1H0HA

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 369
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
369
sequence length
977
structure length
977
Chain Sequence
ATMALKTVDAKQTTSVCCYCSVGCGLIVHTDKKTNRAINVEGDPDHPINEGSLCAKGASTWQLAENERRPANPLYRAPGSDQWEEKSWDWMLDTIAERVAKTREATFVTKNAKGQVVNRCDGIASVGSAAMDNEECWIYQAWLRSLGLFYIEHQARIUHSATVAALAESYGRGAMTNHWIDLKNSDVILMMGSNPAENHPISFKWVMRAKDKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIAFLNGMTKYILEKELYFKDYVVNYTNASFIVGEGFAFEEGLFAGYNKETRKYDKSKWGFERDENGNPKRDETLKHPRCVFQIMKKHYERYDLDKISAICGTPKELILKVYDAYCATGKPDKAGTIMYAMGWTQHTVGVQNIRAMSINQLLLGNIGVAGGGVNALRGEANVQGSTDHGLLMHIYPGYLGTARASIPTYEEYTKKFTPVSKDPQSANWWSNFPKYSASYIKSMWPDADLNEAYGYLPKGEDGKDYSWLTLFDDMFQGKIKGFFAWGQNPACSGANSNKTREALTKLDWMVNVNIFDNETGSFWRGPDMDPKKIKTEVFFLPCAVAIEKEGSISNSGRWMQWRYVGPEPRKNAIPDGDLIVELAKRVQKLLAKTPGKLAAPVTKLKTDYWVNDHGHFDPHKIAKLINGFALKDFKVGDVEYKAGQQIATFGHLQADGSTTSGCWIYTGSYTEKGNMAARRDKTQTDMQAKIGLYPGWTWAWPVNRRIIYNRASVDLNGKPYAPEKAVVEWNAAEKKWVGDVPDGPWPPQADKEKGKRAFIMKPEGYAYLYGPGREDGPLPEYYEPMECPVIEHPFSKTLHNPTALHFATEEKAVCDPRYPFICSTYRVTEHWQTGLMTRNTPWLLEAEPQMFCEMSEELATLRGIKNGDKVILESVRGKLWAKAIITKRIKPFAIQGQQVHMVGIPWHYGWSFPKNGGDAANILTPSVGNPNTGIPETKAFMVNVTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
total genus 369
structure length 977
sequence length 977
chains with identical sequence K
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1h0hA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h0hA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1h0hA03
1PYQA 1Y1VA 4KDLA 3TIWA 1CZ5A 3GTPA 3HU3A 4KLNA 3FKIA 3HKZA 2R7ZA 3GTLA 1PYUB 2VPWA 4AZDA 2Y0SA 3HU2A 3O5AA 1KQGA 4GA6A 5C18A 1DMRA 1Q16A 1YLEA 1E60A 2R92A 3IR7A 1EU1A 3OUGA 5T5MD 1TWGA 2JA6A 3GTOA 2PMZA 1CR5A 1WLFA 3GTKA 1R27A 1FDIA 1H5NA 1E61A 1AW8B 1IW7D 1KQFA 1SFOA 3HU1A 4DMRA 3GTJA 5DYIA 3GTQA 2DMRA 1SIWA 2B63A 1TWHA 2VPXA 5B6CA 1E32A 2KI8A 2IV2X 3PLXB 4AYBA 2YU9A 5DYGA 1G8KA 1UHEA 1S3SA 3GTMA 1TMOA 3DMRA 1PQHA 1DMSA 2NVYA 4KO8A 1Y4ZA 1QDNA 2VUMA 1PT1A 2EEOB 5FTNA 4GA5A 4KDIA 4C2MA 4KODA 4CS0A 1E5VA 2R93A 5FTLA 5GLFA 1Y1WA 2NAPA 1K83A 1PPYA 1QCSA 3QQ8A 2VPZA 2E2IA 3ML1A 2JIRA 4CRYG 2E2HA 3QC8A 2JIQA 3QWZA 1WCMA 1R7RA 2JIPA 3H0GA 5EPPA 2JIOA 1OGYA 2V3VA 5T5ID 2E7ZA 5FTMA 1R9TA 4RV0A 1PQFA 1TWFA 4QIWA 4CRZA 5FTJA 3IR5A 1PQEA 4AAYA 3CF2A 1PT0A 1I3QA 5C1BA 2JA7A 1H0HA 1TWAA 2VPYA 3IR6A 2NVXA 2V45A 1FDOA 2PJHB 3CQZA 2WB1A 1TWCA 3GTGA 1VC3B 1Y5IA 2IVFA 1G8JA 2JA5A 2C45A 2NYAA 2WAQA 4AONB 3QQ7A 4D7ZB 5FTKA 1UHDA 4AOKB 1AA6A 3TM7B 1E18A 1CZ4A 2JIMA 1I50A
chains in the Genus database with same CATH superfamily
3QW4B 1P5FA 1FU4A 3B8EA 2I4TA 3SC6A 2HLPA 1O6ZA 4KQGA 4G2NA 1DPGA 4IFIA 2R8PA 2YNMD 1CR4A 1A82A 3H1BA 5CDUA 1I9CA 1YZVA 3OJXA 1UBJS 4FXOA 4HN9A 1QRRA 2ZI7A 4OHBA 4QECA 1ZC4A 1GAEO 2GFHA 1E4VA 4PVCA 3T0FA 4LIPD 1RRMA 1I3OA 5C18A 5LUBA 3H42B 1KS9A 1YCDA 1R15A 1MABB 1BSVA 2FPKA 3IVRA 3C85A 1PNQA 5KB3A 3GJ0A 3IR7A 5JS7A 3LO5A 2DECA 4ABYA 1YI0A 3VR5D 3WK5A 4BBZA 4RJJA 1TNDA 4ZCIA 3WJ1A 3V4ZA 2N1BA 3C7TA 2QU8A 3PKIA 3ESDA 4ZMRA 5ARBA 1VTKA 1AW8B 3OIDA 4BB5A 2ZR0A 3NNNA 4IJQA 4HAYA 5E6SA 5TQ0B 1MIHA 4FZVA 4G1CA 5LKAA 3LCCA 4MJ3A 3BSFA 4PX9A 2VDOB 4ZT2A 1QIHA 2ZVJA 5L45A 1BXGA 1KZ7B 3IUYA 