1H0HA

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 369
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
369
sequence length
977
structure length
977
Chain Sequence
ATMALKTVDAKQTTSVCCYCSVGCGLIVHTDKKTNRAINVEGDPDHPINEGSLCAKGASTWQLAENERRPANPLYRAPGSDQWEEKSWDWMLDTIAERVAKTREATFVTKNAKGQVVNRCDGIASVGSAAMDNEECWIYQAWLRSLGLFYIEHQARIUHSATVAALAESYGRGAMTNHWIDLKNSDVILMMGSNPAENHPISFKWVMRAKDKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIAFLNGMTKYILEKELYFKDYVVNYTNASFIVGEGFAFEEGLFAGYNKETRKYDKSKWGFERDENGNPKRDETLKHPRCVFQIMKKHYERYDLDKISAICGTPKELILKVYDAYCATGKPDKAGTIMYAMGWTQHTVGVQNIRAMSINQLLLGNIGVAGGGVNALRGEANVQGSTDHGLLMHIYPGYLGTARASIPTYEEYTKKFTPVSKDPQSANWWSNFPKYSASYIKSMWPDADLNEAYGYLPKGEDGKDYSWLTLFDDMFQGKIKGFFAWGQNPACSGANSNKTREALTKLDWMVNVNIFDNETGSFWRGPDMDPKKIKTEVFFLPCAVAIEKEGSISNSGRWMQWRYVGPEPRKNAIPDGDLIVELAKRVQKLLAKTPGKLAAPVTKLKTDYWVNDHGHFDPHKIAKLINGFALKDFKVGDVEYKAGQQIATFGHLQADGSTTSGCWIYTGSYTEKGNMAARRDKTQTDMQAKIGLYPGWTWAWPVNRRIIYNRASVDLNGKPYAPEKAVVEWNAAEKKWVGDVPDGPWPPQADKEKGKRAFIMKPEGYAYLYGPGREDGPLPEYYEPMECPVIEHPFSKTLHNPTALHFATEEKAVCDPRYPFICSTYRVTEHWQTGLMTRNTPWLLEAEPQMFCEMSEELATLRGIKNGDKVILESVRGKLWAKAIITKRIKPFAIQGQQVHMVGIPWHYGWSFPKNGGDAANILTPSVGNPNTGIPETKAFMVNVTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
total genus 369
structure length 977
sequence length 977
chains with identical sequence K
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1h0hA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h0hA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1h0hA03
5B6CA 1E61A 3CF2A 1E32A 4KODA 1PYQA 3HKZA 2NVYA 5FTKA 1I50A 3GTJA 1SIWA 1S3SA 5C1BA 3HU1A 1CZ4A 5T5ID 5EPPA 3GTMA 4C2MA 2C45A 1KQGA 5FTJA 3O5AA 2IVFA 1E5VA 2DMRA 3HU3A 2JIRA 3GTPA 1DMRA 4AYBA 2JIPA 1H0HA 5DYIA 4AAYA 2JA5A 3HU2A 1K83A 1IW7D 1R7RA 2E2HA 1TMOA 1UHEA 1OGYA 4CS0A 1AW8B 4AOKB 4GA5A 4DMRA 1PT1A 3GTOA 1CZ5A 1Y1VA 4D7ZB 3DMRA 3TIWA 2E2IA 1UHDA 4KO8A 2WB1A 2JIQA 1VC3B 1Y1WA 2NAPA 3QC8A 1TWFA 2VPZA 3H0GA 1PYUB 1SFOA 5FTNA 1E60A 2EEOB 3GTKA 2JA6A 1KQFA 3QWZA 2E7ZA 4GA6A 1WCMA 4AONB 5T5MD 1TWAA 2JIMA 2PJHB 1G8JA 3QQ8A 2PMZA 1Y5IA 2R93A 1QCSA 3CQZA 3TM7B 5FTMA 3GTGA 5DYGA 2JIOA 2NYAA 3ML1A 3IR6A 1YLEA 1PT0A 1WLFA 5GLFA 2VUMA 2V3VA 3GTLA 4CRZA 1Q16A 2Y0SA 1R9TA 1DMSA 4KLNA 4RV0A 3IR7A 2VPWA 3PLXB 1I3QA 1PQHA 2VPXA 1R27A 2IV2X 1PQEA 2R92A 1TWCA 1FDIA 2JA7A 1CR5A 3IR5A 4KDIA 4KDLA 1E18A 2WAQA 4AZDA 3OUGA 5C18A 1Y4ZA 1QDNA 4QIWA 1FDOA 1TWGA 1AA6A 1PPYA 2KI8A 2R7ZA 1PQFA 3FKIA 1G8KA 3QQ7A 1TWHA 2B63A 4CRYG 2V45A 2YU9A 1EU1A 3GTQA 2VPYA 1H5NA 5FTLA 2NVXA
chains in the Genus database with same CATH superfamily
3H4VA 2XD9A 3TLBA 2RK4A 3A7DA 2E37A 3K0FA 3AVUA 1UMDB 1SQ0A 1I3CA 1F7VA 3ELWA 3R5KA 5HQJA 1MX3A 2G9QA 4HNUA 1PYQA 2UUBB 1G3QA 1DRVA 1ZJYA 4EMUA 1BNCA 4CEHA 1LBHA 4YY3B 1ATIA 3DF7A 3ILSA 4XJSA 2FI1A 2LD4A 3IQZA 3WIUA 4W5HA 1VSUA 2C7QA 3TIVA 3X1MA 1GPNA 3BM5A 4JVLA 3UH1A 2CLHB 3V9PA 5IF9A 3F9IA 3SQDA 2PBFA 1PZFA 3AIMA 2WAMA 1AK1A 3EUAA 2RK6A 1A8HA 3SIWA 4A1FA 1DVRA 4C2BA 5F1PA 4ETMA 5FHRA 5BYBA 2J5QA 5AW3A 4CIYA 4N3GA 5I7VA 1XMXA 3VHRA 4ENPA 4IUYA 3I05A 3R7NA 1Z5OA 3HKCA 2Z08A 4NCXA 1F7UA 3ETHA 3H1BA 3IDSA 3NV7A 1WCWA 2P6UA 2ZTHA 2C1XA 4MAMA 2MYNA 5A4MS 3DOEA 3EQ7A 1Z4PX 2RH4A 4K6CA 1QCYA 3R3SA 3PF9A 3A05A 4FZ3A 4QULA 3ZLBA 1NJ5A 5KYXB 3QY0A 2C0PA 1WUTA 1M34E 2D6FA 1KQ3A 1T29A 2G4CA 2GK6A 1C0LA 1IY9A 2IJGX 4PBRA 4BNLA 4GRAA 5JNSA 3IP3A 3K96A 1UBUS 4NLLA 3S3TA 3CX3A 5G0SA 1Z39A 3N6RA 5CBPA 3C3CA 3K9HA 1OJLA 1F9AA 2XMSA 3EDYA 2Z2XA 1D0VA 2K2WA 3L7BA 2G0NA 1ISSA 1O87A 2L0XA 3NOXA 4Y2TA 4AKSA 5DHTA 1R6UA 2Q4BA 4RJLA 3CZAA 4F91B 2CJYA 1KZGB 5JZSA 2V7QA 1PS8A 3FHJA 4IDPA 4V0MA 3ZE7A 3M6MD 4P5EA 1WLYA 1LI5A 2UKDA 3EFOA 4N7MA 3TSYA 4ENSA 3KPJA 4ZO8A 1EA7A 3IELA 4HB4A 4TGLA 1NATA 4Q4CA 3QE2A 1QRUA 4LZAA 3LAWA 4NVRA 4UULA 4YHBA 1BDBA 5JXWA 5DYGA 5FI0B 1NZDA 2EGUA 4Y1RB 1NBHA 4YP6A 4YJ2A 2BFEB 2VNSA 4OCZA 2HRDA 4BMDA 1NC1A 2F8MA 4M98A 3R7LA 4D3SA 2Y1XA 2FWIA 3OZDA 4Q7LA 1UFVA 5BN1A 1VMAA 3JYOA 4CM9A 4Y6QA 2QB5A 3RM3A 1K1EA 3FNEA 5KQGA 3LKVA 3DE6X 2ZM5A 4F3CA 1KE2A 2VPWA 1IBCA 1DCKA 1MB9A 5TMEA 4XSGA 3PHJA 1I7PA 1FQOA 4FE4A 3LO5A 1N0IA 3IULA 2QL7A 2UZ1B 1UPFA 1QSGA 2Y1GA 4ZAVA 1F5NA 4MJ3A 2C3OA 4EY6A 1SOUA 2XGGA 4IO1A 5GJWC 5I9MA 3GLGA 1OLUA 1DFGA 3PQ7A 5HUQA 2FPIB 4AFNA 2P2SA 2H1VA 4MR8A 4HH0A 1AGYA 4DG9A 2RHJA 5G0TA 4R8RA 1CY1A 3KQPA 2R4UA 2WZBA 4P98A 2HDOA 4AVYA 5A5VA 3DGFC 3CUWA 5FUVA 1U98A 2REQB 3GCXA 4QYXA 3GIDA 2VDMB 2JZCA 1R6AA 4OX9Y 3HXPA 2OGSA 1HYEA 4DJ5X 1NUSA 3TZKA 3DTVD 3UTCA 1KOLA 3JQ8A 2B4TO 4BP9A 2PGJA 4MUNA 1WZEA 3FVQA 4LJ4A 3UWDA 1UAAA 5J2UF 2IS1A 2Q9AA 1PL6A 2D54A 2PEZA 4CMCA 3MPUA 1GWNA 1Y48E 1Y7TA 4KIWA 1S8AA 1A8SA 1O08A 5C8YA 3LSTA 5K4AA 4C78A 3BZBA 1X8XA 2PZBA 3F98A 1SKYB 1IY8A 2Q6LA 5KB3A 1T5HX 2A9RA 1V4BA 4OLJA 4J94A 4B6QA 3LHSA 2CXQA 1KYIA 3ZGVA 3GLRA 3NOQA 3LOUA 3IUEA 2HJ9A 3SUKA 4R81A 1KAQA 1SVWA 3TX2A 3WMRA 3HSSA 3ZNPA 5HRAA 1RPJA 1KH3A 3DMHA 4HQLA 1R88A 4CLEA 1OA9A 1SVLA 4X1OA 1XL0A 1UIRA 4AYBA 3AZQA 2FPPB 3VNSA 3G49A 4JJZA 1CEXA 3JQBA 5SICE 3ER8A 2HMYB 1PSDA 2VJBA 3ZWMA 4RX1A 4GUDA 3I6QA 1QAQA 2BZ0A 3ESZA 1T10A 1AF4A 2WG0A 5F35A 4OK5A 5YASA 2WFLB 2HSJA 4N54A 