZX6A 4LRIC 1Z9SA 4TOYH 3OM3B 2Q8AH 1FSKB 5AW5B 1KCWA 1P1ZB 4M48L 2CA4A 2D7NA 5CJOH 3MNZA 4TNVF 3WFBH 1U8CB 3VRIB 4Y19A 1EHAA 3UAEA 4J12A 4K2UH 3BXNB 1NZRA 3OKNA 1NBZB 3LCYA 4FZEH 2KKQA 2F1EA 1WCBA 1XL6A 1UXSB 5EEXA 4NZ8A 4K23H 4YSOA 3VW3H 4HXBL 4RAUB 1FSKC 4LVNC 4A66A 4FFTA 3LIZH 3VGAB 5BUGA 3D06A 1LILA 1DDHB 1W6LA 4L0PB 3QISA 4XMTA 4B9GA 1ZSDA 1RU9H 5C0JB 3IJEB 2O6CA 3WEXA 4CC0A 1JZ7A 2XQYK 1OB1B 3PWVB 3HHSB 4M1CC 3AG1B 3O6LL 4EXPX 4UMGA 4PWFA 2W59A 4LEBA 2IDSA 2G2NA 4MJIA 1FZOA 3IRPX 1IC7H 2YZ8A 3BEVA 3QUML 2Z92B 3IB4A 4PBVC 4U7KA 4B0MB 4ODBD 5CFAA 3D2TA 4YHNA 3GKZA 3EH1A 3CE1A 2IDFA 5BOPA 1XSKA 5DC9B 2OX5B 1FIGL 2CH8A 3EO0A 5ICZA 2X87A 1XIWC 4PHZA 1N19A 2DD8L 2V2XA 2F6AA 1N5YL 1S3KH 4PCKA 3WOVA 3MRJB 2J7LA 2COQA 2HX9A 1JMXA 3CX5J 4NKOB 4UQ2B 3TFKC 3IXAB 1ZEAL 4D9QE 2EDMA 2JH2A 3HN5A 2OP4L 5T1LA 1OGAD 4ZAKB 4YDNA 1FYTA 2ADIA 1SZNA 2IQAA 1IGIH 5IEKB 3E9UA 3SDXF 5IQ7L 3DX8A 4JM0A 4X6DB 3H42H 3HR5B 4Y5YB 1A64A 4RGOL 3VWJA 1E5ZA 1EEYB 2DQCL 3NJNA 4JPWL 3PABA 4IQHA 2V5SA 5E9DE 1KGCE 4ZAKC 1JGVL 1PZ5A 3IKCB 3AG3B 4I2XB 3LNFA 3AXLB 4WY7L 2BZCA 3EJYD 4P06A 5ACZB 5TJWK 3SGEH 3V9CA 3VXUA 4O00A 4Z1PA 3ARDB 2HFTA 3BW9B 4JFFA 5IB1A 1G7JB 1UD5A 3K2KA 4J3OG 4Y5YC 5D7JD 1ZYRD 5DHDA 2WLIA 4Z0BL 1J11A 4S1SL 1G1CA 4G7SB 2EEBA 2CJTA 4EDWH 2ZYIA 3HAEH 1A5FL 3GTOA 4B3VA 5AW3B 4F7TA 3POCA 1X5IA 2YEZB 4PYGA 2OR9L 3VXTB 5HJDA 1Z9NA 4JP7A 2Q2LA 3RPIA 1P4IH 3ARDC 4KAQL 1G9NC 4P3DB 2CKBA 5E6ID 2VOTA 5SX5K 3W9EA 4H0IA 4TL5A 3ZKMD 1CDUA 4YQXL 2XPGA 4NQQA 5AVVB 7PCYA 3B37A 3WDIA 3EYSH 5KVDE 4J3BA 1I3RB 2G3NA 4NZRH 5IZ7A 1CBVL 1OZTG 5CLXA 1E50A 3Q6GL 1UWXK 1VHPA 2EDTA 4BSVB 1LXMA 3WKPA 2YUJA 3TZVC 1IBDA 1NOFA 3I75B 3CCHA 1A9EA 4M8UA 5JDSA 2EDEA 3IDMB 5DD0L 3TBTB 3MV7E 4MJ6A 4BE5A 1I82A 2GIMA 3LNGA 1LM8V 2P3YA 1DLFH 3P77A 1FJ1A 2BWIA 2JJUA 1L6ZA 1K4DB 3BZFB 3QXDB 5IBTL 2DI7A 2XN1A 1JK9B 4AJ0A 3BIKB 5J3HD 5CEXB 3RX7A 2X10A 2EVFA 1QFHA 2FJSA 4FNPA 2WVSA 1YECH 5CJQL 4PJBB 3VFWA 1UT9A 4NAQA 1RCYA 1BVNT 1K6QH 3QJZA 4PJ7E 3GBNL 3S98A 3S8GB 1B0RB 3WLBB 2VMFA 1EX0A 1OM3H 2G2RB 2E2IA 1DQDL 3VVWA 3ZIMA 4WEEA 4XP6L 2Y2TA 4Y1SA 3UJIH 2DQEL 3GUTA 1G7HB 2F53D 1HQ4B 2NTFB 4CSSA 3ARWA 3VTMA 4HLZG 3TT1H 1XCWA 2BH0A 4G6KH 4O2EA 2BNRE 1UH3A 1YUHB 3WL9B 3Q3GA 2R69H 1OA7A 2P5WD 1DQQB 1SDAB 3S37H 3RY5A 3EFOA 4W9FC 1WA0X 4MNHA 3Q2CA 5E1AB 3H9SB 1F3JB 3NQKA 4W9ZA 3DX2A 4U1NA 3WTSA 4L18A 4OFDA 3SKOA 1BECA 5D1ZA 1FORH 4JPVL 2CO3A 4WUKL 4JE4B 2UY7A 4NP4L 5G55A 3RNKA 4GRLD 4GSUA 3SDCD 3UGEA 1KZYA 5T33L 2ZG3A 2BP5M 1KGIA 2C7UA 4FQ2H 4M6NH 2O6FA 1BYPA 3QBTB 3T0VA 2UYLB 1TQSA 3QIWA 