5ENZA 2VZ9A 4HVTA 2QY6A 3BICA 1L8QA 2H4JA 3RYHA 4B7XA 4C7XA 1OU4A 3GJRA 3TAXA 3ZDDA 4IFEA 5A4KA 3VU0A 2W0SA 2Y1WA 3EOBI 3KXDA 3QHPA 4QJ3A 1BKDR 4KQHA 1P2FA 4PLZA 3CH4B 4ZQHA 1SKYE 1S0UA 4HGZA 3ST7A 3HU5A 3KXKA 5FCDA 2FP4B 1C0IA 2A5FA 5JR3A 2QY9A 4PLFA 3Q3IA 2UZ1B 2D1SA 1KVTA 1TECE 2IF0A 2YHAA 1L0BA 3KUCA 5ALXA 5BSTA 2JI8A 3AVOA 4BX2A 3D0RA 3DEKA 1I8TA 3IDSA 2EFCB 4GOXA 1WF3A 3CNNA 1Q2XA 3CVVA 1CE8A 1WQ1R 2CL7X 5HFAA 1XDDA 3PA8A 1N4DA 1QK5A 2YFQA 3I9JA 4KDCA 4RMIA 4ZI7B 3SXPA 2IE8A 4LFBB 1JJVA 2WD7A 3PVCA 4EPXA 3W8EA 3G1WA 5IT4A 3P2JA 1ESDA 4WFKA 3RDPA 3AWIA 1ZD3A 1QU2A 3M82A 3QWIA 3HB9A 1M66A 1GPJA 1UJ4A 2ECOA 4JCOA 1D6SA 3OCVA 3LQQA 4KMOA 3Q8WA 3TCNA 1JWAB 3BK1A 3KWLA 5HTKA 3V8VA 1B74A 3DJFA 3MBOA 3ZZMA 3OIYA 2ZCJA 2AMLA 2BE5D 6ABPA 1SQ5A 3M34A 3GLIE 1I10A 3FAKA 2Z1MA 3N58A 5IXSA 1EHIA 1FUKA 3RUAA 5P21A 1IOLA 2W6ZA 1NNLA 2JH3A 2XWBF 3I28A 1AB5A 1CR0A 3K0KA 4M8NE 4XZ3A 1I4DD 3R3UA 5GWXA 1DTSA 5HCUA 1Q0LA 4P6VF 3VZDA 4LVNA 2JD1A 1UK6A 1EP9A 1D09A 1PJZA 3E58A 5DULA 1UBEA 1XK7A 2J08A 2R9VA 4JT2A 5LYJF 4DCGA 4MW1A 3S99A 3RRBA 2CV0A 4BFLA 1BVHA 5BMVB 6AT1A 1IUOA 2A6ED 5FAKA 4UD2A 4DCSA 5JYBA 3K6SB 4F9EA 1YFLA 2GNPA 3ZNNA 2BF7A 2H2GA 3HJHA 4F56A 1W7AA 2X22A 2PUDA 3QVGB 1NMSA 2AI2A 2M9MA 2E4VA 5AD1A 2CZCA 4U6SA 3CVXA 2EVWX 5DEOA 4P4TA 5FL7D 3SMVA 1OCEA 2IXEA 1GSAA 1E2PA 1RLMA 3TM4A 3ZJ5A 1BGXT 1GUAA 4A0SA 4BX9A 5HX7A 1XCPA 1AMOA 2NMVA 3U3KA 1LPMA 1NN5A 2NU7A 3JYHA 5K8JB 2AT1A 4GM4A 4YAGA 2MSLA 4J8PA 5FB3A 4CI9A 4TLAA 4RA9A 5K8UA 1ILWA 1R8QA 3G2PA 4LRYA 1SM4A 1KOJA 5AUPB 4ZJUA 1JHDA 1JYSA 3E5RA 3H7IA 2R92A 2D3WA 3SG0A 2IKQA 1NMQA 1OJLA 4IIXA 4ZC1A 3OTQA 2XKKA 1Y1RA 5L3RA 4PGGA 4DY6A 2WMOB 2C5LA 1N6NA 4X7MA 4D98A 2J3DA 5JS2A 4DUGD 3Q10A 3WADA 1P1IA 3ZWQA 5JWRA 2OQRA 1GFIA 1M8GA 3C6BA 3OE7D 4OHCA 3ZGZA 4FP9A 3VHXB 1OXUA 3GI1A 3A4MA 4I19A 3UK1A 1DV1A 3NHWA 5GM9A 4HWRA 5HYVA 4B6OA 1UC9A 2AF4C 2AN4A 2FOLA 1KEEB 2AEJA 2J0UB 3NBXX 4LYDA 5K6RA 1E96A 3VR6A 4Z0NA 4Q6WA 2J3LA 1U3VA 1KU0A 1C30A 2KI8A 1CF2O 1WJGA 4PICA 5F2OA 5IEJA 3SVLA 4YTEA 3QV1A 5A3JA 5ALNA 5C1OA 3OHSX 5LCXA 1TMOA 4H6WA 2OAEA 3GFQA 2JRCA 1UKVY 1WKCA 1C7QA 4AY6A 1SXJA 4YP9A 1XNGA 3L8FA 4KXXA 1P4RA 3NH9A 3T5CA 1A5AB 1BS1A 2GCIA 5G1OA 1NBAA 2XNJA 4JYPA 3Q9NA 2NW6A 1WXDA 4KO2S 1QQAA 1AX9A 2IUUA 1MZVA 1Y1WA 5BR1A 1R3UA 2OFXA 1HNXB 1JHMA 3R7WA 1TAUA 3K0AA 3B1WA 5IKPA 4OHKA 4PFSA 2BHTA 2DZDA 2HF7A 4I5IA 5DYYA 5GQSA 4OHUA 5BWBA 1GEEA 1E6CA 3I2IA 3ISVA 4MLDA 4MQMA 4OLHA 1GTVA 1WDKA 4PSCA 4HQNA 4YPFA 1I4EB 3OQVA 3LGAA 4J0EA 4C78A 2JAXA 2Z5VA 4LTNA 1UPXA 3TPCA 5FI0B 5FV4A 2P9GA 3L0OA 3O8LA 5HCNA 3X2IA 5JYCA 1QR6A 2IHBA 1PWXA 3ZU4A 4YI5A 3G0DA 1GLNA 5KSOA 2V7WA 1YJXA 1J56A 2RHDA 1R0YA 4M8KA 4RDHA 3OPVA 4GD3Q 1QP7A 1B42A 1AN9A 3CQZA 3M3HA 4MW9A 1GPKA 4XVHA 1Y0BA 3A05A 3AUSA 3QEMB 3ZCRA 3CVUA 1ACMA 3HN2A 2IZ1A 2C45A 3EIOA 5KVQA 3AR8A 1GZ7A 1SQSA 1R50A 2LD4A 5FI5A 3RC7A 1AU9A 2WHPB 4MOWA 1KJWA 3MGGA 3NVMB 1CRWG 1XZNA 3GEIA 2CVPA 3IHLA 1E64A 4G85A 4Q16A 1HR0B 3CJQA 3KEFA 2XBMA 2BEUB 2PCLA 2XTZA 3BGSA 1E3JA 4DV2B 2YY5A 3C98A 3D5TA 2V5AA 4E5KA 5A04A 3GNQA 4OPMA 1A4IA 2PT7A 3CXRA 4YCJA 4C7VA 1Y63A 4HDKB 3LP6A 4YJ2B 3TE6A 4CQJA 1YOVA 2GYUA 1F2UA 3LQFA 1N8TA 1XZFA 1UODA 1GYQA 1Q7CA 2GSWA 2DH5A 2WKPA 1KXJA 2GPTA 2QRLA 4UU8A 