1R6DA 3S70A 1TUEA 4ZYYA 5K3OA 2F8TA 1OT5A 3M34A 4V39A 3DBRA 4LKRA 3WMFA 3SXJA 1P0IA 2DRIA 2IYQA 2OZVA 3C3KA 1OGJA 2QG4A 2BMFA 4L2IA 3ANTA 1XFDA 1NQ5A 3P0JA 2UUPA 1U9IA 2XITA 2RI6A 2WB4A 1LW6E 1WMFA 3RYTC 4XCQA 1WPRA 1ZM2A 3A1VA 2GT1A 4PQRA 4UBNA 3WBBA 3EE6A 2ILVA 4M1TA 1YACA 2GEBA 3T7JA 1FFXA 2VYQA 1CIPA 1U0TA 2XVMA 4AROA 1QRTA 2JJQA 2WNHA 1MIOB 1Q83A 2C20A 3DL7A 2AFRA 1U8FO 4ILEA 1I32A 2OYCA 4ZEMA 1G20B 4BLQA 3WXBA 3DHWC 3GN2A 2REOA 2CHEA 1LA2A 4GBMA 1SH7A 1N3YA 4YP1A 1KPIA 3DXXA 4IEIA 8GPBA 1GGJA 1KDZA 1XWIA 1FNDA 5CFNA 1P6XA 5F9HA 3F47A 5K0SA 1W2HA 4OO3A 4IIJF 2ZJ8A 5G1OA 3UMMA 1TTTA 2XQJA 2LVBA 3H1AA 4V1CI 2YH2A 2TMKA 4TS4A 5D5PA 4A5SA 4BMSA 5HJEA 1E2NA 1QZ3A 4BRZA 1DS6A 1DELA 2NZYA 1EFRA 5EZYF 3GU3A 4NBLA 1GTRA 3MBOA 5HMMA 1USUA 4G56A 1SC1A 3PG5A 4RVFA 3RKRA 1ZYRD 2X23A 2PCJA 3GFTA 3UMJA 3PA8A 3AUAA 2PR7A 4L4SA 3TQHA 9LDBA 1PQEA 2R92A 3EUFA 3KR2A 2ZWAA 2VI5A 1EEXB 1T1JA 2G1JA 4QPJC 1WCXA 1CULC 3BREA 1SBIA 2B78A 4ESOA 5KOJA 3AVPA 4MWDA 1E9FA 2BF7A 2OCYC 2WOOA 3VVLA 3I8OA 2PUVA 3TNFA 3HGTA 4CDRA 1YRYE 3RYFB 1JE1A 2HMSA 1PT8A 4DLBA 1JKJB 1WDTA 2ETXA 3SYNA 1WZIA 2IUTA 2C96A 4IJ5A 3KQLA 4QUGA 5EMHA 1YZUA 4JJOA 1V1MA 5LWHA 3EZNA 3CB4A 1R8YA 3V55A 1KK1A 1V2HE 5A71A 3UJ7A 4BMZA 1J1ZA 1NASA 4JEHA 1T6ZA 3D3WA 5TVKA 4ZCIA 5K0LA 5K3FA 4YDHB 1DPFA 4BJ5A 3KUKA 4ZAYA 3DLCA 1KSJA 4RFSB 5LJLA 3TRJA 4EUEA 2EF0A 3C39A 3O4HA 5JCJD 3PEYA 3EUEA 3O84A 1DC4A 3FHLA 4PHGA 4ZI7A 3M5DA 4RF2A 1L5OA 1TLLA 1IUOA 3DKVA 3E7FA 2I65A 4U2DA 1XALA 2OTCA 3IAUA 3L7IA 1GRCA 4PZLA 1U0EA 4O0MA 2O2XA 2DXIA 3PLNA 5T67A 2Q49A 1L1FA 1EZZA 1J97A 3OFSA 5KINB 1XCMA 2Q6TA 3K0HA 4N3NA 5FPPA 4NWIA 2BISA 1THMA 4CL0A 3G2HA 3U4QB 2Q4DA 3QW4B 4G0XA 1RQ2A 3O1HB 3TL6A 1X8KA 4C0XA 3OTIA 4KPGA 3PEVA 1L1QA 1NVVR 5FUMA 2OBLA 3G5MA 2VBIA 2P0EA 2XVXA 4I14A 5E95A 4ZCQA 3FSGD 1GKKA 1X9GA 2AFHA 2D3TA 2IPXA 1IVSA 4H2DA 4E09A 1ZI9A 2V03A 3EZXA 4Q4JA 3NTUA 3K9WA 1CRQA 4IH9A 4JI3B 3M83A 3A0UA 4E3WA 3OZRA 1NZJA 2HXSA 2VJMA 3PUWA 5FAXA 3VR6H 4M60A 4X44A 1WMDA 4MGIR 1DDOA 2XE6A 1PR4A 4AMGA 4AJEA 3WWPA 1FUYB 5K20A 2XA9A 4LXQA 3ZCRA 2ZRAA 2PXXA 1SXJA 1SKUA 1YVEI 2E48A 5E4YA 3W9UA 1K2WA 3GJRA 3QUTA 2GESA 4HMPA 4G2NA 2XYVA 3WLNA 1P9NA 4EY8A 1KEWA 2JCXA 3DDOA 4HH3C 3CEHA 3WE7A 1QPGA 3LG2A 3JQFA 1JIIA 1HG1A 4W7HA 4X3PA 3RIYA 1X7ZB 5HX7A 1DG9A 3L8CA 4NULA 1RIFA 3UHOA 4R05A 2VRCA 1WCIB 2MWMA 4XDZA 1X74A 2EKZA 4J2HA 3OQHA 1YZKA 1Z2PX 1DO0A 2XAAA 1GOTA 5CLHA 1EJ2A 2VR1A 3CRZA 4Y2QA 3RS3A 3ZHYA 2Q5IA 4ZCPA 4X54A 4ZJUA 3FOEC 1PZXA 3AWIA 5DTRA 5FB3A 5ICCA 3TAHA 4LGMA 1HQCA 2OV3A 3IBTA 3HHEA 3M1IA 2Y0SA 1NDHA 4OB6A 2WJJA 4MRMA 2ZTVA 4OQEA 5CGZA 8MHTA 221PA 1GPWB 2JL1A 5B3LA 3K0SA 3E7PA 4YHHB 1JFFB 3DNFA 1UPTA 3IP6A 5A3JA 3I5YA 1IBSA 2ACKA 1FYDA 2Z3ZA 1YMUA 3VR4D 2GHQA 3L8FA 2D1TA 4K3UA 2YBDA 4MVJM 5DEIA 4UNNA 4JI6B 1FYXA 4H60A 3BK2A 4C7KA 3HNPA 3HZOA 4QIHA 4CR8A 4GHWA 2VJCA 1AA6A 1ORHA 3D6UA 1KI9A 2YNMC 4YJKA 3RARA 1MZVA 1ZKDA 2IE0A 3F3SA 2A5LA 3AWDA 4ER0A 2IWRA 1E79A 2WWIA 4Q9AA 3FTCA 3KAQA 3WMWA 2O3JA 3OCZA 4BFUA 5KSZA 2NVWA 3ZV6A 4HDCA 1EWKA 3W5BA 2WP8J 2C58A 1ZCJA 4KQ1A 2PJDA 4N3AA 3FPSA 1XA4A 1G5QA 3IX7A 1NXQA 4ZMBA 5DOVA 3WK8A 1VLJA 3T7SA 4KHZA 3H2GA 3CPSA 1T2UA 2O3SA 2A9QA 2LBPA 2V4ZA 4AJ1A 3SXUA 3IP5A 3L84A 2O2SA 2C88A 3TSAA 1L1EA 2ZP1A 1YC2A 2CW5A 1DQSA 3NWJA 4RQTA 3GP8A 3CO5A 1H42A 2BOVA 3PFHA 4Q7JB 4DYDA 3T1OA 2HA2A 1HQKA 3CZCA 4N03A 4QVIA 2GRUA 1VYUA 3JPYA 5IJXA 1V16B 2FHPA 2FHSA 3Q5EA 4JLMA 4B3FX 1AG9A 2EW8A 4RPIA 2I4IA 2C57A 2Q5JA 4PAGA 4EG5A 1Y6FA 3L1IA 3RJMA 4JXJA 1WBBA 1T8PA 4BTVA 1W87A 4N47A 3HYLA 3HU2A 3CYFA 3RS5A 1OGYA 4B0PA 2F6RA 2BGGA 3LS2A 1XWWA 1XZBA 4PQGA 4QXOA 1Y81A 3K2QA 1GZ7A 2QYSA 4RV4A 3O03A 4BX3A 5EUMA 3QVLA 3KKPA 2H51A 4KP7A 4O2RA 4EUNA 4HDQB 5FJIA 3GJTA 1KFCB 3LPAA 4HZIA 4L95C 2XBUA 4IYJA 5EA2A 5ALLA 4DLWA 2QPTA 3S5JA 4AWXA 5BUZA 2EBFX 2SKDA 1BCSA 1N2OA 4UD6A 3H0GA 2CFTA 1II0A 2AGVA 4J6FA 1DOZA 3KLPX 4QICA 4L75A 4M7PA 2HL6A 2FUNB 3ENWA 4EOGA 1P19A 1JXQA 1WU8A 3BTVA 3QWHA 2Q0SA 4RIEA 1D9XA 1BG6A 3PL5A 3TI7A 3V2HA 4KL8S 4R2LA 1MN6A 4PXYA 3OIWA 3Q9LA 3G3EA 1A71A 1MAHA 2XECA 3HPRA 4X1YB 4ZEVA 1FP4B 3UG6A 1YZGA 1FSPA 4HPWA 2JAQA 1B42A 4CKZA 4F3KA 3EIUA 4B34A 3M3GA 4R84A 3WBJA 4DXDA 2ZQZA 3ILYA 4QPZA 4CM4B 2O3TA 3LCRA 3BHNA 3O82A 4DJTA 3MMXA 4ZYZA 1N9GA 2JJ2D 1EGAA 5LP6F 4IOLA 2WJVA 5LR6A 2QVLA 1KE1A 4RJTA 2F00A 5ARCA 1K75A 3JQBC 5JJCA 1AM4D 1XHFA 4LJ5A 1HGXA 2YRFA 2XNDD 4UAJA 2ZBQA 3ZDFA 3O7MA 2QKYA 3WL4A 1QX3A 3ZY2A 4B4KA 3EVZA 5F1KA 2WMNB 3K0AB 3E82A 4Z8XA 2HQ1A 2O5JD 3T4UA 4CN9A 3OEHA 3DT8A 1UJBA 3OPQA 3A6EA 5FA8A 3MHPA 4RZSA 5EJ5A 1KO1A 3Q85A 2WJPA 5DNEA 3ZE0B 4U02A 1Z07A 2IUFA 2OFPA 1GPBA 4GD3Q 3FYTA 4UVHA 2PFKA 1Q21A 1KH2A 1S2DA 3ESDA 3KQSA 3ZY5A 4OQQA 3MJVA 2IOHA 4ROTA 5A4FS 2H59A 2YW9A 3E0QA 3EA0A 4UZSA 3FNBA 1EM8A 5HKBA 2RH9B 2IH5A 2HGZA 1YFLA 3H5NA 1L1RA 4WACA 3QF4B 1KARA 2OYSA 4MQEB 4QVKA 4UFOA 3L1JA 2A5DA 5IM5A 7GPBA 3EQ8A 3SOPA 5J2UA 1WP4A 1I1QB 2QQ0A 3I2FA 4RVUA 2DOKA 3SYMA 2WG1A 5JFGA 1TLTA 2MR6A 3Q5DA 3QHQA 1H0RA 1LVHA 2VZ0A 4RSRA 4C08A 4MGKR 5CVTA 1KKLA 3KSZO 3AR2A 1E2PA 1MVLA 3I8XA 1C0EA 3DBLA 1SIBE 2J87A 2Y6UA 1I4EB 3Q6NA 1XXHB 3HKZA 5DULA 5E6UB 3PIDA 4ZP1A 1LEHA 1ATZA 1RM0A 