3R06B 3GPEA 3P73B 4L37B 1U6AL 1A9BB 5CLZA 2BIPA 2XQBH 4FADA 4QO1A 4R97C 2DQMA 2W8CA 2YA1A 4JL2A 5IVXA 4RZKA 1VKXA 2QGCA 4WFFD 5KSAA 3UO1H 5I1IH 1LO5B 1ACYH 4ZX5A 3LKPA 3EXLA 2V4LA 3VFOA 3W0WD 1DUZB 4FJYA 3GTPA 1U3HC 3NCWA 3F7YB 1G8JA 1RZKH 5GZND 4N25A 4Z7UB 1AKPA 3BHBA 1ZHBB 3HPLA 4LL9A 1VZIA 5AG8A 2WUCH 5KBLA 3H8NA 1L8FA 3CQQA 3X11A 1TNNA 3WN6A 1QG3A 3F12B 2BOCA 2CPUA 1FDIA 4DGVH 3V9FA 5FYKH 4TMPA 2Z93B 4TPRH 4XP9H 4RAVA 5J6HB 2CUHA 2IWFA 4Q6IA 5BRZD 5E6IB 5LGJB 2VABB 3QO1B 2E7LA 1CC3A 5DCCA 3EG9B 1KBPA 1WGOA 2YC1A 3FOLA 2VZUA 4HAKA 5F89A 5IVOA 5F3BB 3F3HA 3QCVH 3JWNH 1DJWA 4I5BB 1M7XA 5L7XH 3LKSA 3CWGA 1G8KA 1S6NA 2GSGB 2H32H 5E6IC 4FX5A 2YKKA 2IXQA 4G5ZH 3ZHLA 3BN9D 3WFZA 4OKVA 1YPZE 4CJ0A 3IMWA 5K39B 3MLWL 3PAYA 5AB2A 2QMJA 3B4NA 4X4YB 3LZFL 4WCYH 5B38G 3MA7A 1IC5L 3B9AA 1CLYH 4JO2H 4ORGB 3FQNA 4G7VL 2A9CA 3D09A 5E8PA 4WFHE 1VAHA 2DLFL 4KOBA 4K8RC 1XF3B 1BPVA 2XFXA 4NI3A 3ULSB 2DH3A 2QV2A 5KAQG 4FNQA 3BX7C 3EOTH 3IEAA 3O2VH 5AW9B 1A6TA 5J11B 1YJDC 5DZVA 2QQNH 3ML1A 5IB2A 3HC0B 1VENA 2Y7QB 3FONA 4ODTL 4WO4D 4ANVA 5T1MB 5ICYB 3HU1A 5IIEB 3DOHA 1FFOB 1LEIB 2VXSL 3SN6N 5CSBA 4U49A 1LDPL 4IOFC 4W9JC 4EKXA 3N41B 4HWUA 4HJSA 3MRFA 2DM4A 2M26A 3DNKA 4PJHF 1WZ1H 4OLVH 4PCYA 2CALA 5DJXA 4PP2B 4DZ8A 2OI9B 2P5WB 2A83A 4HKXB 2WLKA 1QYGH 5IFHH 5T1JA 4PGZA 3RZWA 4EN3C 2WVTA 3TEWA 2G75A 2B59B 5LXVA 2AXJA 4KKBC 4X7FC 2V8LA 4P2QE 4JRFA 5ADOH 3EGSB 5ECJE 5D1XC 3SDCB 1BAWA 4HUVA 4X7SH 2PYFA 4L4VA 3BAIA 4G6AC 4MMXB 5SWQA 1HI6B 1PLBA 2EE2A 2OI9C 4PMFA 5I5MA 3SY0B 3H54A 3OKKA 4R5XA 5GS0H 1SHXA 4I18A 4UINL 2XWTB 3GIVB 4F8LA 2PCXA 1I3GL 3TTYA 1RIUL 1PCXA 3SDCC 4RMRA 3NCYP 1NGQH 2EJ1A 1HKLH 1FIEA 1SEQH 3X2PA 1UA6L 3BD4A 4PY7B 4ZTPL 2ZTBA 1GJWA 2DLIA 3CD4A 4MMXC 5FYLL 3ROOA 1QP1A 4DEPC 3CZKA 3KDPB 5DQ9B 4EIGB 1YEWA 3SULA 2WXQA 2WVUA 5AOLA 2A7BA 2CGRH 1KGWA 2E27H 2CIIB 1WC7A 3M8OH 3QZOA 3FSOA 1PSKL 4L8DB 2LLLA 4OF8A 1RZPA 1RHFA 4DKFL 2JK5B 1JWMB 4UUJB 2FR4A 1OPGH 4GB9A 4CRPA 1DVTA 4PAZA 5JXAL 4N2CA 5C8JB 1S7XB 5BRZB 2C34A 2WLLB 3RTQD 2EIKB 4KK9D 1RY7B 2EE0A 4R3SA 1Z9MA 4WUUD 4ZSOA 3FQUA 1PY9A 3SDDA 1YEJL 1YNND 3D4GA 4LSDA 5E8DH 4I48B 1CG9A 4ACTA 3U9UB 3K46A 4TNWF 5DZPA 3UPAA 5DJ0B 1SVZA 5I8CB 2VLME 2ZPKH 1K5NB 5AW2B 4TOYL 1FO0H 2Q8AL 3MV8A 2WMPB 2IEPA 4JM2F 1KPVA 4N90D 4OUUB 3VI4F 4X5WA 5CJOL 5GGSY 2WXGA 4PTUB 1CL7I 5FFLA 3WFBL 4BFIA 4AY0A 3ZE2F 1ESOA 4AT6A 3PWUA 3EOYG 2UY6B 4K2UL 3BZEB 5CEZD 5JUEH 2CO2A 1KENH 4FZEL 3VGGA 1S9YA 5G4MA 4GSDH 4P5RA 2E7ZA 1MXGA 4YGAB 4K23L 3VW3L 3FT3A 3LIZL 1UH4A 5J1SC 2HPTA 1O6SA 1JL8A 1S46A 1T7YA 4IIZA 2GVYA 3MRBA 