1CZUA 2AXEA 4XX0A 1A3CA 1IPEA 1KAEA 5B3AA 3V46A 3U0VA 4CV0A 4NFYA 3LDGA 2WPDA 4JQCA 1CNMA 5ESXA 5AVRA 1SWVA 1R27A 1JFSA 2IHKA 1QGDA 5F9FA 1WM1A 2ZIVB 5AXCA 3UG6A 1Q21A 4MR8A 5HZKA 1QIMA 1CZOA 4LWOA 1HF3A 1SXHA 4HQLA 5AW8A 1T1RA 1SCUA 3O2SB 4EUEA 5TPWB 4DMRA 4JBLA 3F8WA 5D8DA 3UJDA 1V7CA 2BFDB 1Z33A 4DSUA 2BONA 1T0UA 4XFDA 1HPLA 1KYQA 5K2MA 2G8NA 3KR9A 2CJPA 4EUSA 3ON5A 4PINA 2GN2A 1IHOA 1CJKC 1GAJA 1L5MA 3NHBA 3MYYA 4Z5XA 2GM3A 1C5KA 5JSYA 2AWNA 3BFPA 1CS0B 4CDNA 1G8KA 1O4VA 3WNZA 4EQ6B 1V3UA 4U2EA 3HKCB 5ARCA 1K97A 3VR1A 4BLWA 2Q21A 4H7PA 3UWPA 3H6HA 2VSFA 1NXTA 2XHZA 2Y0EA 3Q7QA 3FN4A 5EMJA 3ORRA 4L6AA 4P31A 1C3LA 1E5VA 1HSZA 5ALTA 4Q4CA 5I7VA 2I2BA 5FWXB 4XQEA 5K1ZA 4CEIB 4MDFA 3PC8A 3EUFA 4B7ZA 2Q4RA 3MAJA 2B4TO 4CFYA 2CFTA 5JQGF 2QX4A 4ZVPA 1SVLA 4XB2A 1EVQA 3VYWA 3CW2A 1OFHA 3S27A 1YS7A 3SYMA 1SD5A 2A6HD 2G5PA 2WR8A 5AI9A 4D97A 4F97A 1IE3A 2P2CA 3KT8A 1EDBA 1IVYA 3DG9A 3P4XA 4S1VA 4RNCA 3VMMA 2D0IA 1XD9A 3AYXB 3HYCA 4FJ2A 1Z34A 4QIWA 2C1EA 3IT0A 3ANYB 1PQEA 2REOA 3I64A 1KI7A 2WWVD 2B36A 3K7EA 4OBWA 3C6YA 1GCIA 1A5BB 2W4MA 2X1MA 3DB2A 3DB1A 4G8BA 5AXBA 4YGYA 4IJ5A 1JR3D 3N2KA 2V45A 2W2KB 2PK3A 4ZPXA 5BRNA 3RKRA 4UQPA 2NWQA 3E5MA 1HYGA 3F6PA 3BXHA 3GA7A 4R1OA 4K03A 3OQIA 4PLCA 3NUZA 3I9LA 3IURA 4CQMD 3PJFA 3DMTA 3RUIA 2GFIA 2WJHA 2FA9A 2ZRFA 3BJZA 3V1UA 1UWCA 1R5BA 2NSDA 3BFXA 1PBTA 3B2QA 5IT9A 3LC7O 3SOPA 2VOEA 2IDJA 2C03A 3LT4A 1C1YA 4JI0B 4WNCA 1W30A 2HQSA 2C4NA 1UT8A 3DL4A 5JSHA 5LN1A 1QNFA 4BMZA 1X86B 4GIBA 2H2IA 3DP7A 3SM9A 1GZ3A 1QQ6A 2W6ID 4RORA 3REQB 1WD7A 2X3FA 3C6XA 4QGHA 2NO9A 4C7BA 4NBRA 1A9PA 1LJUA 1YHNA 3K92A 4G5HA 4NPCA 1QHEA 4GR4A 3KZVA 1LPOA 2P8JA 3MFQA 3R1IA 2PO5A 3BERA 5AIAA 3J7TA 2HB6A 1KZHA 1N6KA 5A6SA 1ZVMA 3DHNA 3HJTA 1LK5A 3A6EA 3RIMA 4PLHA 2W6MA 5BRJA 6REQB 1IEVA 3DKIA 4P4LA 4A26A 3EHEA 4LTMA 3TOSA 4O4JF 4C0KA 2G8LA 2UXBB 3KD2A 1XZQA 3A04A 3V1YA 4DCMA 3SR0A 5LBIA 3KJZA 5J40A 2PJRA 2AUNA 1EFKA 4PANA 1JU9A 4KWIA 1L8LA 3S1AB 3TRIA 1OWNA 5BV8A 1ZYRD 4KXLA 2J3EA 4IG9A 4D46A 3NKLA 1UBCA 2O2EA 4ZOQI 3CFYA 2VPXA 3C1UA 4TV8A 1U1CA 2OHJA 4KN9S 1K5GA 1X1BA 2MTBA 2R1TB 3UMRA 1Z2NX 5I8PA 4KE8A 4UXHA 2D2XA 4UXIA 1I3NA 2CJFA 4WGFA 3C3WA 3MVEA 1D2CA 3GO4A 4Z0TA 1C1XA 2AQHA 2PGXA 3GH1A 1RXYA 1CJTC 4TT3D 4ZV4A 4DQKA 4IIJB 1UKBA 5FTNA 3H16A 1XAIA 4Y2GA 4AJ9A 4MWBA 4QDTA 2YXBA 3TOVA 2CYBA 4KB5A 4OTZA 5H4HA 1BKSB 3JTEA 2J0QA 4ES6A 3FYCA 3NR2A 1QGUB 3DGEC 4GE3A 4P83A 4YP1A 4MKHA 2MYTA 3PGJA 3ZGYA 1Z13A 2FR8C 4B0OA 1LB1B 2XPCA 4GKAA 3DOIA 4NARA 4YP7A 4R2MA 3KZXA 3I62A 3V6LA 3JQ9C 4HT3B 5J59A 4GGMX 1WMDA 1VL8A 3PCTA 3L7LA 4L22A 3E22B 4I9UA 2YWHA 1P0PA 1TM7E 3E7XA 3TDKA 3X2OA 3HGTA 3V7WA 4C3ZA 3QNWA 1QVRA 3TLMA 1O03A 4ENTA 8ATCA 3QKSB 1Q77A 2OSVA 4MGEA 1KP2A 1GV0A 1EM8A 4HS4A 2GB4A 2NO4A 2XMPA 2DUMA 3EMVA 3RS2A 1G4UR 1TQ6A 3RT7A 4OB8A 3ZDFA 4YJ3B 3G7NA 3GLGB 4CRZA 3CS3A 1EUZA 1J23A 4KAXA 2B69A 2JA7A 3MCZA 1YA4A 3N8IA 3TGWA 4OH1A 3PI6A 3CH5A 3H65A 4H0FA 4OO3A 3ZD8A 1LI5A 3CRW1 1M6VB 2I3BA 4OAPA 4OJYA 2B5OA 3C8HA 4XW2A 2BR5A 4LZWA 2C4UA 4R7GA 3USZA 5FH9A 1NF2A 5T8KA 5AW5A 5TJ9A 3JATA 4H4CA 2XYRA 3B3GA 3L46A 4WCFC 4D7ZB 2DR3A 4UEQA 1UHDA 3F2IA 1U9YA 3E0XA 3A7DA 1W5EA 3VU3A 4CLRA 2NZYA 4JBYA 1DRVA 3B36A 4Y9RA 1WZUA 4MQ4A 3LCMA 3SQMA 2JCGA 4CMKA 