3SWWA 4GAEA 4HAVA 2O2JA 4RABA 1Y3HA 1D1QA 2JGEA 4H77A 4EHKA 3QYAA 1DBIA 1VB5A 1E1CA 1XQ1A 4W8OA 3RVSA 3ADPA 3GLIA 3SYRA 2PRJA 3HKDA 1P1BA 1R4AA 2V65A 3SHWA 4CKEA 2EW2A 4IINA 5HRCA 4BMNA 3A6GA 3KPYA 3UGTA 1OWLA 1KQGA 1IOWA 4QGAA 2R8ZA 1NUAA 3I37X 4MW7A 5DSZA 1G21A 1K6EA 3OY2A 3LI2A 5AM5A 5F1OA 4BN0A 4YIHA 1CRZA 3UPUA 1L7DA 1OASA 3EIOA 1IEQA 4RZQA 3UK1A 2CJWA 1QBKC 2NT3A 2PVSA 4LS3A 1I0LA 1DNPA 4M9SA 2CKDA 3RWOA 3V4SA 2Z43A 3G0GA 4ZT2A 1TKAA 1X7XA 2O1EA 1VSTA 3HYNA 5JPDA 1SCQA 2FV8A 2G3YA 4HTFA 4PFQA 4X85A 4MRMB 1WG8A 1T9AA 3PFKA 1DO2A 1OC2A 3NBAA 3E6AA 3OFNA 3HKBA 4GR5A 4XFJA 1EFHA 5IBPA 1KIFA 4YRGA 1IM2A 2Y05A 1DU4A 3CMCO 1ZISA 3WGOA 4BDTA 4E94A 1U2GC 4WL0A 1RCTE 3B38A 3NP7A 3HMQA 1JSRA 2FEMA 4MCJA 3ZNNA 1PYUB 3FUCA 4L4YA 3RHSA 2BCJQ 3R6DA 4Y6OA 2GN0A 5JJKA 2F3QA 5LQJA 1OX5A 4LOHA 3HVRA 4EK9A 3MNFA 4CGZA 4U9IS 5SY9A 3DLBA 4KIJA 3WYCA 2GHIA 3GPDG 2QD1A 3AO0B 3B3QA 4KWTA 1XZGA 1YS6A 5HKLA 3ZW7A 3VU9B 2VPQA 5CW2A 1XZCA 2WFMA 1E6CA 1Q1BA 4KNWA 1N3IA 1J2JA 3OLYA 3K7EA 4WZAE 2HMWA 1XVAA 3KWFA 1Z0IA 5E7JA 5D00A 2FVXA 3TH5A 4JYZA 4MRSA 5LQMA 2PT5A 3LLUA 1OX4A 1PZGA 4FSXA 4RMJA 1GG8A 2B4RO 1JR4A 3LW8A 4YFVA 3CINA 2FSSA 1AUVA 2YHBA 3EXG1 4LCBA 1D2HA 4L7VA 5HOQA 3PUIA 4Z0PA 1KNXA 3BTOA 4GPZA 3KOXA 3R1IA 1OY1A 4O6VA 1HI9A 3L7LA 3LIIA 4L4UA 2QZJA 1XTRA 1Z22A 1FFCA 3G02A 4FMPA 4KWIA 5EIWA 5J63A 4P54A 1NF3A 2WSMA 3OE7A 2XNSA 2X7XA 3FNFA 4BNFA 2VIIA 5LQDA 2LCIA 1FJ2A 1JLMA 3OD5A 3PUHA 5DCWA 3RK1A 4D8UA 1OIVA 2X6RA 1QPBA 4LDJA 3VAZA 5U9CA 1GY8A 3ZHVA 1L4NA 5FBRB 4R1NA 3BTSA 1QH1B 1PR3A 1RI3A 2PJZA 1E5QA 3A7EA 2J3HA 1UMDA 3QYFA 1UBKS 2WWTA 1NIJA 2WBLC 3AHJA 3TLCA 4B17A 4H3KB 1ZNXA 4PYLA 1A7JA 5HS6A 2IHKA 3COWA 3I0NA 2KW5A 1UP4A 3ELBA 3IS3A 1BQEA 2P41A 2R66A 3MTIA 3LECA 4DYHA 4JLDA 4B3TB 1KC1A 2HA7A 3FKSD 3WGUA 2FWNA 5FR2A 4XTCS 2YJNA 2JZOA 1H5UA 1HOTA 5G2OA 3PBKA 4GGOA 1FTQA 1Z5WA 4C7BA 1ZN8A 2RBKA 4Z53A 4Z51A 1NXTA 1FU7A 2GD1O 2PWZA 3A6ZA 5T41A 4P08A 3UWKA 4BFWA 5E4JA 1QB8A 3MMSA 1TF7A 1BH6A 1UK9A 4R0NA 4ETNA 2BEWB 2F67A 5TVGA 4TTRA 4Z0TA 1Q0QA 3D3WB 3HJHA 3RYCB 2D1QA 3OM0A 1Z7YA 1OV6A 2O05A 3UK7A 5KWVA 1DC5A 4EB6A 2ZI9A 3BILA 1ZGHA 3DUWA 4MEAA 4G4JA 2BLLA 2XQVA 1L5SA 3CO0S 3WGKA 4EPYA 5TGDA 2QTCA 3PR3A 3I09A 3KYBA 5FBZA 1PT6A 4JOBA 4ZVTA 2VP0A 3JQQA 2JLWA 4O8CA 4AG6A 3R9WA 2GBIA 3OUZA 5HZGA 2B36A 2WJGA 5E3IA 4KK3A 4JU8A 4YRNA 2PGAA 3JQAA 2WSLA 3OM1A 2R85A 3VNBA 3WGGA 2GSDA 4XOUA 4ETIA 2QX7A 5K3DA 3GUCA 3ZHUA 3LXXA 1ZH4A 4F4HA 3FHOA 1YK1A 2B2CA 3EG9B 3VKUA 3WK9A 1PU2A 2QMZA 4CLRA 5AVRA 2VPTA 2NZWA 2ONYA 2QWXA 1ODTC 1GGHA 1ZZEA 2XYRA 1VCNA 5EE1A 3M4ZA 2ZRQA 5DNUA 4O4HB 3VBEA 4KREA 3WNZA 4UOZA 4ZD6A 1QYCA 5IVDA 4J16C 1UZNA 3TXAA 2WWYA 3ZWVA 1O9HA 4Q1DA 1CUJA 2P62A 1QGUA 4NECA 4WZBB 1QRDA 2PO7A 3DCJA 3TBFA 1KTVA 4LMAA 4PFKA 4CIWA 1A98A 1QS0B 3MJCA 3UN1A 1NVFA 3C85A 3EQ2A 1Q3TA 1BW9B 1F12A 1TM7E 2O2EA 2A86A 3FDZA 3OBIA 2ZWOA 4FI3C 3WS7A 5IHPA 3ZHOA 1S7GA 4FHFA 4K9RA 3OJFA 3V7YA 3O94A 5C46F 4HNHA 1W4AA 3IUBA 3GW8A 3QPBA 1VGQA 3W5SA 1RC0A 3WKAA 2JBAA 2YJ3A 4GZ6A 2ZSAA 4HFNA 4IF6A 1THTA 3IT0A 1FUUA 2B35A 3OX2A 4PYRA 5E1OA 4EGSA 4YPVA 2FDXA 3OX3A 2QHXA 4RLQA 2LIPA 2QGFA 3V8EA 1ICEA 2DT8A 1S2LA 1XQ9A 3EC1A 3GTLA 3MWDB 1B1CA 4JLPA 5IBRA 5BP7A 1NWCA 3AIIA 4C3OB 1NP3A 5JZ9A 2NTYC 4Z7JA 5DX8A 2REQA 1Y3AA 3TQOA 1BS2A 5F5NA 4RAQA 2UXDB 3WDSA 2OAGA 3NHPA 4E0BA 1L7BA 2QX9A 4RNDB 4BNDA 4DMHA 1R15A 4EYSA 1PV4A 1A04A 1REQB 1U5BA 2P90A 4BC1A 1HE8B 3C16C 4L8VA 1QDNA 1NI4B 1M8PA 3OE5A 4EITA 2QTTA 3DPUA 4PG8A 3QBVA 3ZGZA 4AKIA 4BGVA 1R0LA 2QBYB 2GILA 2J9GA 1XA0A 3D6MA 3U7QB 1J20A 2O1XA 3QLUA 3VR6A 1E1DA 1W0KA 2DTXA 5B30A 3KXIA 2HFKA 1P2SA 5K6AC 3EMBA 2ZOSA 4LY0A 1EDDA 4QJ3A 4IGIA 3DOHA 3K0CC 1VIDA 3ICVA 4FYJA 5JJBA 1NKSA 5CYPA 3L8ZA 1Y6JA 5DBGA 4KQHA 1ISHA 2QRJA 3N2GB 3ZZNA 1PR9A 2B3DA 1V11B 4YRDA 5ICMA 4W7IA 1I1OA 1V95A 4IL5A 4MWBA 1ZZGA 1ACLA 3HP7A 3TR0A 2FEWB 4QD3A 1C1XA 3DQZA 3FNRA 4IJ6A 4KN5A 3BF8A 1YB7A 1QH0A 5AJWA 2YYZA 1L5WA 2BP7A 1YASA 4QPDA 4M8IA 1P2TA 1Q3KA 3GDOA 3IA7A 4P7JA 5DNVA 4BQRA 4JL5A 3T34A 3NBUA 3QLUC 4R7TA 3R75A 2R79A 4G5GA 1D4ZA 1H05A 5EJ9A 3P96A 2IU6A 4GDMA 2BM9A 3MILA 4AX8A 3AUXA 4G5RA 2PTHA 1AZLA 3OKAA 1J00A 1EK0A 3ZCVA 5F2NA 4RTKA 1Q7RA 3UPDA 2JFGA 5JD3A 5HXAA 3HC7A 1JECA 3OTHA 3EZ6A 1IK6A 1JHRA 1ZOPA 3GB9A 1WCIA 4BNZA 3V80A 1VJRA 2BDEA 2LKDA 4DR5B 3R7WB 1CQPA 3CR3C 2J3LA 4DV3B 3KDPA 3V46A 4JYMA 1RWPA 2VT7A 3Q1KA 4I55A 2IXAA 1K68A 2WQZA 5ULLA 3WAKA 1HNXB 1U0SY 1G3IA 3NGXA 5M7EA 1RI5A 1PQUA 3QBEA 3RTAA 1EK5A 1UM9A 2XSZA 4UDNA 3ZE2B 1WUKS 1G5RA 4L28A 1B8VA 1JIKA 1HETA 1PI3A 3B7GA 1R0SA 4QJBA 1BMFA 4GEGA 4L3VA 1S3GA 3LQ4A 2A5YB 5LMNB 5M29A 1U9IC 4R3UC 2BSAA 4TLAA 1QVVA 1Y5NA 3PHIA 2YXDA 1L8QA 1QNFA 2HMTA 2XUIA 3D4LA 3CVXA 3JPWA 4MI3A 5I7FA 1JDPA 4FZVA 1TM4E 4BOYA 1T5DX 2BEVB 4HEJA 2I7TA 3OPNA 3H9BA 2OUIA 1QTIA 1QHGA 1NR7A 5E9AA 5IJAA 4Q19A 5IWAB 1AS3A 3INTA 4YDSA 2M9MA 2ZBVA 4K9MA 2RHRA 2HK7A 4TV9F 2R1UA 3U9SA 2PXHA 3UUEA 2C2WA 3VR3A 5JVDF 4JJ6A 4GDFA 1SXHA 5DLEA 5JIBA 1WPGA 5FF9A 2FOLA 4JC5A 2FUG1 4IFTA 4UC0A 4C76A 4DWWA 1NBMD 2D13A 4WBNF 4IJQA 4ZT4A 3FNGA 1W7AA 3L6OO 1S2IA 2WUGA 1HT0A 3D8RA 4UARA 4BVKA 3P9QA 3T3HA 3BJZA 3LQKA 2RD2A 3JWHA 1FTNA 3NM5A 2D5CA 2MSKA 