5MEQB 3FO1B 4G8IB 3PUUA 1RU9L 3AACA 4X42A 3UBXA 5I6KA 1KFGA 4DO4A 2VITA 1EHLH 1GY2A 3ASNB 4XBPB 2DQTH 4HKBA 1DVXA 5ECGA 1TUPA 3O5AA 1ZT4A 4AIZB 3QEQD 4WO4B 1IC7L 2GBUA 4ELKB 2YSSB 4AKOA 1OCCB 4ZUSA 3CZFB 1RZ8B 4AVHA 4LPYA 43CAA 4A6YA 1L7IH 3NABH 2YBRA 4AM0B 3TJPA 3MYJA 3VFUA 5C0FA 5JHBA 1A6ZB 3VXRD 1S3KL 2LABA 1OD9A 2ZXQA 4OZHE 4D0CA 5HHPA 4NO3A 2CHNA 3T9WA 2E86A 4QR7A 5FHBH 2BSDA 5CCGE 3MRPB 4WI2A 7CGTA 1QQDA 2OMNA 4IGBC 4OJYA 4UZUA 5IHWA 1OKEA 1P5UB 3Q8AA 4RMBA 1L7TH 2Z7UA 4JJHA 5BS0D 3SD5A 1G87A 5JHLA 4IRSC 4JAMB 1QUNA 4G6FD 1IGIL 3GI9H 3UACA 1FVDA 2X09A 3PV6A 1TU2A 2JB6B 2O5JD 4KVNH 1J86A 1HHIA 2WO3B 3H42L 1A3QA 1I8MB 3EYFB 3HFFA 4FI8A 3WFDH 5KYYA 1U8JB 5GLYA 1P5UC 4CU6A 1BMGA 1H3GA 1XF4A 3CFMA 4FXKB 1FFNB 3QG7H 4OCWH 3QORA 1T5XA 1OAJA 1OF2B 1KDJA 4TS6A 1E9QA 5H4ZA 1N8ZA 4PD4K 2EZ0C 2FEDC 2PW2A 3UTZA 1D5ZA 4MAYC 5AZEH 4GSQA 2C3XA 4A7GF 1KBGH 4NC0B 4OZGB 5DZAA 5LCVA 2JI1A 3TO4C 5MEOB 5D7LD 5AEAA 3TN0D 2QADD 2X6CA 3L1OH 2WQUA 5DEGB 3HOGA 3MXVH 2VKXA 5A7EA 3OX8B 2DMGA 1A1OB 4HIIB 3SYCA 1BP3B 1Q38A 1TETH 4FD0A 4EF3A 2Y3AA 4JY6A 1P4IL 3X2IA 4PH8A 3FOMB 3X2HA 1T83C 3BO8A 3DOIA 5DHYB 4H1LB 4G9FA 2PCPA 2B9AA 3EYSL 4MZIA 2QL1A 5CCKH 3NFPB 5IB4A 5LNGA 3BISA 4WUUB 3QK0A 4NZRL 2H26A 1IBGH 2ZXDA 3BKMH 1QHOA 1FUNA 2HLFD 5DJDB 5I1EH 2HRLA 1P7QA 3QWRA 4FS0A 3RKDC 5EHFA 4RFOH 4ALAH 1ZE3C 2E59A 2I26N 3G04A 4M00A 1HEJC 2V45A 4MWFB 4OW6A 1G6RA 3U82B 3T2QA 4AKPA 3PXHA 2XZCH 3GZKA 1DLFL 5F1OB 5DMJB 2VZVA 4NIKB 5MEPA 1ZIAA 2CCVA 1ACXA 1OK0A 4DPRA 1W8NA 4Y8AA 5TE4H 1GC1C 1NKOA 4KJYB 2ZUWA 2AXGB 1CXKA 4F7CB 3VFNB 2FWUA 2HYMA 5CINH 1AD9A 3C5ZB 1YECL 2J1YA 2X70A 2V5YA 1C12B 1FZMA 2YQ2A 5DK0B 1K6QL 2CRMA 4P2OA 4F7EA 5JXEA 3V4LA 2Y1ZA 3VE0B 5T5ID 3NAAH 4A38A 1OM3L 4YFLF 3KS0J 5CZKA 3QEQB 3GSUA 1QBAA 2PR9A 1N26A 1QI5A 2NQCA 3UJIL 2CKBH 4IIQA 3L4CA 1Z9PA 1I8UA 4V1DA 3C5ZC 4NKDA 1XGPB 5DD1H 4AZUA 3HR6A 4X6FB 3GTQA 1HH6B 4OZFB 4GI9A 3SDXB 3TT1L 3ZDWA 4G6KL 3V8CA 3ES6A 4LRNH 2EIDA 3VXRB 1XFPA 3GTMA 2R69L 2EDBA 3MU3A 5C07B 2NUTA 1PFOA 3S37L 2ATAA 4TNGA 3L5WA 1KXHA 3FB6B 4L1DA 3LPFA 5TFSH 1FORL 5HPMB 3KPSD 3VI3E 3VFMA 3MOQA 3MCG1 4G6FB 12E8H 2Q7NA 1G43A 1IEBA 3C5SB 3QNXA 4FQ2L 4L05A 4M6NL 5HYJB 4PJFF 2NY5C 4PRIA 2I5YH 3W57A 2C9UA 4ZX4A 3BAEH 2XQBL 3OJ2C 3BIBX 1SMAA 4XPGH 4OIIH 2QR0B 3AREB 4PS3A 3WFHA 5K1VA 3L5HA 4WI3A 4OSUL 3H7BB 2BM3A 2C9VA 3IBOA 4W9EC 3UO1L 3BD5A 4ANXA 5I1IL 1ACYL 1PX4A 3FK3A 2FK9A 1KPRB 2XT1B 4IU2B 3TLRA 2JIXA 5GM9A 1Y0LB 2GJJA 1FG9C 2CBQA 5JORB 1RZKL 2IADA 4ABQA 5EN3A 5GGRA 2BSED 5KANG 2WUCL 4AYDC 3U4EA 2XU9A 4LCUA 2WV3A 3TN0B 2QADB 