2OQ2A 2Z1NA 1SZDA 1TYCA 2C9MA 2QZJA 4PYOA 4CMEC 4W1RA 3TE7A 2GPSA 4J7XA 4TQAA 1QGAA 4FWTA 1D2AA 3IIMA 2VWQA 3E9EA 3RVDA 1K8XB 1W2GA 2HADA 3HCRA 3OF5A 3INRA 1KQGA 4US0R 4GA6A 1XZEA 3BD8A 3SQWA 1JUDA 2E85A 3DLPX 3HABA 4FFPA 1W25A 3ETLA 3FNGA 4FYXA 3ZJUA 3PGXA 1GCGA 4RMNA 3O95A 3BMNA 4QATA 4MGHA 2AFIE 1UCFA 1OWOA 1W46A 2AQIA 2H1IA 2VWHA 4CKZA 5JS1A 1P60A 2PUEA 1W0KD 3B20A 3RLFA 1TJPB 4U5XA 5A5EA 3RJZA 2XI4A 5HGXA 1QP8A 4US1R 2BFWA 1P9WA 2XUJA 1KJNA 1WNFA 2OHOA 3KEGA 1NVBA 3VNBA 4J49A 4DQLA 4N5LA 3NOQA 5EZ5A 1IL0A 3B6KA 4DRZA 1T3SA 1RAIA 1FP1D 1GZUA 1FVXA 4OBEA 3P8ZA 1SCQA 5IC4A 3HYNA 5C4MA 4X1YB 3PSAA 3C0KA 3JQBC 2V3CC 2B8TA 3T4XA 4GX0A 1XTBA 3L01A 1Z22A 2H1VA 4B2LA 1D9ZA 3W04A 4OMFG 4DLLA 1S02A 2QRUA 3I2GA 4OXIA 5J58A 1LBHA 5FOXA 2DPHA 3V32A 3DMRA 2GUGA 5EN4A 5CITA 1Z4JA 2VJBA 3HEAA 6LDHA 3OQJA 1JTEA 1GT6A 3CZAA 1XXLA 3DC2A 3DNMA 1YQ9A 2QZ9A 3X1ZA 1YU9A 1CUGA 4QWMA 2NTNA 4HAVA 3CZCA 3CF4A 1PPYA 3UUEA 4WLOA 1O94C 3IQDB 3B70A 4P4NA 3KZ1E 1N9ZA 1FQWA 1IEQA 1FNDA 3AQ4A 3I45A 4RDXA 2PZMA 2ZYWX 4Q9AA 2CUNA 2R8EA 3CKMA 3H0CA 4HGYA 1RC0A 1MCZA 1T34A 2EC5A 2QTVA 1NSTA 1UXHA 1TZCA 1F2TA 1T5TA 4F21A 1TKCA 1X80B 4ETMA 4HB4A 4EDHA 1ZJWA 2NQ8A 3FTNA 4BBJA 1YRQA 1DJLA 1C0EA 1QZXA 2JD0A 1IWOA 3B1VA 3GJ4A 4P5DA 4OI1A 2OQVA 4ALMA 1DJQA 3IDOA 3CX7A 5JJIA 1Y3BE 2KBEA 1FB5A 2FW7A 3FMGA 4Q7QA 3N8GA 5IG2A 4L2IB 5LZ9A 5IVDA 3QE9Y 1VJ5A 1CJSA 3KQSA 2R4TA 5J43A 4PG7A 4DB2A 1XRNA 3DD5A 3KZOA 4C1BA 4YQFA 5DIFA 5BWOA 3TKLA 1I7DA 3NBUA 3ZI4A 4NE7A 3VYRB 3EODA 3FPCA 4JAVC 3ZE9A 4DA6A 3JTMA 2IVFA 4MTLA 2VXOA 4EX6A 1JJBA 2OLKA 4RELA 2XZLA 3FTQA 3W6PA 1BYIA 2ZQYA 2H11A 1VFNA 3LW8A 1G291 4OP2A 4YQYA 3F4BA 3U62A 4IXWA 2GN6A 4YREA 4LV5B 1T5OA 1KORA 2EGGA 2MU1A 3IBFA 4QYXA 4J4TA 2G80A 3AM5A 5K51A 4M7OA 2IK8A 2VZ8A 2BFCA 4ER0A 4HB2A 2JATA 1ZDMA 2ZSDA 2P5YA 2R8OA 3HE3A 1W88B 2G88A 4BFTA 5GONF 1PR3A 4K2HA 3FNQA 2I7DA 2CYCA 3P0EA 4QOJA 2FE1A 1P0QA 1WUYA 2UYOA 1F17A 2A1UA 2V55B 3FI9A 3LUGA 5BSGA 1M1YA 2OUIA 2GLUA 1LQUA 4AMBA 4FHFA 4BVAA 2QUAA 3GIDA 5J2UA 2WYIA 3NHSA 1UANA 2JCVA 1X6VA 1UR5A 4HBZA 2HBRA 3K6RA 4Q4LA 3URKA 1W4LA 4ND8B 3WWOA 3AR5A 2XB8A 4LOHA 4P0TA 1DSSG 4DYDA 2UYYA 2WWYA 2DSTA 2DTEA 1FW8A 1OV4A 1Q7RA 1H9AA 3B3QA 5CHYA 5G0TA 1ENOA 1GPYA 2I2WA 5TGZA 4XVRA 3UATA 4D80A 1Q22A 3G85A 3L1VA 2H6EA 1UBUS 3EZXA 1WHSB 3AEQA 2XUKA 4D1YA 1M2EA 1Z62A 3GFTA 4WIAA 1VZ2A 1RCUA 3OWHA 1UMDB 1J99A 2W8BA 2QI9C 2WZCA 4INZA 3FOBA 4KBFA 1XC7A 2J5QA 2B4QA 4N03A 2LDBA 1JTFA 2B63A 2FV8A 2C5HA 1XMSA 3G0BA 4DBVO 4BFZA 1VXRA 4MUGA 2NUPB 3LQ2A 3BDAA 1DQPA 1O6FA 1M1NB 1GQFA 3JAWA 4KOAA 5LP6C 4N9QA 3VFDA 4HEA1 1VECA 2AEEA 3O94A 3OFSA 5HKKA 3SHFA 5JDCC 5C35A 2GCOB 1P0IA 3E1KA 1IM8A 1WAMA 3H1TA 5DLDA 1LFDB 5BSVA 3ABRB 3MLBA 4P3YA 2TMDA 3FF1A 5K3FA 1I5OA 1G9TA 1HQCA 4MRVA 5A7HA 4EUHA 1OH7A 2EGUA 2J9RA 1Z06A 4BBAA 3MN1A 4LZLA 4MVJF 3TK1A 4BE9A 4YFYA 1Y4SA 2HPVA 2FR1A 4GM1A 3T5DA 4DLTA 1P4SA 1VJTA 2OMKA 2QD4A 2ZJ8A 3O9VA 4IIYA 1VYUA 2OO5A 2WWRA 3DKPA 3UXHA 1HDXA 4EUFA 4RBNA 4LSGA 2OP1A 3RHZA 1HWYA 3EH1A 3JAKA 1Y4AE 1HYBA 2WAYA 2MHCA 3UB2A 1Q1QA 3C6QA 4EYEA 4HFJA 1M76A 3U9SA 1V3TA 2RGNA 3WZMA 1U4NA 1V5WA 1HDEA 1M7BA 2FF5A 5C9ZA 1ZRHA 5T5ID 2PLWA 3N3BC 3F8TA 3U4DA 1F0PA 1J0BA 2F3PA 2OGZA 3FY4A 2C5FA 1Y3CE 3E35A 1ZN9A 3D8HA 