3GCDA 3NKFA 4NZZA 4D80A 1TPYA 4NPCA 1WB6A 3T0GA 1T43A 4MWEA 2B8TA 3P32A 2BTQA 2RGRA 2DWOA 2ZVDA 3BMNB 3U81A 3BGVA 3IE1A 3GJ5A 3M70A 3CRVA 3OZFA 3OLXA 4IV8A 1GAEO 4AMYA 2YVKA 4ZXFA 2WWHA 421PA 1VIMA 3JAMA 3MG9A 4ZJYA 3L8GA 4BXOB 5JARA 3SICE 3THXB 3CNEA 4HDNB 2PSEA 1MDBA 1NVKA 3I62A 3OZSA 1YKGA 2PWYA 2BFCB 2CLEB 2Q9BA 4G1VA 2I2AA 1FP7A 4PZZA 4M46A 4LE1A 3KSMA 3JATA 2LRHA 4C0QC 1AXGA 2NACA 4I5IA 1Q7EA 3PXXA 4IX1A 1MW8X 1EVZA 4DUPA 3ZXXA 4OXYA 2PUBA 2A58A 2WTNA 2X4IA 4PWYA 2RAPA 2WJYA 1G2QA 4PNEA 3UHJA 2A1TS 1HFEL 1EWVA 4JODA 3LRTA 3X2LA 1Q1NA 1GPYA 5J4VA 3W5DA 1A9RA 3TAUA 3DV9A 1GPUA 5HIMA 2JGFA 3TM5A 1I4LD 1B00A 1F1BA 2XWJI 3O2SB 1X7YB 3EW9A 1BEZA 2Q5LA 1XZMA 1U7PA 2Z2ZA 3JQ9A 4J90A 4JT4A 2B9EA 3ELUA 3GJYA 4QHSA 5HCUA 3ZWKA 4BIIA 3K70D 3GV0A 3DULA 4JI4B 4GECA 4Z9XA 1FSSA 2J7PA 5BQ5A 1THZA 3VHQA 3PHLA 1K0UA 2OE2A 3DMDA 4HK4A 3LVBA 5H3CA 4BMPB 4C05A 2RE8A 4GPIB 1ODLA 2AKEA 3S2UA 3IPYA 5TPZD 3VSBA 3ESBA 3E9ZA 3F49S 3GYBA 1FXWF 1SBTA 3DAHA 2B21A 5KYYA 2AUNA 3JQGA 4LZLA 3WLKX 2BKVA 1JB1A 2IBMA 3AR7A 3MIIA 1XRPA 3B6ZA 1L8AA 4FD2A 4UM9D 5IFLA 4NPHA 3TRFA 3H3JA 3O8CA 1TAHA 1XD9A 5KAMA 2R00A 1J8FA 4TTJA 3O1IC 3ETJA 4IIDA 5BYKA 4NBWA 1PK8A 1WKCA 3VX4A 1N5KA 4BO3A 1AQIA 5CXQA 6LDHA 3I64A 1MDFA 1OX6A 4CT5A 2X76A 3BL6A 1QWSA 5TQ0A 3JQAD 1X80A 2ZRPA 3DD1A 1XN1A 2UUAB 2WM8A 1IN1A 4TLLB 3SMVA 1ZRSA 2EP5A 2BFNA 2ID9A 3AINA 2GCNA 4B8WA 1OXVA 3KZ1E 2NO9A 4U7TB 3UAGA 4ANFA 3CVYA 1J42A 2WUDA 2XB4A 3K9GA 2P4EA 4URUR 3NHJA 5L40A 5AW1A 4KNYA 1QFMA 1RAFA 3WSTA 4YV0A 5L4SA 4FONA 1QCSA 1A96A 4TLMB 5KSWB 1BX1A 1SQSA 3RHFA 4XQEA 3ZLJA 1BGVA 3MGCA 3JZMA 3ZKWB 2TMDA 4UUNA 3ZWXA 2XEDA 2I3DA 3OZVA 3L7CA 1Q17A 2VT2A 3INGA 4NKRA 1MUUA 4RK6A 2I22A 5I3CA 3GX1A 3ML1A 1Y8CA 3PJEA 3DO6A 5TARA 1WKVA 3GA0A 1L4LA 4KQ2A 3ROXA 3IV7A 4NZ9A 4CRZA 3CLUC 3RG2A 1B23P 2R96A 3HWX1 2ZS7A 4GUAA 2ZAYA 1TL7C 1ZEJA 1LQUA 4LV5B 2FLWA 2CJPA 5H9WA 4K9PA 2YOGA 5MN6A 1SQGA 1M83A 5DIFA 3GN1A 2YMLA 4JLJA 2VHWA 3G9TA 5CLGA 3T5BA 1FFBA 1O77A 2NXJA 2QJTA 4GZ3A 4YUVA 4IDHA 5AK0A 3TEJA 4DC9A 4QG7A 3HXOA 2HTFA 4PONA 2IYOA 2P2CA 5EYPB 1N8KA 4HQKA 1Q0TA 4J3JA 3PE3A 2NT4A 2PD6A 3SS7X 1G21B 3BAFA 1WDWB 1H66A 1L7QA 1R9NA 4ZO6A 4REQA 1OW3B 5EJIA 2I2DA 1OF1A 2A3NA 1HYBA 5FPKA 1P2FA 4D82A 5AHWA 3HMKA 2QR5A 2CL5A 2XSZD 5I8ZA 1UDCA 1ND6A 5AM0A 1IDOA 3WJ1A 4EEKA 2O07A 5HSGA 1K8XB 1N9GB 3DWFA 4N3BA 4I4LA 1DJPA 1GSOA 1AN0A 1S3IA 3IAM1 4BFTA 4QYSA 4G0OA 4QJ4A 1EXDA 2PLFA 1T8TA 4I6EA 5T7BA 3EISA 4FFBA 4GL4A 3FUWA 5L6LB 2J3EA 1YMQA 4DDKA 5CR9A 4DCGA 2RGNC 2VSQA 3GNLA 1XJQA 4QUHA 2DCMA 3SJUA 4LF8B 4C4RA 4KRXA 4WN9A 1T2EA 2QW1A 2ZU0C 3H2ZA 4TYYA 4KV9A 2X0IA 5DI3A 1V4VA 2CVHA 4KZKA 1F0PA 1JKJA 2F17A 3DQPA 3GAAA 3EGCA 5E1BA 4WV3A 3WO1A 4C4TA 5CDUA 4O4JB 1BE8A 2ZW9A 3DE0X 1NU8A 4FYIA 4R40A 4L7QA 1HK7A 4HJRA 4PLWA 1H1DA 3BL5A 1YB1A 1D4FA 2DT5A 3FR7A 3K0EA 4EG6A 3UGJA 2AFIA 1BCSB 4GVPA 3DTTA 2CBXA 1ZMRA 2E6KA 4DRYA 1GG9A 3NH6A 3MB8A 3M6IA 4OUDA 4XWAA 4EYEA 3P94A 3RVDA 4EYOA 3BA6A 5CDHA 4KFCA 4FGUA 5FIUA 3UK0A 4IIYA 2QNRA 2C4HA 2NWQA 1J8DA 5EE0A 1DEHA 1OZHA 1YJCA 5THKA 4OSEA 3F5DA 4F4FA 5IDQA 3T5PA 4WEQA 2H2AA 1HDGO 3WGIA 1IHDA 1OV4A 4GSYA 4OHFA 1ZNWA 1H0SA 5ENZA 3N2LA 2ADFA 2HBRA 3WQHA 7REQA 1WUIS 5KJCA 4C04A 1PJCA 2O7NA 2P27A 4WGGA 1BW9A 3HCPA 4CCSA 1U4NA 1G2IA 1CY0A 1J5PA 3CH4B 1F2TA 3ET4A 2IZ6A 1SHTX 4JH0A 621PA 3D7KA 5ELXA 3EG5A 4J0EA 4AMZA 3LF2A 4NATA 1RZVA 2PKXA 2QJOA 1E5LA 3N8GA 1V35A 4RK7A 2FPGB 1SUFA 1E66A 3G2IA 2G9RA 3I34X 2B0CA 3M5PA 4A6EA 3LFUA 4BXOA 2B3TA 2GXAA 4HPJB 2Z5LA 4TTVA 3IVXA 1NUPA 1LGYA 3JD2A 2VPPA 4FT2A 1X9IA 3ISJA 4RK4A 4YXWD 1UM8A 3GAMA 3KJZA 3VDRA 1W52X 4IJUA 1EVQA 3Q3HA 4J49A 1U1GA 4DUGD 3M2TA 3GGJA 4M0CA 3CSDA 2HBYA 3FZQA 4JEMA 4UJ5A 2BEUB 2FSUA 3G2MA 4IDBA 5GV7A 2E5WA 5G3YA 1L5GB 5EHQA 3RWMB 3D6HA 2LTAA 3S2IA 4KDFA 3SBOA 4YMIA 3LUBA 2C2YA 2GEDA 2B99A 2R1VB 5HUHA 4W1QA 1JXOA 2GSWA 1RJFA 1T13A 4TM8A 5ES3A 2EIXA 2CLSA 3E2IA 2XZLA 2UXBB 1P17A 3QU4A 3RJZA 5KTKA 5EAIA 5FOUA 3UG7A 4WLOA 4EF5A 1C1YA 5BMVB 4JV5B 2I2WA 5AKGA 5KYUB 2ZCJA 2GLTA 1F0KA 5A9RA 3WB0A 2VJDA 5EINA 4IJVA 4EH1A 2AZDA 4PSKA 1XK6A 3LRPA 4X0EA 4GMFA 4DG8A 1QHEA 2YS6A 3IIEA 3UT5B 2RHMA 4UVIA 5IP5A 2RAUA 1NFFA 4UXJA 3FR8A 5J5CA 2CUKA 4F8EA 4G0VA 1OOEA 1CUAA 4D25A 2W8BA 3KQOA 1ISRA 4RD0A 4EW6A 3HNRA 1XDZA 1B74A 1JZSA 4YRSA 3LL4A 3IIKA 3GTQA 4FXOA 1VA4A 4ZVKA 2WJ6A 3T3PB 2OR3A 2FZGA 1IIBA 3EF3A 1RHJA 3M6AA 4OP3A 1G1MA 2VUSA 1CD5A 3FUVA 5JSFA 1XEAA 1I2DA 4XM0A 4IF4A 5F76A 1P9OA 1QKIA 4MEBA 4G0YA 3JARB 5PNTA 3LYAA 2V7GA 3LK7A 4J7AA 3S5UA 2P1ZA 4MB2A 4RY0A 2IV7A 2ZG6A 3DFKA 3X2HA 4G0MA 3AL2A 3CZ4A 4NDNE 3DZHA 5AK4A 1KYQA 3QVGA 4JXZA 1PWYE 5F7JA 1AS2A 5J40A 2IPLA 2RHCA 3I23A 5AHRA 2FG5A 1PDOA 1G55A 4ZO4A 4A27A 4PN7A 2R48A 1NA5A 3PCRB 1U4SA 5A3RA 1HMYA 4MV9A 4J2TA 5IDWA 2XCRB 1R18A 2R1TA 4XUCA 4PZAA 2X15A 2A6ED 3NT4A 1V7CA 3ZJVA 5LKRA 4ALIA 4F3RA 4S1NA 1X1QA 1AZTA 1RZRD 4EX7A 2WB2A 3SE7A 4LRXA 4WCFA 2PJJA 3SZMA 4F97A 1FRFS 5JG7A 3DZFA 1KORA 5DIZA 4O63O 3YASA 4MW2A 1EUCB 5HF6A 2PH7A 2ROQA 4B3BA 3FSGA 9LDTA 2E2IA 1PYGA 3GRPA 1QYDA 3IA2A 1N77A 3HDVA 3RBVA 3W6UA 1HBJA 3NIWA 2OZLB 3IOEA 2ODBA 3AOEC 5C9ZA 3ER6A 4QUEA 1P7ZA 1XVIA 3LDAA 4IQ4A 4JJKA 1Q22A 4R01A 3IHKA 