3AREC 4JHUA 4RRPM 1I1YA 4C57C 5SX4H 4QF1A 3FB8B 2DQDH 4DGVL 4F24A 5FYKL 2VPYA 3NIDE 4TPRL 1I9IH 1PAZA 4KDLA 4XP9L 1TJHH 5FW8A 4AGOA 5JIPA 3OGCB 4OFYA 1T22B 3SJVD 3GS4A 2HJLA 1ZJBA 2CXKA 1QLEH 3X3GH 3ZKXB 3DXAA 4Z7OF 3P3RA 2P80D 4P5KA 3KLDA 2XN9D 1NBVH 1QSFA 4OJDH 3CJJA 3QCVL 3LKRB 5CJBA 4PJGE 2GTQA 4DCQA 3DHPA 4XAKE 1O9WA 4YR6A 2FO1A 1R5WA 4BFJA 3NIGF 5L7XL 3C8HA 2X41A 3LH2H 2VLRA 1NAMB 5JIHA 1A7BA 4G5ZL 2WGNB 1DEEB 1T21B 3BT2H 2Y72A 1JMZA 3ZKXC 3WFEH 1GYUA 2XYCA 4Z7VE 4WCYL 4H8PA 2GY7B 1AQMA 1PQEA 4JFDD 1IX2A 1CLYL 1MCJA 3KAAA 4JO2L 4S2SA 4I7ZC 2WXPA 5C09E 4RRPA 1WA2X 4JPQA 4GW4A 1D5RA 4ZNCD 3VXNB 4ENGA 4BZ1H 4Z3IA 1ODAA 2H0JA 4H13C 4TULH 3TEXA 2BFGA 4DUWA 3EOTL 4L5FE 3O2VL 4C83B 3FT9A 3KMDA 3QXAA 2ESVE 3EBGA 1VADB 4LBEB 1CFVH 4BSWB 2QQNL 4X83A 2F1AA 3CTTA 1FN4B 4PJ5D 1EH9A 4YN3A 1RZQA 2OSXA 1OCRB 2X9WA 1IZKA 2QVTA 4HFUH 1I1RA 2P5EA 5GGQH 3BH8A 3I6KA 2EECA 2Q76B 5JHDD 4BFOA 3F7VA 4UI2A 1UZ6F 3GSNB 4EE2A 1E4KA 4X4MA 4O2CA 3FCUB 2V33A 1MCRA 5TPWH 3RB5A 4JVUA 2I07B 1WZ1L 4OLVL 3IXTA 1AKJB 1VFAA 1XH0A 5FTMA 5IFHL 1DZ0A 1QYGL 1U3NA 4X6BA 2VZ3A 3V0VA 3QUZA 2XN0A 4ODHH 3MNWA 3NSYA 3RY4A 3KCPB 1L5GA 3UZQA 1A6UH 2ZKYA 1QTYT 5FYJH 4R90H 1J0KA 5ADOL 2Q3XA 1EQWA 4GUPB 4X7SL 2GUOA 1PY0A 3MGOA 4DFHA 2HFEA 4TUKH 2VLJD 5I1GH 4XXDB 4FI7A 2BIMA 1ZA6A 3ZYJA 5GS0L 2DAVA 5E70A 3WS6A 4OD2B 4M3JA 2H0FA 2VJ8A 2GJZB 2HH0H 1YYCA 2IGFH 4K94H 4FERA 1S9VA 3ALWA 1B3JA 2MOVA 4AEFA 1NGQL 4QHNA 1HKLL 3DUSB 1SEQL 4UTBH 4MCYB 1V05A 3CZNA 3IDYC 1MCFA 3SB3A 4HSQA 4ELMA 1JZ6A 2CGRL 3B43A 2X9ZA 2E27L 1BVLA 3M8OL 4MXVF 5EU5A 5F9JA 3AQDA 4P2RE 4LAQH 3MFFB 3FH5A 3G5YA 4W68A 3BQUB 4R2GD 3LKNA 1MG3C 1OPGL 2DYPB 4EI5B 3WIHA 4JM2D 1NBYA 1S7QB 4GPVA 4B9KC 1P53A 1RAMA 3LV3B 4GAYA 3LKQA 3SJVB 5CFHA 1ZLDA 1F3DJ 3P54A 1ZA3B 2V0AA 4ORZC 2YGPA 2X0WA 5FIEA 2XN9B 2H6UA 2DI8A 4GRMB 5E8DL 1RULH 3BQUC 5A2LH 1XR8A 4M5SA 1TJXA 2ZPKL 2AK4A 4EI5C 1ITCA 1TTCA 1I1AC 1FO0L 1S3RA 4ZFOB 1R24B 1ZKAA 3PGDB 3VCLB 4BUQA 2CM6A 4JO1H 4FCAA 1V10A 3C08H 1HKFA 4GXUN 2JI3A 5BZDA 5FF6B 4QRRD 3BVUA 5JUEL 3SBWA 4JFDB 1CE6A 2K7PA 4M03A 1KENL 1NGXA 3G7TA 1SNRA 4GSDL 3ZTDC 2WZ6A 2IAAC 5E8EB 3EJPA 1XDTT 1A1NA 2A6DB 4B97A 1MHCA 1JERA 2W92A 3MRQA 4PRPD 3MREB 3PE9A 5A16B 3UTQA 5ILTH 3IS1X 4U6YB 4X5RA 1UHEA 5D6CA 4PJDA 1BW4A 1I8IB 1AAJA 4Z7NE 1FCCA 1EHLL 5EC2B 3CIAA 2DQTL 1BQRA 2AGJH 3QIUB 4U4IA 1RJLB 4YE4H 3UZEC 1O9ZA 3DVIA 1KCVH 1IVLA 1XHHA 3L3IA 1QNIA 5B21A 4ODXB 5FA4A 4FQXB 2J72A 2WCGA 3L3KB 1HL8A 2KLTA 3GXFA 4JHZA 4Y1AD 5LN8A 1L7IL 3NABL 4Q74A 1F1DA 4XNMA 3S88H 5CO1A 2JE8A 3NZ8A 3QIUC 1FGVH 4MD0B 