5F1OA 2P9ZA 2RBKA 5B2FA 4EJSB 1NAHA 4KEAA 4M1YA 2EHJA 3U80A 5J3JA 4FZJA 1MFPA 3EVGA 1K7EB 3LDUA 3TXAA 5I7FA 3H8SA 3WK4A 1W5AA 5D5PA 3A1NA 3EAGA 3PNKA 3OCJA 1SPXA 1BWPA 4YDRA 1HZZA 4GQIA 3D6AA 3TZEA 2PCJA 3HLKA 4ZI3A 3IDQA 3QW2A 4J6FA 1L5LA 4R84A 2BFFA 4FYYA 1A2QA 1AGPA 1JEQA 4EB0A 4ENRA 2PHZA 4Z6KA 3EQZA 3CUKA 3H5TA 2A1TS 5C52B 5I51A 4PAQA 1VL5A 4D9IA 3I9MA 3KQUA 1INLA 1UOOA 2ZUTA 1G8PA 3RWOA 5LZ7A 5IBPA 2BFOA 4DNQA 1XZBA 3OEYA 2ZUFA 4AVYA 1JEAA 2FPGB 3B9PA 3KB6A 4V02A 4WZAA 3SF8A 1AMNA 2QROA 1WZIA 3GRKA 3NFRA 1ORTA 1TO1E 3IHWA 4HRXA 5BY2A 1NN1A 1DMRA 2EKQA 2G77B 4JZYA 4N3BA 4F1WA 1NTOA 3F9RA 5MFZA 2VP4A 3L7KA 2XQVA 3BILA 1XDUA 3EMDA 1I4OA 1NKVA 1VG0B 4MJ7A 2I0FA 2VCYA 4ZJZA 1GL3A 3KKNA 4LBZA 4BMDA 1XMQB 1OZ0A 3L84A 1E20A 1NI4A 2DH6A 2R5NA 1Z73A 3H2JA 3M83A 1KAHA 4JVMA 4B9AA 1XP8A 2DE0X 2YIMA 4QXOA 3WB9A 3O9MA 2NTEA 5LYJA 3T5PA 4QGAA 2I99A 5KNCD 2FMTA 3T41A 2O6LA 4O4IF 2Y6VA 3UT0A 3IAHA 1R6BX 3AT1A 1JG4A 3ZI7A 4OFBA 3G0IA 3D4IA 3K4QA 1SUBA 3STXA 3TW0A 4YDSA 1BXGB 1OWPA 1THGA 2FW6A 3A27A 2GD6A 4MKGA 4OQ4A 5AM1A 3RYHB 3TSAA 1CS4C 1L6RA 4ND7A 3MT0A 1I4TD 4O4HA 5JDIC 3NDPA 2J5KA 2AX4A 3ME5A 3PD1A 4G23A 1Z35A 1XTIA 2VNSA 3IV6A 4BZXA 1NP3A 3W5JA 5KSWB 3BCUA 3HSKA 5CM8B 2J8ZA 4IH9A 2VF4X 1Y1QA 2IYEA 2CNDA 3FPEA 3D3KA 1VBFA 5IDYA 1S7CA 2OYCA 5DNYB 4AUMA 4Z7NB 4ZN6A 2QZSA 1D0SA 2LV8A 4N8DA 2LR0A 3WGOA 2F2TA 4EL5A 1G4HA 1KMNA 2D59A 3O0DA 5IK2D 1CE8B 2D5AA 2WIDA 4ETNA 2ZBQA 3BHJA 3DYVA 1SKAA 5CAEA 1XSEA 4W5RA 2DXIA 1Q1AA 1DFIA 1UAGA 2WD7B 4BQSA 3OPMA 4CG2A 3OF3A 2XD9A 3EIEA 5JROA 3WV4A 2ID8A 2X0IA 4E5VA 1I33A 1X7WB 5IVKA 1WRBA 3W5BA 4R71A 2QTGA 4OQMA 3KWJA 4YLEA 5JZMA 3JAMA 1Z6XA 1ZRNA 4WLFA 1NZDA 3F49S 3O2JA 3A9RA 1OVGA 3L6BA 3P2OA 1P1RA 3IMFA 4OEHA 4DCUA 3KQQA 2IXBA 4GEKA 3QOWA 2NV2B 3CLSC 3IKMB 1NL3A 3ILSA 2CVQA 2AMFA 3W1VA 3NYIA 5L3SA 4YHHB 4JWKA 1CY0A 1W52X 4Q7LA 4COKA 1POWA 4MGIR 1LUAA 4BP8A 4BS9A 4YV0A 1OHHD 3T7AA 1VMKA 3UICA 2DC1A 3C8MA 3VYUB 4NEHB 3TMKA 5BN4A 1RIIA 3K94A 3KT6A 5K3DA 5AVSA 4BO2A 1KEUA 3W5UA 2GHIA 5DRYA 2OC4A 1P7CA 1QK4A 3Q7PA 2FEXA 2HXGA 3NIDB 3A2NA 3PNOA 1V6AA 2GD1O 2PSEA 4FFNA 2HLDD 4MAAA 1XPJA 4ZAWA 1YE8A 3RIHA 2QOEA 4G01B 2XWQA 1NVFA 4F1KA 4YT2A 3BGVA 1E1QA 3VYVA 3O47A 2MMGA 4UAGA 4E08A 3WIOA 3M9WA 1I01A 3EUEA 1LSSA 4U9HS 1RSZA 5JMOA 5I7RA 4BAUA 2FFQA 2H2HA 3FYDA 5EQDA 5JXHA 1Z4IA 3A6PC 5FPHA 1Z6YA 2FRXA 1PJRA 2JAPA 3CPHA 4AECA 2DFPA 1V9SA 3CM0A 4G67A 3EEOA 1XLTA 3T6KA 4KRGA 4W63A 3GLTA 3I83A 4ZCTA 1R8SA 3H4TA 4HUQA 4C03A 4FFMA 1LSJA 3RT9A 3LLCA 4N6GA 3QY9A 4HNGA 3B48A 3DM5A 4AP6A 1GT91 3JVDA 3DAPA 2CLEB 1HA3A 1GTJ1 1ZK3A 2PKYX 4MUKA 1Q20A 2CUKA 1J2UA 2WJWA 3W2GA 3KB1A 4IH1A 4J3JA 4KYTA 3PUJA 2VUSA 1OU0A 2AD5A 2NSLA 4IDAA 1BW3A 1N6RA 4LXYA 1RLOA 3STUA 2FSFA 1C30B 3KSRA 1L5HA 1DIAA 1I4WA 4TMTA 5A9RA 2GASA 3JQCA 4IICA 1QIJA 4PBTA 3ICEA 1RYMA 3SXUA 2I6QA 1IB6A 4G63A 1LRKA 1NWHA 1TAGA 3NBFA 1KO7A 5KYUA 5KYTA 4DZTA 3QUTA 4RK7A 2Q0QA 1SCAA 1SXJB 2YMMA 4HGRA 1FDUA 3PR3A 3B78A 3WMEA 2NTJA 2WVGA 3DA8A 4EOGA 4JP8A 3P9RA 2G5CA 4URFA 4UTOA 1QO0D 3KR0A 4C7JA 4I2VA 2QUZA 4ADSG 1E9BA 4NCJA 3O8QA 4M9ZA 1U1IA 2VHQA 4QRHA 3E8XA 1TE2A 3AJ8A 1FSFA 4MV5A 4HN4B 5JSKA 3K0AB 3WKAA 1KJQA 1ZNWA 2P4EA 3HR7A 3UK2A 1UC5B 4RIIA 4IZ6A 1FYXA 3FUVA 1UQRA 4YLGA 3BQNB 