3TSZA 3UJBA 3ZHSA 2NMVA 2EBUA 1XVUA 1NYQA 3KEOA 4OGKA 1LLQA 4QX6A 2IP1A 1CJTC 4TSFD 2ZSEA 1PLKA 2QD2A 4U00A 1GPJA 3T7KA 4NOLA 1M2OB 5ILGA 4EHLA 1HURA 4F38A 3D43A 5AUNB 3KIPA 3JQFC 4E7PA 3UBMA 1CF9A 5AVZA 2GA8A 3GLVA 4M9QA 4TL9A 1ZOIA 1Q1QA 2H63A 4DJEC 1L4UA 3BQNB 4I4IA 5HR5A 3C5VA 4M3NA 4RVNA 2ZI3A 3IMEA 5FA6A 2QQGA 1XTPA 1LX6A 1YS7A 3L1VA 3QA3E 1XEXA 2I3AA 3VPGA 5AW4A 5F2EA 1Z12A 5JAOA 2IS6A 2H4WA 5ALOA 3KNZA 1S2MA 1YUBA 2Q1SA 4IUBS 2ZUUA 5EIBD 4MDHA 5L8VA 2CBZA 1R4MA 2W4MA 3V3TA 4IUDS 1TADA 3UA4A 1YA8A 1T2NA 4JLVA 4MLDA 5TQVA 3SDSA 3T3GA 3U2QA 5HM8A 4TVOA 4P22A 5AI5A 1FW6A 3AF5A 3KUXA 3LVQE 4ZU3A 2IEBA 3F4KA 3Q87B 4ME6A 4CCWA 3DEZA 4YR7A 1DIGA 3ZDQA 1ZMBA 2F2TA 3ENNA 4FKBA 5JDCC 4HDRB 1AXEA 1Z63A 5DSTA 5WRFA 1BS9A 2QAGB 1UC9A 3PEUA 4G8JA 1ISPA 4GBJA 4ZXPA 1KP2A 2QV7A 3CONA 4AKGA 4CL8A 1P0QA 3SZOA 1V1RB 1A2OA 1FUIA 2V3WA 1CUEA 4URYR 2Z9CA 4YJFB 3CBQA 2E4WA 2FWRA 5EXEA 5CYOA 4V3CA 1Q15A 3ROQA 1B2LA 3U44B 2ERXA 2PRZA 4BV2A 1JI0A 4BJ6A 3EQ6A 4Q7KA 2J3MA 3W5VA 1AHPA 1QS0A 4YFYA 2GN6A 3QQ7A 3I2KA 3KOUA 3CXUA 1G6Q1 3DMGA 3N86A 4IVQA 4JGBA 3ZVKA 5A2QA 1E79D 2H0QA 1JDSA 4WNIA 3C14C 3JSAA 2VKQA 3BF7A 3QPDA 1QLWA 1TUBA 3N59A 2A78A 4IRUB 3IEXA 5JMWA 4WFQA 3FIUA 4DQVA 3DB2A 1R0YA 1O96A 3FUTA 3PVCA 4Z4CA 4ISCA 1BU8A 1BWRA 2NO7A 3IAM6 1WMSA 3L6UA 1P1JA 1BVYF 5FPYA 2BGRA 1GM5A 1SQFA 3HR8A 2TYSB 2NTNA 4JVNA 2ZIGA 1L7VC 3MJFA 4I46A 3KBOA 2DUJA 5MDHA 3SR0A 3MK31 4JVMA 4MRPA 3RVNA 4EJFA 1FX1A 4CM5A 2OCXA 2JARA 3IKLA 4JBHA 3KJNA 2HGSA 5ALMA 3SBXA 3W4KA 4DM4A 2FW8A 1O6GA 1GYPA 3NHRA 2PUAA 5CRIA 4DB2A 2V5UA 2G82A 2WSIA 1PVOA 3INNA 4HBGA 1B4DA 2VG8A 3NNDA 5ARDA 3DZIA 3A9SA 1VLQA 2E2HA 1GA1A 1I7LA 1PK9A 1V8PA 1Z5UA 3H86A 4YJ3B 5ALJA 3RG8A 1KERA 1QQ5A 1W85B 2ZBPA 2F48A 5CVEA 2XIQA 5AT1A 4CVNA 5MN4A 1G6KA 4ZARA 3U7IA 3D4IA 3NWOA 4HATA 5FQOA 3WICA 1OXMA 3T38A 1SVNA 4ND6A 5CAEB 4WBXC 1I6MA 2H17A 1I24A 3TZQA 3OLZA 2VUHB 5HIAA 6ABPA 2P9FA 2FZ4A 2PX4A 3GARA 4ZU1X 3IVCA 1J9ZA 2JGIA 3O47A 3PYXA 1LF0A 2QI9F 2O7VA 3K5HA 1V41E 4KFRA 3PR1A 3RGGA 4BUZA 4ARIA 1Y1RA 4J16A 5IW8A 3W2IA 4EFDA 1TVCA 2OKGA 3FWZA 1M1YE 2VRCD 3DDCA 3W1VA 3KCNA 4URZR 5LYJA 3ZXYA 1LV7A 4AS2A 5ICGA 4RC9A 1ZD1A 3B70A 3TD6A 3MJSA 3HVUA 4FFPA 4MV3A 2BEKA 4OFZA 2P6PA 3H1FA 4QYWA 3PFWO 3VC1A 4QARA 3LT5A 4V02A 4X92A 1AHNA 3OMWA 4WZAA 3GGDA 3OQ6A 2O9JA 3WOHA 2FMXA 1R9GA 3H2HA 1DKNA 3HKBB 4QDUA 4U63A 1B0PA 2PWBA 3HCNA 5IT4A 1OB2A 3U3KA 4BVLA 5JCPA 2HRCA 3ZKWA 3WP1B 1NAHA 2VF2A 5LUBA 2IS2A 2GH1A 3C7TA 1T3HA 2EFCB 1SB9A 4NS1A 3DTNA 2A1UB 3MYYA 3HZHA 4JT9A 4WKPA 4QG3A 4F9TA 2J6CA 1J07A 1W1WA 1T4MA 2EOAA 3L5OA 1K7SN 2B5OA 3R3YA 4PG6A 1C2YA 4ZCSA 5K99A 5DMHA 1X1TA 3T99A 3JY6A 4P5PA 4M9UA 4BL5A 3MWLA 1Z15A 1TTPB 1QU2A 3RC1A 1T1SA 1VHLA 4C4YA 1CUSA 2FJPA 5FLEX 4UU7A 3IV6A 4YT8A 4JGIA 2GPAA 1E2QA 3KQMA 4DARA 3RAJA 4IOKA 3VTKA 3JV7A 5D84A 3DAOA 3S2GA 3X2PA 1OHHA 4DZZA 3ISTA 1H8EA 2ZJOA 2WHRA 5HIJA 1QQTA 4C2TA 1XNGA 3HGMA 1Z83A 3AFHA 1I4DD 2NTEA 4G81A 5EKTA 5H80A 1Z08A 4RY2A 2IHYA 5LNK1 4CDNA 4NJEA 2RI0A 5E6RB 3LUDA 2EZUA 3Q0EA 1ODSA 1D04A 4G1UC 4PW0A 1UBEA 4BWGA 6GPBA 1SOWA 5LPNA 5JAQA 5SZIA 3I01A 4H27A 3A3KA 5F5XA 1U3GA 3SBEA 4CBVA 5LLTA 3V1LA 4YMGA 2XRFA 2ZUWA 1XB2A 2WU1A 2YC2C 3V4OA 1H1LB 3CGWA 1ECGA 3MAJA 1YBVA 2X6QA 4JJEA 1IE3A 1X0XA 4TL6A 1N36B 1TKBA 2J4FA 2MDTA 2OHJA 2QAGC 2XY4A 5AXAA 2EDAA 3UXHA 1ZK0A 1AIPA 2W2QA 4FSDA 3TWOA 2OCKA 3IV9A 3OQBA 1KDPA 4YP7A 4EECA 1MHTA 4MINA 4B2IA 4E5VA 4ESHA 5CFPA 4BFLA 3W0LB 1CUFA 2SBTA 1KETA 3K1AB 3OX1A 3OZUA 4F93B 2QAJA 1FBNA 5AKLA 2NZUG 1JAIA 4QAQA 4AYWA 1F4LA 4FYYA 2B1JA 3SXUB 2QUKA 1ZRMA 3NEAA 3P9IA 1SPXA 1NM5C 1J21A 2PZKA 1T1EA 4G6ZA 3TJRA 1A9XA 1TECE 2IUEA 2XYQA 4YQYA 3FCYA 4EHBA 1HE4A 2AX4A 2HPHA 1N57A 2ZJ3A 4KK4A 3Q1LA 5IG2A 1VG8A 3F6SA 5JADA 3F97A 3PK0A 1XVTA 1RW4A 1VPTA 2QRNA 3DWEX 4HUQB 3UF0A 5KTOA 1Y8ZA 4PR0A 1SC3A 2A6PA 1Z0AA 5E4TA 1Z33A 5FBWB 1Y9JA 5HCNA 4ZKEA 3WZLA 1GV0A 2FFHA 2IZOA 1UBCA 3S0JA 4W6ZA 3VMFA 5JSZA 1BHO1 3QLEA 4RAOA 1JG6A 3DL0A 1ESMA 3KM0A 4Y1RA 5CTJA 3SQNA 1YR9A 1LRKA 1RACA 1EFLA 4RHEA 1X1AA 5DYYA 2YZ2A 5CIYA 2R84A 2JFXA 3CNNA 3LA6A 3JD3A 2HO5A 2KLHA 4UE2A 3WV4A 4A7PA 1THGA 3EAQA 1Y1PA 3I12A 5ALSA 5EJ2A 5JC8A 2GAIA 2VWPA 2Q6IA 3RFUA 3WMEA 1II8A 1DAIA 3J7AC 5D8DA 3JQAB 2JGLA 3PDJA 3FYUA 1P4JA 3BYZA 1XL1A 2EGHA 1CG6A 4KXQA 1Q1EA 3ANNA 1GQ2A 2NZ2A 2OC9A 2B8JA 2Z1DA 4K86A 1DLJA 1XLVA 4Q16A 3IQIX 4RWZA 2OSVA 1TTHA 1P4SA 4B3IA 4EJ6A 1HH4A 1SR8A 5J23A 2QPLA 4C20A 3ESCA 3HU5A 4XWYA 5F77A 4OI1A 4C0AC 4ND2A 1XRSB 3AL0C 2J0QA 3LGXA 1A5AB 4M36A 4KSBA 5EKDA 1UBHS 2C9MA 5F12A 1X1SA 2ZPTX 1OYWA 3E4DA 3S55A 3D59A 4ZQIA 5A4AA 5C5IA 3QXCA 4OMUA 5LD2B 1CQXA 1PIWA 4FEAA 4GSKA 5L3SB 1DP4A 3CCBA 1H9AA 1YR8A 1E59A 1LJLA 2PRKA 3CZ9A 1BN7A 3M4NA 4TWZA 4Y0AA 2ZZKA 3M2PA 3VU3A 1SFRA 1JAHA 1T4CA 2FR0A 2G7MC 1O8CA 3GEMA 4MKFA 4UOQA 4XCVA 3T0IA 4EBFA 3RKUA 4AJ9A 4CQJA 5I9IA 4FGKA 2GN8A 4X90A 3F74A 2Q4OA 1X7YA 3DBIA 1F8UA 4DLTA 1TA4A 1UKEA 5C1DA 3H1PA 1XZAA 4YBZA 1XZPA 1ZD3A 2AFHB 1KO5A 5JXHA 3OX4A 1Z4OA 3I9NA 4JZYA 1V1MB 2DPMA 3EIHA 2ZJFA 3PQDA 2C00A 4MVWA 3WHIA 3U80A 2CFOA 1QK3A 3FWKA 5DN9A 4ZAWA 1KI1A 3X2OA 4H7JA 4WLNA 4A0GA 2VHVA 2BHTA 3BA1A 1NF9A 1VKHA 5HZHA 1GTL1 2JCSA 4ND1A 3U3OA 