1T89A 2WXRA 3G9VA 1E30A 5I66B 1P84J 5FHBL 1YN7A 5J89A 1RVFH 4XN5A 4N2GA 1S5HB 4AENB 2V37A 4FQXC 1L7TL 1VFUA 1HHGA 4W1TA 2EIJB 3EF7A 5DUMH 3RP1A 1P4BH 1I75A 2WTRB 3LRKA 5HYQB 4KKCD 3C6SA 1X5LA 1SVCP 4G7YH 3GI9L 5E51A 4EQ2A 4YEFA 4PRHE 1QEWA 2NY2D 1NUGA 4XN9A 3AXIA 1BQKA 1FQ9C 1NCIA 3CPLB 4KVNL 4NQVA 3KWUA 1J0YA 2WZ0A 3KXFD 3REWA 3ZHFA 4D2NA 3RA7H 2Q3ZA 3CSYA 4XMPH 3WFDL 4IHOB 3FQRA 4QIRA 3C6LA 1NGPH 4C47A 4UYQA 3TBBA 3TNMB 1FL6B 3N5AA 1U8HB 3QG7L 4OCWL 4XMKH 5E8NB 4RETB 4URKA 1O6VA 4YSEA 2R83A 5J7CC 1PKOA 2RFXB 1RJYA 2FJGA 3HHMA 1JZEA 3ZO0A 1J05A 3ARGD 5AZEL 1DJGA 5CHNB 8CGTA 4H1LG 1FC1A 1KBGL 2Q87A 5KG9B 3AXHA 3TA3D 4YHPB 2ZWLT 1DUYA 4XNQB 3BP7B 3AGVA 3L1OL 4P4RB 2MNUA 3MXVL 4P5MB 5CZRA 2Y07H 4LQFH 1TETL 1A4KA 3EADA 5A2AA 4A6YH 4MLSA 4R2GB 3FO2B 1ZS8A 3PWLA 4FULA 5F7BA 4JM2B 3VI4B 4BCXA 3X14B 1ZTXE 4CSPA 2EO1A 3EKCA 3WMQA 4LLWB 5DK2A 3ZE2B 5CCKL 1KOAA 3QDGD 2B7DT 4GUOA 4AJVA 2HTLD 3ENGA 1OW0C 4E9WA 1IBGL 2NMSA 1AS8A 2ZSVB 5C9JB 4PJXE 2Z64C 5I2IA 3BKML 4YBLB 5I1EL 1B0GB 5JHLH 4KK6C 2VZOA 1HEZA 4X6CF 1PL3A 2BP3A 2BY0A 3KDMA 4RFOL 4ALAL 2C9QA 4FXGB 2NSMA 1AZUA 3FUJA 4I0PD 1QSZA 4N2EA 5HYSG 2XZCL 3MV9A 1UKTA 4YMPA 3ZMEA 1IEAA 2JIMA 4U1LA 4YBLC 3Q06A 2X44D 4PY8J 2AQPA 2DQFA 4NRXA 4W6XB 1XH2A 4F33A 5TE4L 3COOA 3R0MA 4XTRC 8PAZA 4PRPB 4AH2A 3GO1H 1SOSA 5CD3B 1EO7A 3CPUA 4FXGC 4A67A 5CINL 5B8CA 2XV6B 1E40A 3M88A 5F88B 4Z7WE 3JTSA 5LCVH 4OZFG 1IM9B 4L8SB 4P05A 1TVHA 1UADC 3OR6A 4Q6YA 2F74B 4Y16B 4DP4X 1MCLA 1OCWH 3RLSA 3NAAL 3KEDA 5GRJH 2X4QB 3B6SA 3BFWA 4Y5XA 1EVUA 4YBQD 5EU4B 5TDNA 2YPLA 3MTRA 1K8DB 3NH7H 4JQXC 4LASH 3L1EA 2CKBL 5E8OA 1U30A 1ZV9A 5DD1L 4IRJD 1OP3K 2K78A 4PIRF 5ID0B 4J8RA 4KZCA 4L8SC 3KVDD 3B7YA 3O6FB 1O7DC 4Y16C 5FEBA 4LRNL 1W0YT 1JZDC 1K2DA 3LEXB 3I3DA 1BJ1H 4XHQA 2WLJA 2DB8A 3QARA 1J5HA 1RI8A 4JHWH 3BZ5A 3RX9A 4POZD 2JI2A 4LKXB 3R7QA 4PWGA 5TFSL 1QO3A 3MRMA 5EU6A 3C60D 3DETD 3M17B 5L2KD 3O6FC 4XE0A 12E8L 3UTSE 1G6RH 1X7QA 2NY2B 1CGVA 1KXQA 4FOMA 1WZMA 3KXFB 4LHUD 2I5YL 5GRZA 3T6WA 3BAEL 1U93B 3QJHB 5B38A 3DVGA 3GNMH 3VSTA 4XPGL 4OIIL 4BRJA 5C97A 4BUGA 4AYSA 3K74B 2GEQA 3DVNA 5GXBB 5EEUA 2Z91A 4L4TD 1ZHKB 3ZZLA 4YUEH 5GZOA 4I85A 1ANUA 5JPNA 5T5FA 3ARGB 3U9WA 5DVOA 4AV5A 1BIIA 1E2ZA 4R4BA 2NDFA 2V17H 3TA3B 3MBEA 3ATAA 3O9WB 1AGCB 1H5BB 4L0YA 2DQDL 1MCIA 1I7TB 1W80A 1T1WA 3ET9F 3IDGA 3JUYA 4EVNA 2AZAA 1I9IL 2JMRA 1TJHL 4RISH 3ARGC 1VCAA 1YRKA 3BUYA 4QRUA 5E94A 3FT4B 3O4OB 4UT7H 4PI0A 4BKTC 3P9LB 1NEZB 3FTSA 2KLRA 1QLEL 3P4LA 3TA3C 3X3GL 2HG5A 3JV6A 3DX6A 2GB2A 3O9WC 3QDGB 4KC3B 2YPKA 2XVKA 4QIWA 1NBVL 2C1PB 2OJ1A 