3GJ5A 1XG5A 1M2VA 2E4ZA 3QBDA 4CMBA 1RRPA 3CF0A 2B99A 3UK0A 4Q48A 3BB4A 4R8LA 3GMSA 1F48A 1JHQA 2H7XA 5SY9A 1HRDA 2FEKA 1X1TA 4L28A 4KXVA 4XGNA 1NM5C 1NJGA 1BN7A 3R7DA 5JAQA 3HO6A 1IUNA 3THRA 3UV7A 4DCTA 4ETWA 3DE7X 2FQ1A 4GT1A 3E8MA 3UENA 3A0UA 3TZCA 1WIWA 2PMCA 1CP2A 5C31A 3F9CA 3EPKA 2J30A 5CT4A 2B0JA 3RU7A 4JLPA 3B3FA 1E9AA 3KT0A 3NI2A 6YASA 1VKRA 1N5OX 3TVDA 2HN9A 2QV0A 5KNDA 4TLMB 8MHTA 1PGJA 1YQGA 3IT1A 1Q14A 1NFFA 1RP7A 1JFRA 3ZTWA 4HK4A 4KSYA 2ZB2A 5ADWA 1WL8A 3DEAA 3IRUA 3QVXA 5FTKA 1C3OB 1VM6A 2J85A 1FX1A 2Q41A 4LDNA 4DM7A 1XXHB 4B35A 4RTJA 4BVGA 2O23A 4GKVA 1KI6B 3F47A 3GFOA 4ZYLA 2JGDB 3TLXA 3ZWOA 2H5EA 1NXPA 4TXLA 1VHDA 3U48A 3GT4A 2PMEA 5AVKA 2CY0A 1R4AA 4RZ2A 5F1PA 5CXUA 3AVWA 4PC2A 1YHYA 1NOJA 3QVSA 2DTDA 4FFOA 5ADUS 4JJ8A 3A1WA 2D0PB 5BQFA 1QQBA 3LA8A 4EHFA 2QYSA 1P3JA 1CUYA 1VG9B 1M33A 2H4YA 3E2IA 3A4LA 3UYKA 2ZVPX 2B1IA 3ZVLA 4AFNA 1R0RE 2J31A 2YOHA 1GKIA 4RY8A 4XX0B 1KYXA 4EO9A 1DJOA 4XOIA 1CUXA 4Q47A 1JVBA 2I8CA 3D1JA 3I37X 2IFTA 2WILA 1U0LA 1E3QA 1CHDA 3G2MA 4QUDA 4KFUA 4AKEA 3IH5A 4DLKA 3N2IA 4JDUA 2WB2A 4A15A 1X39A 4M8IA 2UUOA 4XQGA 4FNAA 5K4HA 4MR8B 1U7TA 4BXOA 2FEWB 3GPDG 3AHJA 1NBEA 3A26A 3CEHA 4X60A 1SCUB 3R9XA 3SYRA 1OXTA 3HL0A 1JYFA 4C5AA 1H05A 4REMA 1D6MA 4BKQA 2Q5CA 2Z2ZA 2R48A 5D1HA 1UPCA 2BJVA 3N86A 2OCKA 3QVMA 2DCUA 1P2GA 2I91A 3JZAA 4RVFA 1C7FA 4ZT3A 4Z54A 5DYGA 1FFBA 1R5JA 3DCYA 3NETA 4RNDB 4HDAA 4L9SA 3ZQ6A 4BKPA 5LMNB 2CD9A 5DISB 5FWDA 3X2LA 2C4WA 1M0WA 4GDMA 3AR6A 3D5EA 3Q72A 2YASA 4GA5A 3C5EA 1Z0SA 1L5RA 5B58C 1RT9A 4L5BA 4Q93A 2QL5A 3N8NA 1QPZA 3PX3A 4QQFA 1W8IA 4J6EA 2FPSA 3AETA 2Q3BA 5ES4B 1RVDA 3EOZA 2QX9A 1ODLA 2OFFA 1N2JA 1WX1A 1BDIA 4LF5B 4X41A 5CBPB 4BEWA 1MB9A 4O4JA 2YOFA 3FFWA 3JZFA 2B8EA 4C06A 1WBDA 1R37A 3PNMA 2A5LA 1J09A 3S4YA 1EH5A 1MAUA 3U3ZA 5A9TA 3FLMA 1WMAA 1J5XA 4MIEA 1RABA 4AMVA 3WK9A 1N2HA 3WE7A 2RGYA 1G66A 1L1EA 4KQ6A 3TDNA 4GXNA 4M1TA 3U7IA 1YA6A 1JBKA 2JGNA 2ZSBA 4R8KA 4C4RA 2GPAA 2E4YA 2WP0A 1BRMA 4IMJB 1CUBA 1ZQ1A 4PZDA 4BOYA 1E9RA 1IPFA 3PUXA 2Q99A 3SFTA 5C81A 3P9SA 1GRRA 4MH0R 4JJKA 3SQDA 3O90A 4EVSA 3EXAA 4XI9A 2FGKA 2CLIB 4NZOA 2PM8A 2WU0A 1UP7A 3C3BA 3E9QA 2VBCA 2VT7A 4OCZA 2TRSB 2WU1A 4II2A 1DHRA 1NW8A 4IFTA 3H3FA 3OQIB 4A8JC 4D81A 4DKJA 5JEDA 3B9BA 1Y9AA 3LUAA 3O6VA 5CH5A 5EIBD 3OE4A 2W90A 1XHEA 2XT9A 5IKOA 3ZCTA 3RPEA 4L8LA 1QRTA 3IAS1 4JZKA 3V9PA 4UPDA 1YR6A 3L92A 2IJGX 4N41A 2PKQO 3O7MA 1P7VA 3DW3X 1PZXA 3T7RA 4EI8A 3DTYA 4Q7KA 4URVR 2BI8A 2C83A 4K87A 5JXJA 3IQZA 1D2MA 3AL3A 1WG8A 2W0MA 3NAQA 3ESAA 3H2KA 3L5OA 4F3KA 5J1SB 3RJ9A 4A6EA 1RCTE 2V7PA 4AF6A 4ZV9A 4IDPA 3THOA 3OZUA 1RDFA 1KVSA 2CZGA 2GAIA 1I1NA 1NBME 5SZHB 4X1KA 1QG6A 4IWXA 2WKRA 2QORA 4QGBA 3LIIA 3CF6R 1Y7HA 1KH2A 1TM1E 3GZJA 1TVCA 2AH5A 5SZKB 4F5DA 2YDYA 3K4PA 5A71A 2G76A 3E5NA 3AESA 3L1JA 5C46F 4MJLA 3VR6H 1Q15A 3AQIA 5I7OA 4M1KA 4GLOA 3GLGE 3G0GA 3DVQX 3OESA 4NNPA 2KW5A 1BHJA 1KSGA 4N0QA 1HM5A 3ZIAA 4HX5A 1XQXA 2J9GA 4Z8XA 3IP7A 3GAAA 4PYKA 4TV8B 3PHCA 3OX2A 3IODA 3RS5A 3C48A 1G6HA 2X5JO 4F7WA 4KK3A 1PD1A 2WWIA 3IAFA 3OIWA 1IDN1 4D45A 3W78A 1C1XB 4G0WA 3BSWA 1VBNA 2XSZD 4FTWA 3E2PA 2VEOA 3BD9A 4EHBA 3NAGA 2M6KA 3JQQA 3DZJA 3RYFA 2CCJA 1KYYA 2I03A 4WBNB 4PR3A 3RT1A 1CUIA 4L95C 2GUWA 3AO0B 2AYYA 5H4GA 1O08A 1MC4A 