3UKOA 1YVUA 1ETHA 1RM3A 2VP5A 4ID9A 4EI2A 3PB3A 3JU3A 4UAUA 1VIYA 1KPGA 3OWHA 1HRDA 4WCFC 3QVWA 5EZ6B 4CM1A 1S2OA 2DHCA 2BAGA 3G59A 2VXOA 4EABA 1QIGA 3JQ9C 1XT6A 3ZNOA 1BSVA 1M0EA 2E5LB 1R5OA 4MWCA 1CJBA 1FYVA 3BD9A 2CYAA 2F1JA 2ZJ5A 3KQUA 3HGQA 4F5WA 5AVSA 1GNLA 4QQKA 4ARCA 2R7KA 4S12A 4C21A 5DYIA 2GPTA 3IP8A 1E6EA 3NANA 3NM6B 4A8HA 1NXWA 2JATA 4AUKA 3T1HB 4I4TF 2BT4A 1JQJC 4PQYA 5DK4A 4YV1A 2D5IA 1KMHB 3G5AA 1UBNA 2VYCA 2WYHA 5ALPA 3D7SA 2D62A 4CKEB 2I4LA 1KMMA 1YIDA 3SHTA 3UAVA 4DNFA 1HR0B 4R2KA 1L5KA 4F1WA 2D5BA 3SR3A 4MUJA 1T9KA 5JO9A 1QG2A 1VYHA 2EJTA 4NU5A 3CZMA 3A6KA 1BC5A 5IYZF 3RYHB 5H4GA 1JDBC 1JLKA 4NBNA 4NS4A 3V6MA 1QIDA 1GYQA 5KNDH 3GFSA 3AUKA 2C5SA 4G0PA 2IWHA 3WQBA 2F43B 5TQ2A 4F5DA 1DKMA 1JQKA 2H3EA 1N0WA 2LNDA 3EH1A 3GZ4A 4K81B 3OIGA 5EESA 1EFAA 1SVIA 4BE7B 4DZRA 2F3UA 4GR9A 1PTJA 4Y0NA 5GONF 2ZYGA 1ODKA 1RI1A 2W98A 4U7HA 2MR5A 3SQXA 2JFPA 5DFAA 3SQOA 3HN2A 3HUFA 2A8YA 2HJSA 4FFRA 4X3CA 5T4HA 4M9RA 4XWKA 4EEXA 5BRAA 3D8NA 2QMOA 4WA8A 2ZBFA 5HJ5A 1ZXLA 6CHYA 4OXIA 1OWNA 4KACA 1C30B 2P75A 3C41J 4OK3A 3VR5D 2OGWA 3VDXA 3VHLB 3OIYA 1L3BA 3T3EA 1FYFA 1QM5A 3C48A 3QGMA 5HCIA 1GYRA 4JKIA 2V3VA 3JAKB 1VLZA 3BRCA 3NPAA 4QYTA 4HR7A 3MXTA 4P3NA 4DCVA 2X4DA 1U8CB 1JLLB 3BB3A 1W8IA 4PTLA 1WZNA 4TV9A 2P9JA 1PTJC 1X14A 4QBGB 2Q27A 4H59A 1SXJE 4PZDA 2WLTA 1UZLA 2D7JA 4DLUA 4QTYA 4UEQA 1L7AA 1QMGA 5DXJA 3TSOA 2PZ8A 4AN0A 4LNUB 5MGNA 3VSDA 5JR3A 1ID8A 3GFGA 2OLJA 2HLDD 1OH8A 4WE3A 1QKJA 1X7WB 1E18A 2WAQA 3H1EA 4XYMA 3WL5A 1IN6A 1RHUA 1RWXA 2X22A 4LRQA 2B69A 5ERYA 4YXWA 5PGMA 4MQBA 3FOAA 4J75A 4GFDA 2PS0A 1U28C 3H6GA 3FY4A 2N1MA 4X41A 1FB5A 4KZPA 4EW1A 2CCJA 3ZHRA 4HZGA 4IFBA 2PMBA 3TNLA 4KXFB 3VOBA 1J09A 1QYVA 1FFAA 4JBNA 3EB9A 5SYMA 3AUFA 3N07A 3OF3A 3R44A 3R7BA 2PRYA 3SYKA 4CQLB 2FW9A 1W0KD 2PLRA 3DHVA 1MZPA 4JFAA 4TOIA 1C7QA 2OVFA 2A68D 4E2ZA 3IEVA 1H2FA 5JSZB 3E8XA 3D3EA 2HEGA 2XCOA 1PUJA 2UVPB 3Q3JB 2C1ZA 4OYYA 5EP2A 1L7XA 3T7EA 5LM3A 4TT8A 2BLNA 3FRJA 2PNWA 3EEQA 3H0KA 4WKBA 1P8JA 1SD1A 1PJAA 3E5MA 1KU0A 3T9BA 5C1BA 2P8JA 3PLRA 4KXYA 4R8LA 2WT4A 3SDZA 4IIJA 1Z7GA 3ZQUA 1NN1A 3AP1A 4B45A 1ORWA 5E0KB 1YR6A 2VDRB 2IYEA 1ESNA 1GQYA 4OJKA 3UWMA 1TK3A 1UWVA 2ZRLA 2ZVQX 5FOWA 6REQA 5JSHA 1W5TA 2HNAA 2B7LA 4G5FA 2PNJA 3ZXUB 2G5CA 4L4RA 3KVOA 4KCGA 2XNDA 2J0VA 1Y3FE 2YV4A 4CV2A 1JXMA 2OCGA 2ZUBA 3DEYX 4J0IA 2AJLI 4RJJA 3C3XA 4GBGA 3KT8A 4AK9A 3RDPA 5K0EA 3T3OA 1SXQA 1TYCA 3QFFA 1GP2A 4MUYA 3ZZUA 4C6SA 5AH0A 2I9PA 4EW3A 5GGXA 3GVXA 5LBUA 4P6VF 2QORA 2Z1NA 4H6XA 4KSCA 1KDTA 4NCNA 4MVCA 5GOZA 3VNVA 2YHAA 5E9QA 3V8PA 4UDOA 4EA7A 2R11A 2A1IA 2BR5A 5KZMB 4LRYA 4FI3F 4YMWA 5DZSA 3K92A 4MR7A 1Q6YA 3QQ5A 1G3UA 1VL8A 3DMNA 4JJ4A 5JJLA 1ZJZA 2R6DA 2JRCA 3C6XA 2Z6UA 2H7CA 2ZULA 1Q1AA 3FTPA 4Q5IA 3SSNA 4B80A 4MQ4A 4XPIA 3EPLA 1TWAA 4PZPA 3DMTA 5ECWA 3AIOA 1KJQA 1FE8A 3G68A 4Z9FA 2X0EA 1TD1A 1X2EA 4BDSA 3PXUA 4DIDA 2QE7D 5F98A 5ENDA 1OU4A 3NGLA 2H2HA 3NM4A 4OM8A 3TOXA 4BQQA 3LBFA 3STHA 1L5LA 2DHDA 3IBFA 3RS7A 4BO8A 2XAUA 1QHHA 1MO2A 1YTUA 2PVCA 3OMLA 4WIAA 4J8PA 4ADSG 1N6NA 2OBNA 1YGPA 1CZLA 4NE7A 3MCUA 3VZDA 2HYDA 1HOXA 1B6GA 3FMIA 4UTNA 3BT7A 4LIPD 1QP8A 1FOEB 2C07A 4NXMB 2G70A 3HN7A 3W7BA 4FUTA 2CDCA 2ADOA 3RPEA 2VHEA 1BXRA 5AW7A 3M33A 1I6LA 5EC8A 2AXQA 4NU8X 4DSNA 4C0LA 5I7UA 3W8FA 3UC5A 1A9QA 1S01A 4IGAA 4PHFA 3OEED 1OLXB 4DILA 5A02A 4KITB 3L93A 3B3GA 2XT9A 4OBBA 2IYRA 2NXNA 3DVAB 5FTWA 3CX6A 4I9UA 1K5GA 3IAS1 2P4SA 1FRQA 1NFRA 2VDPB 4FCTA 1PV2A 2P79A 4QTXA 1MAVA 2CB9A 2GKOA 1PGOA 1JAZA 3FKIA 2GPNA 3KTFA 2JAOA 4NCJA 3CHYA 2B4AA 2IT1A 5BW6B 4JELA 1MP0A 3NNNA 2ZCUA 2OGZA 4XGNA 1N3BA 2Z2KA 1RQNA 3AW9A 1FRZA 2I4NA 3RHZA 3ZK7A 3BWEA 1ZX1A 4R71A 1DEOA 1A77A 3A4LA 2W00A 3FIJA 2OCPA 1IY2A 5H5JA 4QZVA 3EZGA 3E9EA 1H2RS 3SMQA 1OB5A 4S1PA 3RJTA 2OV4A 2XADA 3AJDA 3LY9A 3NBQA 2LKCA 3OPYI 1QOZA 3ZLVA 4O08A 4XR9A 4AXXA 4PINA 2IHUA 3CKMA 3INRA 4D9JA 2G9ZA 3BORA 4NESA 4E88A 1RTKA 1M67A 3NCTA 3JRWA 2GZDA 2H07A 4PG4A 4CMIB 1N78A 2XRMA 1ECPA 1JHYA 3ZWAA 1DTEA 2HYIC 3CEJA 5JO0A 1V47A 3O75A 2ASEA 2WK1A 3OKCA 1NBAA 1RR6A 3PJRA 2JC3A 3O5AA 2IVFA 1JJ7A 2ZB3A 2G4VA 4RWEA 4B40A 1XCJA 1B6TA 4C3UA 5AM2A 1E98A 3QXSA 4JP5A 1XNRB 4JUDX 4P0PB 3E9DA 5JS6A 4XYEA 1WM1A 1PG2A 2P3SA 2FSFA 4FT4A 4CG3A 3K1AA 4Y9UA 3OOSA 4AOKB 4Q01A 3E22B 5DM2A 2C84A 4COKA 1Y6RA 3BWXA 3BKXA 1GL9B 4WINA 3U39A 1X1DA 4BTEA 4LTMA 3BMCB 3ZD8A 4X8MA 5ARBA 4Z3OA 1H9CA 2AN4A 1Q19A 2EBWA 1X70A 3K4PA 4EGJA 4DL9A 5JEDA 3WBFA 5K8UA 4C7OB 3A6JA 3BHJA 3C7AA 4HFJA 3S1AA 4C5CA 2NVOA 1XV5A 2YNMA 1OR8A 2Z56A 3DT6A 4OLBA 3C70A 1P2DA 3HO6A 1QTRA 3FLEA 4C2UA 3PQFA 3NBXX 1PJ4A 4Z3KA 1ULBA 3GTKA 4KUHA 2QLFA 3FFWA 1JG7A 3A3OA 2ODEA 3D2AA 4QDOA 2JI6A 2HQRA 3V00A 3DMFA 5LMCA 4PX9A 2XCTB 3LPDA 2UZ4A 1ZCZA 4BQFA 1ZXXA 3IMKA 4BTLA 1WD7A 2YWRA 4BVJA 3MD9A 2OL4A 4P3KA 2Q28A 5M34A 3K1ZA 1EK2A 1T35A 1VPLA 5E8JA 1IMJA 1L5VA 5IDYA 5FH9A 1Z29A 3ZY4A 1Y80A 4OQYA 3UXYA 4ZZ3A 5IK2D 2NU7A 5CB4A 3KVVA 4BJHB 4UAGA 2R5NA 4QLOA 1IJKA 2YS7A 3KT6A 3T9CA 3IVRA 1Z6QA 3AR3A 3T7AA 3C3DA 1ULHA 4QT4A 4JHLA 2FSVC 1KKMA 4JT2A 4X94A 1JMVA 2LP4Y 2YWHA 2OXFA 1C8BA 3C1OA 4ZV7A 4DGQA 4PPGA 2FUCA 1A7KA 2PZEA 2QTHA 3I1JA 5H4HA 4DGSA 4Q4HA 2DPYA 3T3MB 2H9IA 4F3TA 4Z49A 