4ZMXA 5I5RA 1LE5A 1H5BC 1LNUA 3QQ7A 1FH5H 1HE8A 4H44C 4F2MA 3TJEH 3FO9A 1JS4A 2O72A 3QQ8A 1EK3A 3NJKA 2IG2H 1CFTA 1M1XB 2D2CC 4IKLA 4OZ4A 3LH2L 4BUHA 3PYCA 1X6LA 1UOWA 1C16A 1M7UA 2LU5A 2EVHA 2UX6A 4AZDA 2VWEC 3BT2L 3CX5K 4WW2F 5F7HA 3HG1B 4KMTH 3WFEL 1ACZA 3GSOA 1V55B 4P23B 2JFCA 1XGRA 3EYOB 3L7FA 1MHHB 2WWNA 3LSOA 4CKQA 4R7XA 3SKJH 4QOKE 4BZ1L 2I9TB 2WQ8A 1E27A 1CDGA 4TULL 4ZO8A 3VFGH 3GHEH 3X2MA 1MIMH 4QRQB 4AYMC 5H4UA 2E56A 1PG7X 3IJHA 4P23C 4UIMA 1CFVL 4LRIA 1JWSA 4QHLA 1IFHH 3AQYA 4YHYC 1BA9A 4TQHA 3CN0A 1FWXA 3TA4D 1D7DA 3ECBB 5GGQL 4HFUL 3V4VA 3ZRFC 2P8PA 2DQHH 3VSUA 4DMRA 4LDOB 1QA9B 1UACH 2CIKB 3BESR 1JZFA 1JN6A 2Z35B 1MCHA 1T4WA 2J8UB 3OLGA 3V4UH 3WE6B 1BQHB 2ALAA 1AGFB 1DVFD 4B0MM 4IRJB 1B88A 1AR2A 2XWJA 3EOBB 4X0KB 1AXTH 3VXMD 5TPWL 2XG5B 4ES8A 2X28A 1QLFB 2V3FA 1P1ZA 4XGZB 2E6JA 1L9PA 3CG8A 4PJFB 1U8CA 5LUMA 1ED3B 1HSAA 3HI5H 3VRIA 3DPBB 3P4MA 4LNVA 1NBQA 4UNUA 4Y8DC 3BXNA 4ODHL 2LFEA 4P46D 4F58H 2FEEI 4F1SA 1NBZA 4M7LH 5IP4A 2DQIH 1A6UL 1UXSA 5FYJL 4R90L 3ZDZE 2BP0A 4RAUA 4A2DA 5HBBA 3FULA 3RZCD 1AHWC 1DDHA 5C3TA 1A4CA 5I75B 3V6ZB 3K6OA 4TUKL 3HN8A 2Y5QA 5I1GL 3NESA 3QRGH 4JREB 5C0JA 2NW2B 5EO0B 4KDVA 3BQVA 4JFYA 4GAJH 4R4NC 1OB1A 3D39A 1B0IA 2VZTA 3HHSA 1NOAA 1TPXC 2HH0L 2IGFL 4K94L 3F01A 3ZW3A 2IANA 3DURB 4OQTA 3BPOB 4L4TB 2ADGB 2AERT 2Z92A 3O6MH 4UTBL 3D05A 5B7MA 4AQ8C 2FWLB 3HE6D 5IG7B 1G9HA 1SPDA 3A3YB 4JREC 2V9TA 5CJXC 3O3UN 1BQSA 5IUSA 5CZXD 4N8UA 3MRJA 4LAQL 4Z7QE 3BLBA 3MVSA 3BPOC 1ORSB 1E8YA 4NKOA 4UQ2A 5JW5A 3IXAA 3G6JE 4JKWA 3L5XH 1S78C 5M7QA 4GO6B 3R8BB 5GRUH 2QKSA 3GKWH 1OARH 3FTXA 2HMID 1I7RB 4ZAKA 3RWJB 2NAPA 4BK4A 3FH7A 2WBKA 3T04D 1I85A 3D4ZA 4H2AA 4XN8A 4I4WB 1RULL 4E9VA 4X6DA 3Q5YA 1QI4A 4Y5YA 4HETA 1BJ8A 3GMPB 1EEYA 4JGJA 4UM8B 3MJWA 2FHBA 1A8ZA 2NXYB 1J10A 4JO1L 2RD0A 3NPZB 2FVNA 3C08L 3F62A 3IKCA 3KPLB 4I2XA 3AXLA 4U05A 3X2OA 3V0JA 2EE6A 1WE5A 1FP5A 5ACZA 2AFNA 3CK0H 3NCYS 3ARDA 3BW9A 1SF3A 1G7JA 1UB5B 4GXUM 2VJ0A 3ULVE 1NTDA 1F1AA 3GUFA 3FUEA 2BOBB 2NXYC 5ILTL 4UZGA 3WGUB 5DEFB 3BWSA 2JWYA 3ARFB 4FABH 1DN2A 1EEUA 2H41A 2YEZA 3IGLA 3SO3B 1R75A 3VXTA 1X3DA 2PP9A 3VXSD 1TO5A 4DOHB 5EZPA 3CVIH 4DVBA 4P3DA 2YGVA 2AGJL 3WN5B 3GTJA 2R8SH 3TZVA 3IM1A 4YE4L 5MERB 4ZPTB 4XNZC 1KCVL 3H4HA 1WCQA 5C0BD 4XCFH 2CJUH 2HB0A 3ARFC 1I3RA 3L95B 3WIHH 4KXZH 3FQXA 4JE0A 3SO3C 2A74C 1OHZA 4DP2X 1T2JA 1MHEB 1XCQB 3S88L 4N6RB 5DRWB 4BSVA 3KJ6H 4U6HB 5LLIC 1FGVL 4GOSA 3I75A 5IQOA 1HZKA 4G59C 4M1GH 1NFDF 2OXHB 1LVEA 1DQMH 1RVFL 1WBYB 2NNFA 3IDMA 4ZOAA 4JGUA 1A22B 1FAKT 3BGAA 3Q48A 3FCSB 1TWGA 1JGDB 2FB4H 4MQXC 