1OYVA 1Y6QA 4R1PA 5LQNA 5DBOA 2FYTA 2VP9A 4F3RA 1N3YA 3CBQA 3I34X 1MDBA 3DDUA 4L27A 4BFCA 1UXIA 1GNPA 3ETHA 4GOOD 1JHOA 2F90A 3QK7A 4F6CA 5IU6A 1JBEA 2I76A 3HN6A 2QIPA 1Z5UA 4KR3A 1JSXA 4LXQA 4V0SA 2OCAA 3OO1A 2GJKA 3BA6A 3IBGA 2AOTA 3CNEA 4XDGA 1XEFA 5BSRA 2IH4A 1N6OA 5C2JB 5T4HA 3AFHA 5E4TA 1Z8HA 2IOFK 4RV0A 1TI7A 4RPKA 2WF5A 1YR7A 1QFYA 2C04A 2XTNA 4ZRDA 4B5LA 4PC6A 5BW8A 4Q24A 4HVCA 4GDFA 4J0HA 4WT7A 3ROKA 3ADDA 4YT5A 1OB2A 5CCDA 5JCJD 2ZJ7A 4K28A 5ERYA 1YS2X 3QPBA 4P9NA 1Y81A 1QIIA 3TIGA 4RTNA 1KSJA 1S8NA 3FFTA 3R5SA 4NQZA 3DQQA 1TB4A 3JATB 4PSKA 5EXTA 1FDRA 1S2GA 4EYOA 2WJ4A 1U7DA 2QS9A 3BTVA 1PR6A 2FSHA 3HR4A 3MAGA 4D9HA 4Z4HA 1UJ6A 1AA6A 5AKZA 5ALOA 4IILA 1IQPA 5AKXA 1ZOIA 3JYPA 2J33A 4DGQA 3LBHA 3NC1C 5EUMA 4ENWA 3P26A 1OFUX 2XRZA 4OF4A 1VHTA 1A2OA 2O5JD 4E5NA 2IP4A 2A5DA 1GRVA 2XWJI 3DZBA 3FYUA 5TGDA 3WLFA 5HW0A 1CUHA 1RKVA 4B40A 3U60B 2WEKA 4LDRA 2WSBA 2CVZA 2DBZA 2JZOA 2P62A 3DDNA 1YR1A 2X3UA 3H1EA 1KR2A 1QH8A 1WB4A 2ZUUA 3K9NA 4I9FA 2QL7A 5LD2B 1BXRA 2H1RA 5EPOA 1YR8A 1SY7A 2A5YB 4H27A 4S1NA 5EJIA 1VFPA 3RADC 1YLEA 3QGMA 4LYGA 5A1TA 3BMNB 3D3EA 4FHEA 2JVIA 2HPHA 1FDTA 1IZYA 2AFHA 2IQIA 2PGJA 1E2EA 3AJRA 2GK3A 3GLQA 3K8ZA 3MCWA 4G36A 4B7UA 3B1XA 4Z1OA 1D07A 3JQ7A 3OEEA 1K8QA 4RPJA 3UWOA 3I73A 3TQSA 4M0MA 4DB4A 4D9FA 2ZU6A 1Z63A 3BREA 1NC3A 3HZZA 1B8NA 4Z1MD 1GZ4A 3O2NA 4HWOA 1YAJA 3A3OA 3NLLA 2GKGA 1NLUA 2CYAA 2F9LA 2O8DA 2HJWA 4A0QA 4D44A 1Z8NA 3IAM1 4M6WA 3SD7A 3VU1A 5CVJA 3KJHA 1C9YA 2MYNA 2RG7A 4MDHA 2DR2A 2O57A 1VI2A 4IUBS 1KK0A 4LY3A 3RSHA 3TRDA 5BSFA 1GPAA 2BRUC 4K6MA 1EDZA 4QPZA 1P31A 1OREA 1TEHA 1UEIA 3DHVA 3F8SA 1CT9A 3HFJA 1TFRA 2GF2A 1Y37A 3AV3A 4DADA 2YWJA 4B9EA 4R8VA 1PWHA 1E2DA 3PA6A 2J67A 1S6YA 2F1KA 3H5RA 1AHNA 1GN9A 3G68A 3PFGA 1P6XA 2P6RA 4HLUC 2O9JA 4ZDKA 1S2OA 1FMLA 1Z0AA 3WHPA 1SCNE 4X6UA 4MEBA 1MJFA 5GJCA 3T4UA 4C20A 3K16A 2C96A 2HEIA 5BR4A 4DR2B 2IKSA 4BIMA 3OD5A 2QMQA 4JLKA 3UCXA 3GBVA 5F35A 1IN5A 2ODWA 1TJ3A 3TIFA 3RC8A 3Q12A 3QKUA 1G8SA 2QYTA 4YJDA 2PS3A 1ZN8A 1MRZA 1QANA 1R0XA 2IPOA 2E2IA 2Z1DA 1KDVA 2M2IA 4WY8A 4IJVA 3R41A 3CXUA 3LY9A 1IB0A 3DCNA 4BPBA 1CIPA 5GGYA 2QTVB 1F2TB 4H6VA 2O48X 3VNSA 1E6MA 5T4FA 2IUFA 2Q27A 3NHFA 4J07A 4ZODA 3RAGA 4EB8A 4O3FA 3GH3A 1R9TA 4TSFD 2Y2UA 1B3BA 2AKEA 1Z5NA 1X13A 1ZU5A 1UDRA 2DHDA 3G2IA 3MTJA 2IVZA 3OZAA 4LZNA 2GEVA 4DQXA 2FMIA 4RTLA 2JLZA 4WXYB 3V3TA 3GDFA 2FPPA 3QLTA 4MPRA 2BUBA 3H11B 1E3IA 3CBGA 3NONA 3JYLA 3MUFA 4JI6B 4DR3B 3GGJA 1MW9X 4MHOA 1CNEA 3SLKA 1OMOA 1U90A 2AGVA 2WYVA 3EBLA 4CF6A 4EEZA 2RONA 1NZJA 4NLLA 1E1LA 1WEKA 2EZ4A 3THXB 1UFOA 2F4NA 1ETUA 4ODIA 2QRHA 4ZT4A 1Y4UA 4BRUA 2FW1A 5JJ5A 1CJCA 4YJGA 3LZCA 4DR1B 4ND6A 1HO3A 3BIOA 4PW0A 1B00A 3IFSA 5B3KA 3Q1LA 3FWNA 1UBFA 1NBWB 4HI0E 4YMVA 1SBYA 2ZAGA 4HWTA 5DFAA 2CJXA 3KOYA 3VOBA 1GGNA 5ILGA 2CBGA 2P9JA 2BFCB 3DOJA 2BEJA 2OPBA 3A14A 5C8VA 2C2BA 2IYUA 1SVMA 4ZO8A 5HIMA 1RWWA 7GPBA 1WTCA 4L5IA 1EQ2A 2BTOA 3MQ4A 3RS9A 4BP9A 1V7ZA 1N3IA 3U4GA 4PGFA 1UOPA 2YXLA 3SYLA 2AFVA 2B20A 4MQBA 3UH0A 4QD3A 3ZXUB 4CM5A 2LVBA 2YIVX 5JD6A 1MC1A 1RM0A 1T0JB 3U3MA 4E4RA 4RHYA 4F5ZA 1M1YB 1KQPA 1L1FA 3QV2A 5HIJA 4XYMA 4CE6A 3G0OA 2YYYA 4RK4A 3WDMA 4DJFC 2DWPA 5J2UB 3QF7A 1ZIXA 5AOVA 5HK8A 4RAQA 3ZHCA 2O5VA 3RHSA 3FXAA 3VZQA 3I9V1 2YNMA 