1Y9ZA 1BYUA 3QKTA 4IHJA 1M2NA 3AEUB 5HFJA 5HTOA 4JBWA 1NUHA 1OFIA 4YCLA 1NR1A 1TYBE 2W2VA 5CW1A 4ERNA 4QEDA 4MVJI 8LDHA 3KLBA 4C0WA 4CTNA 3HUDA 3KG2A 2QRMA 1AO0A 4GG1A 3FPBA 2ZIXB 2YOHA 1OI3A 3BXHA 3VTAA 3FFBA 1ZH8A 4P58A 2YX1A 4I2NA 4R2HA 5FX2A 2H57A 1NBEA 3W8RA 3OF5A 2HF9A 3I9V1 1DT3A 4ICIA 4IP0A 4E5MA 2F9FA 1F2UA 1QYRA 1SCUA 1E0KA 3TCKA 5JTTA 2HSZA 3W77A 4KMMA 2DETA 1N6OA 1CVIA 2HKIA 3BGWA 3MRTA 3FLBA 3ONVA 2QSJA 1CVRA 1COWD 2AT1A 1FFDA 4D96A 2AMFA 1AUPA 2Z3WA 1VE9A 3HCEA 1WV0A 5DJ5A 3VPBA 3OOEA 3D8UA 1X7DA 3GC6A 5REQB 3EZYA 1UFQA 5F33A 5LLSA 4KYVA 5ALNA 3RYCA 3B6KA 3OFJA 3D8SA 1YI0A 1BKSB 4TS1A 5JSKA 2B1QA 4GI7A 3I0MA 3ZY6A 5EMKA 2XA1A 5FV4A 3KB8A 1SMYD 3KQWA 3PC4A 1XMOB 3KYIB 1H0HA 2ZPAA 3KZVA 3GJZA 1XCGB 1M1YB 1C9EA 4N40A 4RK1A 4D44A 1SHKA 2IHTA 2Q45A 4LWQA 3ZCPA 1CF2O 4YUWA 5IPFA 3TPFA 5LQUA 1LTKA 4UQPA 3FZEA 2RGDA 4M88A 2NTVA 1T4DA 3R6LA 3TXXA 2PHZA 4AUMA 1J8VA 3FA2A 3MELA 4B4WA 4DKXA 1J06A 4DLKA 4KG7A 2GPYA 3E2PA 2NSLA 4KDRA 5LYJB 4NI5A 3RANA 5A5GA 1RZRA 2MCFA 2NUPB 1VHJA 2V58A 4LFBB 4IFIA 1DKLA 4LDQA 2PGNA 3DWGA 2YWBA 4HAIA 2CKMA 1D0SA 2WF6A 3J81A 4D6PA 1YCDA 4CFZA 1KC3A 2G76A 3GDFA 2Q41A 3DTVB 3I42A 3P2MA 1X7ZA 1E7YA 2Q0HA 2VCYA 3QG5A 4L5YA 4CKWB 4GPAA 4JDPA 3L7JA 4I8DA 4I08A 3BQ9A 3KU4A 2Q2VA 1P91A 2N42A 2W70A 2ISSD 4CM3A 1Z17A 3OZXA 4WFJA 1ZBQA 4F45A 5LP6B 5I7WA 4NOJA 2QN7A 5IT9A 4B3MB 3EXEB 3PC8A 1E3MA 3LFTA 4MVJA 1L4FA 1HYGA 1OPXA 2HJGA 4LK2A 2ANBA 2BN4A 2GDJA 4Y2HA 2XF8A 4XWOA 4X66B 2G1PA 4GKJB 1OA0A 2PIAA 1DLIA 5CJ2A 1ZM4A 2FEXA 3W05A 4RYDA 3VYRB 2G77B 2AG0A 3RV4A 2JLQA 3NAQA 1LB1B 5FPHA 4WESB 3ZS8A 4BQOA 1C4XA 2V8OA 5EE3A 1D6MA 1E6WA 1FFXB 3A1UA 5H81A 5FORA 4BAGA 2YYSA 1PNQA 2PG3A 4RULA 1X2BA 2J6IA 2JLCA 3NYRA 5EIHA 1ZK3A 1C41A 2BI7A 5DHSA 2V1XA 4YWJA 3RRNA 1GPLA 3GNQA 2DSTA 4I36A 1KK3A 4Q1BA 4Q6BA 5FWXB 4GBED 5A5EA 4ZN6A 2OV6A 1C2TA 1ITZA 1ML3A 2PYZA 3N76A 4XASA 3ZEAA 1K6XA 1XLUA 2FPKA 3ZWBA 1WXDA 4Y7DA 4PC6A 2OK8A 3ZBQA 3PDHA 1Y1TA 4MVJH 2I7VA 3KZNA 4RUKA 4JASB 5LZ9A 1F6BA 1STOA 1XEXB 1DBSA 1E9CA 4UVGA 4EG7A 1YDMA 4ZCMA 1JQAA 2XOKA 1NI3A 2JGDA 4GE3A 1G6HA 4EUSA 1VL2A 4N6OA 1YOBA 3R7WA 1JTEA 4IEFB 3PQ6A 3OT1A 1MJ5A 4DQLA 1JUDA 4R5MA 3WHKA 2GB4A 4YMHA 4ZMSA 2JI4A 3TKAA 3V4PB 3K09A 5AM4A 4QU9A 1GO2A 3KJIA 1I50A 1JYSA 1RQ7A 2XUHA 3K6RA 1TQ6A 3MRXA 1U31A 4UXIA 4ZQHA 1XU9A 1VYTA 5K2MA 3U3ZA 4EY3A 4FINA 2QZPA 4TPKA 4ZTUB 2O0HA 5JANA 2I55A 4RPJA 3VTFA 3I9KA 1UJ5A 1XRLA 3A11A 4MARA 3PDUA 1MO3A 4QNRA 4PLFA 1FX0A 1IFXA 4ZYWA 3QXJA 2H5IA 3BIFA 1GEGA 3PITA 4GPD1 4HRAA 3GEGA 2BP7B 3CF0A 2RB4A 5CK4A 4CUZA 3TX6A 4V0ME 1Z9BA 4PS0A 1LY1A 1IHYA 3SXPA 4K9QA 3L3BA 3TQTA 5CDYA 2NO6A 4RTSA 2CXOA 3LP5A 3X2EA 1UPCA 3WBKA 2PUTA 4FHCA 3KB1A 4D3XA 4F85A 2RHWA 2ZYTX 2QYOA 2Q3MA 3L7YA 4WN9B 4UDXX 1YHZA 2EKPA 4N8DA 1WHSA 4HKTA 4M0UA 4UBJA 3WHPA 1XMVA 1SAYA 2X8LA 3IEKA 4RPGA 2KSQA 3HH8A 1F1JA 1NAIA 1NL3A 2ZIZA 3ADDA 2GN2A 1I2ZA 2VBFA 3DEKA 3I53A 5J1TB 5GJVC 1Y37A 3WFJA 5IJ9B 2XQKA 3JYQA 3L0BA 4YJGB 1M0SA 3GNSA 4JZKA 1OXBB 3E48A 1R0BA 5FUXA 4KR0A 3EOZA 3KT0A 5J4LA 4F4IA 1EGQA 3IO5A 3LT0A 4D3FA 3K30A 3PP8A 4TQGA 1L7MA 1IYZA 1NW7A 1VC2A 4G24A 3F8WA 4QE3A 1U2GA 1U9CA 5TV2A 2BDTA 2YUTA 3OTWA 4XAQA 2VJLA 3KEQA 1JIJA 4MCHA 4I3HA 5JYCA 2WOJA 1RVDA 1XWFA 2LR0A 1NVMB 1E7MA 2HRQA 2D2IA 2W6ID 1Y5IA 4P7GA 1Q0RA 2C2MA 2GEUA 4QOSA 5LB2A 4MYSA 1Z2OX 1QNLA 3DVQX 1CBUA 4JXKA 2CCGA 2LUOA 4PNPA 4WXYB 2CK3D 4ARZA 1MV5A 1QH9A 4F3YA 3EXIA 1GQOA 1M2VB 4OQNA 2JH8A 4F4CA 5KOIA 1JQBA 3WQRA 2O54A 4MUGA 2JK1A 3P1JA 1YJAA 5JBNA 2GF2A 3L06A 2COEA 2R97A 2VUMA 3F3YA 4QU0A 2QMUA 4RFLA 4ZYUA 4KIGA 5GJCA 2X42A 4P34A 4LHEA 1UPXA 1W5SA 3KELA 5FEMA 1VQ1A 1DT5A 2ZUDA 4Q00A 4BNIA 4MGZR 4XOIA 3ZE9A 4AO8A 2RJNA 2R6HA 1N7HA 2EJCA 2I33A 3A14A 5BNTA 3WJ2A 3R4VA 3H8JA 2PT9A 4KXUA 4Q9IA 4Y3UA 2YWJA 3MRVA 2POQX 4BV3A 1M1YA 2ODNA 3UKDA 3TW4A 1L8XA 2V96A 3TW8A 1GVHA 2A6HD 1NUUA 2B2NA 1P7YA 3E3AA 5ELMA 3UM9A 4KO2S 4AS1A 4WK2B 1Q7GA 4YRTA 4B2YA 2UZAA 2GZSA 4HRXA 4LAFA 3R0ZA 5IYZA 3PD0A 4JL8A 2HBZA 4HNAA 4YAJA 1B3BA 1BMFD 4DNPA 1YA4A 2IF0A 4FYXA 1U2RA 3VDMA 1K8RA 2P5TB 1A9ZA 3UMCA 3RSFA 1H2BA 2AHRA 5E7IA 5FOSA 5DM70 4B09A 1W1IA 3EGWA 3FMPB 3HLKA 3UCXA 4HL6A 3CZRA 3FRIA 1EP9A 4AJJA 1JHDA 3EK2A 4HN4B 1E0JA 1ZUIA 3CM0A 5FTKA 1AVTA 2VK1A 2XZDA 4K7JA 2PL3A 3H13A 1JEOA 5IK2A 2UYGA 4WD3A 4MJ7A 1DUSA 2QTBA 2VAXA 1RCUA 3B60A 2AXPA 1P61B 3OPVA 4JB3A 5MN5A 1ZMOA 4D8XA 3OTOB 2QSZA 3VYTB 5K0ZA 1YZLA 1E9VA 1KOFA 4GM4A 2O8DB 3LMKA 2O0LA 1OH7A 2A0XA 3IT1A 2C77A 2QM7A 3TPCA 4X60A 1G0OA 1LDBA 3GTPA 2J9RA 1CDOA 3ICQB 2Z2YA 3IOMA 3L5KA 1CUDA 3PUYA 4QOIA 4UVEA 1DDGA 1XHLA 4IIEA 2HWUA 4XIFA 1SCBA 3T0FA 2C0CA 3GRCA 2CNWD 1PJ3A 3PDWA 3LUKA 1Z13A 4NBVA 4YA6A 3VVMA 4FOOA 3L05A 1RLUA 3TTTA 4S1WA 2OWEA 4FFMA 4DYVA 5JQWA 3AQ4A 2FN7A 3OHPA 2CLFB 2E18A 4FS8A 4C2AA 5JVDA 3GA5A 2CC2A 1VMEA 1FUEA 3BWMA 3B1XA 4YUXA 4N41A 4H4DA 4LWOA 3K71B 4ENVA 4B2LA 4QL3A 3E81A 3WTBA 4RQBA 3THWB 3BXZA 3Q7TA 2W6JD 2PV7A 4QATA 2PH1A 2XKKA 2O52A 4FOLA 2IE8A 4XUEA 1PR5A 2AF3C 1HQDA 5EPEA 1CUXA 5B3AA 2EQBA 1JLSA 4LDPA 2P11A 1ZM3A 2BONA 2ZRJA 4UBOA 3S1AB 3QEAZ 3U6BA 4ZVQA 3N5KA 3PUZA 4FC7A 1H3NA 6Q21A 1TT7A 2J6BA 2Q46A 3H0CA 1LW7A 4OQDA 1GR0A 1NLYA 1OMOA 4JCWA 3QK7A 