5DO2C 5IMOB 5E5UB 3PJSB 3GTTA 1MI5B 1ZT7B 2GI7A 5DUML 1F86A 1P4BL 3RGVB 4W9CC 4P46B 1M6UA 1N7MH 3X1BA 4WZ9A 5D7IF 4G7YL 4BWWA 3BZFA 3QXDA 5B3JE 1JK9A 1ZGLB 1B6UA 5CEXA 5E7BA 3U1QA 3HG5A 2HT2D 4XMPL 4XOAA 3QPQD 4NUGH 2ICWI 3RA7L 1EHKB 5B39B 4PJBA 1NGPL 2PW1B 4HBQA 1DSYA 2NNCA 1M9SA 3DYMA 4IW4C 1ZJAA 3RGVC 1JRHI 1UFUA 1XGTB 4XBEH 4XMKL 2HX8A 1B0RA 5F6HJ 1PG7H 3WLBA 4JDTH 4NUMA 2GT9B 4NQEA 4MJHA 4C8XA 1DJZA 2P1YA 4J3OH 3HE6B 3LNEA 4WW1B 1HQ4A 3V10A 2FSDA 2NTFA 2NR6D 3O8XD 4OTXH 1HXKA 4NM8H 1MLBB 3VA2C 4PJCB 1GIGH 1PD1A 2NUPB 4LCVA 2VUKA 5FYLD 4LLDB 2Y07L 4LQFL 1YUHA 4KJQC 3VFTB 1DQQA 3WSQH 4A6YL 1GW0A 5CSGA 5CBEA 1JFHA 1P2CB 1CD1B 5E1AA 3H9SA 1F3JA 2GTWB 4EMZA 3NZUA 3X1GA 2Z0UA 2XV3A 2ZNWA 5DMKA 1O9VA 4F80A 1XB6A 1AQHA 2WSDA 2YS4A 2AZUA 2X4TB 1I8KB 2UYLA 4L37A 3R06A 4NXSA 3VM5A 2KT6A 3P73A 4DP5X 1A9BA 5JHLL 1G9MC 1ES0B 2MJWA 4N8PA 4OZIB 2WWMD 3G5VB 1P0SE 1RZFH 2FWOB 4H8HA 4BQ9A 2HMIC 2C3VB 2Z34A 3S5ZA 2DY2A 1CYXA 2QV4A 2YGOA 1LO5A 4GBXD 1JVKA 3DX9B 1E3ZA 2JA7A 5T1KD 4TSCH 2ARJB 4TSBH 1MFEH 5IROD 2R1XB 1TSHA 5HHVH 4OD3H 3PQYE 4JJ5B 1ZHBA 1JUFB 2CBPA 3HUJE 3CUPB 4LXFA 4Q97A 3F2LA 3AROA 3RKPA 4UM9B 1UFGA 3HS0C 4U3XA 2Q2EB 3GO1L 3F12A 1PJ9A 2Z93A 2G5BB 5LCVL 1NDGA 4ENED 1DO5A 2GABA 2YUXA 5C0AD 4F93B 5J6HA 2XRAH 3PL6D 5E6IA 1OCWL 4PS8A 2VABA 3BJ91 5LGJA 3RUGE 2WLNA 5GRJL 1DQLH 3QO1A 1ASPA 4PQXA 2YAHA 1Q90A 4BKSC 3NH7L 4LASL 5LHDA 4LZKA 3LEVH 3K6SB 2BS9A 4JDZB 2EIEA 4RNRB 5C0CD 5KJ7E 5KSBE 4PFEA 3S5LB 1KN4H 1UASA 5A6LA 3WXWH 3ROLB 4TL4A 4JDVB 2GSGA 4HLZH 3P11H 3GRBA 5HYEA 1C8QA 4LB8A 3NA4A 4IHBA 4J3WA 4X4YA 1EERB 1OHQA 1M9WA 3WD5H 2PTVA 4JHWL 4ORGA 3FS9A 2J56A 4ZG1A 4GUCA 3LXAA 4NQCB 5SWZB 4MRCA 2YKLH 1CDJA 1XF3A 5I1LB 3QXVA 3ULSA 3FTZA 1G6RL 2FQGA 3OQRA 4AYFB 4MMYB 5DRZB 1JZIA 3U2SB 4Y7OC 3T3ME 4K3HA 3GNML 3CZSA 4FFWC 4LEOA 4JBSA 1RHHB 3HC0A 3ISRA 3M7FB 1D5MB 3QHTC 4KI5E 2Y7QA 4A39A 4F5CA 1IQWH 4LLVB 4AQ1C 1BEYH 2HFGH 1KLUB 4YUEL 4FMVA 5T1MA 5ICYA 1ULVA 4K07A 5C0DB 4EN3A 5IIEA 2AXHA 1FFOA 1M71B 2ZUQB 3VSVA 3ZZQA 1LEIA 3O81A 4W9LC 4JFFE 1XF1A 3QPQC 2F54E 1NEZG 3AS0A 4JFTA 5DO8A 2V17L 3WV0A 3ZL4H 2Z8RA 3LPOA 3P9MB 1PZ3A 4PGEA 5C0RH 3O8XB 2K6YA 1JI1A 3AS3A 1M3IA 1W72H 4WFGE 1XZ0A 1GJUA 3MUZ1 5FTNA 5AYQA 4RISL 3SYAA 2ZUQC 3RVWC 3LVTA 2B59A 4UT7L 1BLNB 3EXJA 5C0NC 3KE0A 1N0XH 1S7SB 3O6KH 2CRIA 4RWHA 5DD6A 3EGSA 3EW3B 3EYUH 3SDCA 1FH5L 4TYUA 5IQ9B 1UM4H 5EZOH 4MMXA 4I87A 3PUCA 4PJ7F 4X9IA 3TJEL 4CAGA 1HI6A 1J8SA 3GMRB 2IG2L 4NGHH 4FCHA 1NLBH 3BE1H 5EMYA 2BP8B 2VR4A 3IGKA 2PN5A 3GIVA 5J1AB 4KMTL 4ONOA 4GBXB 3K2MC 4MA3B 3A47A 2IWEA 4PY7A 2H0PA 3W0WA 1R5IB 5T1KB 1CFSB 2EYTB 1GGCH 4WDIB 1LO0H 2HLAA 5GZNA 3RHWK 5DQ9A 1FV1B 4WSGA 2A6IB 1LYQA 2DEYX 5GSVB 1D3CA 4HH9B 1FAIH 1KFAH 2CIIA 4RLDA 3SKJL 5KVFE 4LSSH 3EJQA 4L8DA 1A7NH 2VR5A 4OGXH 5T5FH 3KYOB 3VFGL 3GHEL 1MIML 1HN1A 3GDCA 2JK5A 2N59A 1JPEA 3UTTE 4X6EB 1JWMA 4UUJA 1JZHA 7FABH 5IHZB 2V2TB 4P2CG 1IFHL 2PJHB 3QUYD 3EDJA 5C0AB 1FL3B 5IROC 3E8UH 5C8JA 1S7XA 3B2VH 3BLKA 3ECWA 2WLLA 5CU9A 4DGYH 2R92A 4MJ5A 1PYWA 3IBEA 4NPJA 2DQHL 1L9MA 1UACL 3GI8H 3V4UL 3X12A 5EDSA 2X38A 4I48A 4J4PC 4KH9A 3U9UA 2VC2H 1AZNA 5I8CA 5C0CB 3MC0A 1K5NA 1DR9A 1AXTL 2PO6B 1GKOA 3FSZA 5DXWA 4F92B 4OUUA 2VR3A 4N87A 4O58H 2TRYA 4PTUA 4RGNE 5BV7B 4HCIA 4HS6A 3N42F 3HI5L 4YFEA 5LG1A 4UV4H 3KW8A 2FSEA 2UY6A 3OHXB 3TT3H 3IN0A 5BUAA 2HUHA 5FGBC 3Q05A 4F58L 1R7RA 4M7LL 4EIUA 5EWIH 2PWHA 2DQIL 4KMQA 1IB5A 2X2HA 1N70A 2PO6C 2ROXA 4L3ED 1SLXA 3CXDH 3FU5A 1FYHB 2J25A 3VFPB 5BV7C 3CVDA 2JXMB 5C7ZA 5MEQA 3FO1A 1HHJB 4G8IA 4XBGA 4BH7B 3QRGL 1MSPA 5IUCA 1G7QB 1OO2A 2HCZX 4GAJL 4OFKA 1MCOH 2ICES 4CN4A 4DHLA 1J9QA 3OG4B 2OYLA 2QKIC 4JHAH 3POHA 4TQIA 4XMXA 4AIZA 4WO4A 2X2YA 3O6ML 1Q16A 3HZYB 1FFTB 5DMYA 3CZFA 4ADGA 4HZLB 5FW7A 4N28A 4G8AC 5DHVA 2O61A 4JG0H 1YPZF 5I1HH 4Y5VB 1A6ZA 4BK8A 2CNYA 5CP7B 3V4VH 4MBOA 5D1XE 1GSKA 4LLMB 4JDEB 3MUGB 3C09B 5DVKA 3MRPA 4U7SA 5MHSD 1IL1B 5SWSD 1P5UA 3HAEB 3L5XL 4OH2A 1JK8B 5GRUL 3WDHA 1GA2A 3GKWL 2GW5A 1YLEA 1OARL 4W9HC 4WHDA 4WW2B 4GP4B 2UUDH 5FYKD 3VWKD 1WLHA 3U36A 1FVEA 4JAMA 4Y5VC 3RVTC 5I82A 4FQQA 4LL4A 5DGRA 4K3JH 2JB6A 3RWHB 1JTTA 2OS7A 2P45B 3FN3A 1SM3H 3LRHA 3HG3A 3EYFA 1OTSC 5EO1B 3BAXA 3RYMA 1I8MA 2OLDA 3ARQA 1U8JA 5FFOA 1S7UB 3TO4A 1HIMH 2JKNA 3FW6A 4FXKA 2BNQA 1FFNA 4WW2C 1MAMH 2VDOH 2Z9TA 2CNZA 2MNWA 3GZOA 4BGLA 4RIRB 5LDSA 1CI5A 4DK6A 2LTQC 4EBQH 5FO8A 3FQWB 3ARZA 3MLXH 4NIYE 3CK0L 4N0FB 3KYKH 1AYOA 2CDGB 4R96B 1SHMA 2YQBA 3PXLA 4G8GE 4M7JH 2JKWA 5E0QA 3NP4A 1EXGA 2V9RA 2YK1H 2PPDA 3OJDB 4QLRA 5MEOA 1UJ3C 4LPCA 4OQTH 5HDBE 5DEGA 2WANA 1OY3B 1UD8A 2QQKH 3OX8A 1BW8A 4FABL 4HIIA 3VTTA 2EYSB 3ISWA 3L4UA 1QW8A 3JV0A 4RMWA 3CVIL 3FOMA 3DMMC 1AMXA 4LL1A 3ECVA 5DHYA 4H1LA 3SGKC 2R8SL 4HWZB 3RIKA 3G6AB 3MNDA 1IAOB 3NFPA 4XCFL 4LCWA 3R19A 2CJUL 4F8NA 1BG1A 1K3IA 4WUUA 3WIHL 3LQMA 1TWCA 2KPWA 5CR1A 2J2ZB 2D3NA 2PCYA 1IIIA 2Z1KA 5DJDA 4P8QA 3K8LA 3CXHJ 2C9PA 3KJ6L 1FZJB 3TO2B 2CWRA 3W56A 4M1GL 4JRYE 1DQML 4K7PY 3WTVA 4MWFA 3I3EA 5B39G 1G7PB 2FB4L 1KJ2B 1EBPA 3QJVB 3OKOB 4OLUH 1T3FB 2MPVA 4ODWB 4ZMWA 4XC3H 1E5BA 1QFWI 1N7ML 5E08H 1HL5A 3DI2B 2IH1B 2X9YA 2OKMA 3DDFA 4L3EB 2VSCA 2X2JA 2AXGA 4F7CA 3VFNA 4N8CH 3WNKA 1G9NH