3ADKA 3N2ZB 1U3FA 3RU3A 2BM8A 1OI2A 4FMCF 5LU8A 2UV8A 3A4IA 3H83A 2G5GX 2VAWA 2VZ8A 4LJKA 2W11A 3ILHA 4U8HA 5FWNA 2E89A 2YWEA 1JSCA 4RPKA 2ZI7A 2V5AA 2QK4A 2Q1WA 4BO6A 3P20A 1XRRA 2C3MA 2DE0X 3HP1A 1P2UA 4UCFA 1GUFA 1K5DA 2HB6A 2QTVA 1LXCA 2HSDA 4OJQA 3E84A 4RCZA 1KIMA 4WWHA 3EVAA 4IHKA 4LYYA 1RYYA 4MV0A 4RGVA 2J46A 4WASA 3H2KA 3OP1A 1R9TA 2Q8PA 2QN2A 5JHGB 5EHZA 5AXBA 4NDAA 4L27A 3P2YA 1UBMS 4LHWA 1VCHA 1PQ4A 2P7HA 1JMYA 3BWDD 3RRBA 3UAOA 5AVVA 3Q2IA 3SS8A 3VPHA 2OB1A 3EFHA 2IW1A 3X1JA 4TTTS 3GEEA 3EZLA 1UXHA 2VJOA 1L7OA 3LVRE 4L0CA 4LHXA 2DERA 3F8SA 4XRRA 2B92A 3DXYA 4WVLA 3MM4A 4KMRA 4RLSA 4S04A 1GGFA 1FFYA 1ZN9A 3OQ1A 1G21E 5LVAA 1U2EA 3PXCX 4HOYA 3TTXA 4MDEA 3AKZA 1NVEA 5BO5A 4HX2A 1DV1A 3ADOA 3R77A 4E11A 2MJLA 3MTEA 2BW0A 1TXGA 1RD4A 1K8QA 4NAUA 1MAUA 3RC3A 4AYTA 4DNQA 5HK9A 2N47A 5DV9A 2FKAA 2C7RA 1Y4AE 3HV0A 4PYQA 2Q2OA 2V9CA 4YJFA 3T12A 5B5SA 4G09A 2R8YA 3OIUA 2J9ZB 2D00A 2BKUA 2HWYA 4Y2XA 1F2UB 4U2KA 4MSUA 4LPSA 2VT3A 4I1PA 4R6WA 4GOXA 2Z6QA 3HRKA 4N7RA 3Q3CA 1Z7BA 1LPAB 2OVBA 1VBFA 1QXSA 4ZQBA 1YJXA 4V24A 1JLRA 2MU1A 5BUCA 2UUOA 5H82A 3ELDA 1IK4A 2QLLA 2QBYA 1BD3A 1Y3BE 1FMTA 2QW0X 4OMDA 1RYBA 2VTDA 5EFZA 3OE7D 5HFNA 2XKJE 2GM3A 3KR0A 2QQEA 1VL1A 3CA8A 2G9VA 1HV8A 1MNAA 3VH1A 1FSFA 1PHPA 5FADA 1E3SA 1WX1A 4AULA 5BPHA 4FLEA 3TQRA 2I99A 2ONCA 5JNTA 1KBOA 2J6HA 4OXRA 1CIJA 2VYVD 2HIHA 5HKAA 5AKEA 2QNBA 4J9UE 5GVRA 2ZBEA 4U3JA 4XLTA 4AI6A 1MB2A 4AJLA 1NBWB 5CIWA 3A28A 3KBBA 1KJJA 4KR3A 1IG3A 2BR4A 3N8IA 5K0FA 1C1DB 3CUYA 4NV1A 2QEQA 2GARA 3H16A 1SFOA 2AI3A 3MS4A 5DTMA 3FPLA 4J0KA 1G7TA 4L07A 2QVGA 4KQEA 5MFZA 4YV7A 2H2IA 5B7QA 2BGUA 3EZFA 1ZU4A 4S2UA 1C9JA 1NSYA 4G85A 4UUQA 3VH2A 1LQTA 5CAEA 4HRVA 1XYVA 3O7WA 1Z8NA 2PYDA 2Z6VA 2UYQA 5COAA 4FR0A 2PX8A 3K5PA 1GQRA 1U2QA 2QD5A 2NYUA 2JBWA 4UNRA 2J33A 3EZ2A 3DPIA 1BWQA 4MPTA 2E1PA 1UBRS 4ID3A 1DAKA 1E1RD 4DREA 3L2OB 4Z9AA 2FFAA 1OVMA 4WCVA 1XZ8A 2PKQP 4FQ5A 4LRUA 3FBTA 2HRRA 3HV2A 3IBYA 2OO3A 2XWQA 4BNTA 2A0YA 2JDIA 3OM8A 4B1FA 1KEPA 1E3LA 4D4KA 4LF6B 1U0LA 1Q6ZA 5JS2A 1NN3A 4ECEA 4ISBA 4HEQA 6NULA 1SUEA 5CDFE 2UZIR 3HVKA 5KMGA 1E0AA 3KSUA 2ECFA 5HBGA 1W36B 4HF7A 3D7RA 1FS4A 1RRPA 2H52A 1MV8A 2HY7A 3EBOA 3FFTA 4G5XA 5B3JA 4DV5B 1DCTA 4I1UA 4M0EA 4R1SA 2H8GA 1RXSA 1S96A 2FN4A 4CUJA 1KAGA 2EWMA 3B1WA 1YQWA 1XJWA 1W6UA 2VC2B 1RJEA 5K05A 1ZOOA 2PMKA 3ET5A 3H9JA 3K0FB 3N39C 3VVBA 3ROGA 5CVCA 1YQXA 2YKGA 4OU5A 2IKSA 5KQLA 4I5GA 1N2EA 4GIBA 4NZPA 5EP3A 4B3JA 4R2WA 4JOCA 4KJZA 5DB4A 4ABYA 4GLOA 3M3HA 4JMPA 1ZH6A 3DLAA 1BU5A 3EVFA 4WK0B 4JB2A 1XF1A 2I1VB 3I5XA 4J0CA 2D5LA 4RVSA 2YJ4A 2CN1A 1E1QD 2RIPA 3K8QA 2IHJA 4IS3A 1G3MA 2FP4A 2IU0A 4N5IX 3F7MA 3MUEA 3PGLA 3LNCA 1M72A 1Z4MA 3EGDB 4S24A 4DDVA 2BBSA 3HJRA 2F1RA 3BMQA 3PHBE 5BW4A 4DABA 4YRLA 4S05A 2J48A 1U9YA 1XZEA 3PUKA 2OXIA 2Y2UA 4IHJF 3ZC3A 2VHYA 2PU7A 4QLAA 4RGQA 3AUJB 3OEHD 2JHCA 2NO1A 2QTNA 1E6MA 5KU1A 3MPOA 3WNVA 4NEGA 1XNQB 3PXAA 1WP9A 3CPEA 1HNNA 3DL2A 4MUEA 2QR2A 2VTKA 4QUIA 3BRWA 3NH9A 2AEEA 1TO2E 3UIEA 5JDIC 5DP1A 3RC8A 2PMEA 1QGAA 2ENWA 1BDHA 3LIPA 2HHLA 4JYBA 1V6CA 2FUG6 1N7JA 3V4FA 3IEMA 1A5TA 1WSBA 1N4DA 2RI1A 2V59A 3FHCB 4PIVA 4PZCA 4QELA 2VQFB 4QNNA 2O3UA 3Q3VA 4HGOA 3A3YA 1JA9A 3N7UA 1YVDA 3UO8B 1C0IA 4W5OA 4TRRA 2YUIA 1TM3E 2HHHB 3PWTA 3VKWA 4LQLA 3SEFA 3A0RB 2AEMA 4Y2UA 3VPDA 2RFLA 2XT6A 4G1FA 3OCYA 3MINA 3U62A 4YR9A 3QE9Y 2CHUA 1JA1A 3V1YA 3EX7C 4CEHB 4BU1A 2XUKA 4KMOA 2BEUA 2PWAA 2I7XA 4E4YA 1K6JA 4MV5A 1XCOA 5GV8A 2OILA 2YWXA 2Q3HA 1L5MA 1EFTA 1NNUA 2KE5A 1GA6A 2QMEA 3EG9A 5KYTA 3KV3O 5HK8A 5JSQA 5FBHA 3E0XA 3O8OA 6REQB 2WU3A 2R751 1LK5A 4KWEA 5BQOA 1DL5A 1USIA 3DL4A 4AS3A 4BLVA 2ZIUB 2FVYA 3USES 4L0MA 3TLJA 2I71A 4FJ2A 3Q4GA 4CG0A 5DLDA 3B9RA 2Z4TA 3LM8A 3OT5A 2NP6A 5G40A 2QPOA 5GLXA 1R8QA 3DAPA 3NATA 5LQSA 5NLLA 1Z34A 2Q29A 3KDAA 1FPMA 4LDAA 1C8KA 2JFVA 2GVNA 3AEZA 3B20A 1BQ3A 3H17A 2E0IA 3II6X 4CM4A 4FBGA 1JVNA 2AXEA 3COPA 4X6YA 1JPJA 3B12A 2X9GA 3GJ7A 3MBKA 5DNDA 3CJQA 3DDNA 1PAUA 4ZO7A 3B2QA 3HK2A 4ZQFA 3LT1A 5FOTA 2H4JA 1IZ9A 4BBPA 4KX3A 1U81A 1E8DA 3G79A 4PZYA 1AA9A 4X8HA 4QNMA 2GPWA 5EXPA 3RROA 3OE4A 1DARA 1GGNA 4IAOA 2AFHE 4MR9B 4RDHA 4ROSA 1X3SA 5BSMA 4BZPA 1XZQA 1RYMA 2HDWA 3L0ZA 4CDMA 4D9KA 5JV5A 2HJVA 3H87A 3EQ9A 4O2LA 2PJUA 4PC7A 5H68A 4RFVA 1ZUHA 3D4BA 2KBFA 2PT6A 2X3YA 3SUJA 1QV9A 1W59A 3MWEA 3UFXA 2CJFA 5DHAA 4C7VA 1JJIA 1RBMA 3FPKA 1VKOA 2JD1A 5JAUA 2ZBRA 4WK6A 4ZT6A 1JIXA 1VBKA 5K8TA 3DDHA 1IQPA 5JXIA 3A1TA 2X0NA 2CMHA 2NVXA 2JDID 2W0MA 2NXEA 4KGZA 4YJ3F 1G8SA 7YASA 1T26A 2R1TB 4FJ1A 1O97D 5FHQA 4AF8A 3F9RA 1DDIA 4YAIA 2ZSBA 4ZZ2A 4IKOA 1B7GO 1GILA 3A3NA 4P2GA 4FJ0A 1G9XA 1DG1G 2EWVA 2GHRA 2EJVA 2GBPA 4RLFA 2AF4C 3ZDCA 2WMYA 3ZWQA 1ZM7A 4LECA 5SZHB 2REBA 2RHTA 4DEVA 3E35A 1CEQA 3HCOA 2ANCA 1JMKC 1XK7A 3H2BA 5F73A 3T4EA 1HSZA 1TZMA 3NIGB 1BW4A 1D3AA 1EB8A 3L0PA 2ZVPX 5LU9A 3GK3A 2DPXA 3LP8A 3QELA 3B53X 2UYHA 1EAYA 4JS7A 4YLGA 4OKNA 1VCMA 3EY4A 3PPXA 4XGRA 3CIOA 3D5TA 3UYKA 2GZHA 3W8NA 3ZY3A 1EK6A 3TZBA 4D9BA 1QRSA 3C3JA 1I2CA 2AMVA 1YI8A 3AHFA 3MT8A 4O02B 4U6SA 5FNVF 3BXXA 4C30A 4AN4A 3ZUPA 3GJXC 4GLLA 1CX9B 4DMCA 4YPOA 5T64A 1M0WA 1QUFA 1ZCFA 2GYWA 4TYPA 3VX3A 1C4KA 2XUGA 1EBBA 2BGMA 1BEUB 3AF0A 3LUHA 3Q2OA