5ALHA 4O4LF 3ELUA 1KYWA 1A50B 5A2QA 3KOOA 1KFKB 1O9GA 3ONWA 4HUJA 5MF6A 2B82A 2G17A 5EG5A 2DYKA 2XUAA 1O6CA 3KUDA 3KVNA 1B41A 4IRMA 4YO8A 3FZEA 1DZIA 2M6RA 1Q7EA 1NF3A 2B1GA 4ZAFA 3SM3A 3QFTA 1HT0A 1MO3A 3AEQB 3SZGA 5LWQA 1L5VA 5DDIP 3ZY6A 2IDZA 3WSTA 3A4YA 1O5OA 2P41A 2W8BB 3E82A 3VR5A 5JSZB 4BB0A 1XIVA 4GSLA 3ZK9A 2GBPA 2VO1A 2QN2A 4Y2SA 5D87A 1CZLA 1CEXA 1KQOA 1TK9A 3N2EA 1OWLA 2AR0A 4D9NA 5CJ2A 2ZAOA 1UKYA 5HZGA 3VKHA 1D0VA 1S8FA 2F4VB 3KHTA 3R3YA 1H1DA 3I4CA 5JPCA 4RW0A 1UJMA 4CKWA 4GRIA 4CR6A 3JAWB 3QEKA 5F2KA 3CTPA 4BUCA 3NHMA 3NWBA 4TWBA 5DKFA 5KPJA 3AF4A 4HG2A 2A5JA 3HCBA 3G2QA 2HBQA 3UPDA 2YH2A 2R00A 3L77A 4DJJA 3JRXA 2BZ0A 2CNKA 3PUYA 5K3FB 2W70A 4R1LA 1JLMA 3PNLA 5FBVB 3N0RA 4KDIA 4XUCA 3D0QA 4MWTA 3TKAA 5A4IS 5HOEA 3NNDA 3OCCA 2HDWA 3EVAA 1DKUA 1X8XA 1D03A 1O94D 2G4LA 2PSHA 2VTVA 2AQ8A 1AF7A 3KTFA 2Q07A 2BE7A 4HTAA 1R0WA 4B4OA 3I2HA 1AQUA 4JD5A 2QMOA 3LPLA 1UDCA 1X8LA 3N0VA 4HKTA 2C2KA 3JAKB 3WLKX 2VSXA 1C41A 1TLFA 1F2DA 2A78A 1N1GA 2HHAA 1XLVA 3BGIA 4KACA 4QO8A 5THKA 2VQFB 4X7PA 3KXLA 4ZEMA 4B3DA 1VHJA 5C80A 5IH3A 2YXEA 1ZL0A 3P96A 3KL4A 4ID9A 3E05A 2AE1A 4EVQA 3U19A 3K0SA 3GEBA 1CBUA 1NE7A 4XJVA 5CP8A 3WP0A 2A3NA 2XUIA 1TOAA 4YH1A 1S96A 1T9ZA 4TL6A 2JARA 4GLLA 2GFQA 4JL6A 1M5RA 1I3QA 1I3LA 4KJXA 2JHGA 4X97A 1F38A 2A0FA 4ZDWA 5T7BA 3DKKA 2KHZA 2OMEA 4J2TA 1TWAA 1KU6A 1UH5A 1Z5VA 2ARKA 5D3QA 3V4PB 5DM60 1NVVQ 2D5LA 5EC8A 1E1CA 3DMDA 3F6RA 3NM4A 5B2ZA 3GUYA 5DXFA 1WSDA 4UEOA 1U0NA 2R44A 3UAZA 1QB7A 1HT3A 2BFFB 5AI4A 5T3UA 4L4RA 2QX8A 3NBYC 1EM6A 1RKUA 3LO8A 4HNVA 1EGHA 4UEJA 4F4FA 4D8XA 3JQRA 1E18A 3KYJB 2ZT6A 3R7AA 4XYBA 5CB6A 4EY7A 1G42A 4MIYA 3STHA 1OBCA 4ICIA 3FCAA 3CLTD 2YXPX 4M1OA 1YKSA 4KWEA 3E9MA 4LE1A 1ULHA 4IIEA 3RSOA 2G63A 2QJRA 3W1EA 3EFHA 2EBFX 2OBLA 4OD0A 3PE4A 4DIEA 1WCV1 1Q0UA 1ZYUA 3NPMA 1V9LA 2B7CA 1YK0A 3DZDA 3AIKA 4RMGA 5CEEA 1UZNA 4WZAB 2BMEA 3SF8B 2AOWA 1YWGO 3JQEA 2Q45A 1ZVJA 1NQWA 4GC9A 1GL7A 2XCIA 4LOIA 2WYUA 3VC7A 4FYMA 4MUJA 2WT8A 2VHWA 1DQYA 1WXIA 1E8MA 3AHFA 5K8TA 5LMZA 4RQAA 5FL7A 3EC7A 1K68A 3AF1A 4IIGA 3SEFA 2JA6A 1SOUA 5ERGB 3NASA 4QPDA 3M2PA 4E14A 1Q0HA 3E6AA 2GZMA 3L9XA 2OB1A 4YMTA 1OXKB 1OVMA 3GL9A 3K6KA 5SYAA 5LYJB 2EFHB 3KL2A 2OKGA 3NM5A 3EIHA 4U63A 3TBFA 4GWKA 2IY9A 3SIRA 4DUGA 5HUHA 3T7KA 3Q85A 4ZT5A 3DMNA 3OT1A 3PUWA 1DXYA 3TRJA 1QONA 1DFGA 1NQXA 1DEKA 2YYAA 4UDXX 5JG7A 3TIVA 1XWFA 1ND5A 2XZPA 5KMGA 5M34A 1QTQA 2ZJAA 3LD9A 3K0HA 1Z0KA 3I92A 4BN5A 2C2OA 4YR9A 3OPNA 2W42A 1RKBA 1F4PA 1PTJA 2DFNA 4N7MA 3KDSE 3L8YA 3EGOA 4MR7A 4ND3A 4BQFA 3Q9LA 4PYJA 1JA0A 3UUFA 3OE7A 1F4LA 2V96A 1GTMA 4UM7A 3S7TA 4ZHQF 1XEWY 3OJOA 4H3SA 3U40A 3OTIA 3W5CA 1YQUA 3HO8A 3IP6A 4AO8A 3PUZA 3K1JA 3KKQA 3OCWA 1DUSA 1ZCZA 2XYPA 1NW7A 1GU7A 1J2EA 4QOFA 5DGTA 5TVGA 3TFQA 1UF9A 1AOXA 3CISA 2EZ9A 3DFFA 2CUTA 3MPOA 3OSUA 1TFUA 4GPBA 1R4MA 2I71A 4PZ9A 3X43A 2RJNA 3LC2O 3FPJA 4HYEA 3ZE1B 5B6PA 3Q2KA 5A0TA 1SEVA 1XRQA 4PHGA 3DOCA 2BMJA 3RSZA 1ISPA 3Q7RA 3VPXA 1CZHA 1VLQA 4HNUA 4NCBA 3QSYA 1MOPA 4L6IA 2BHNA 1PL6A 4I1YA 4FB5A 1JXMA 1R9GA 2HNBA 3EUAA 3A2MA 1QV7A 1VI5A 4HDRB 2RIRA 3X2JA 2V3VA 1XHLA 1GO2A 1H3FA 2RCYA 2XOEA 1JSZA 3VKVA 2ECKA 1XQ9A 2ZIEA 4JLJA 1GRCA 1WNTA 3OOWA 4K3VA 1C4WA 2BKEA 2Z5LA 1KJ8A 4FYVA 4DDUA 4RMJA 4TL7A 4UHHA 5L3SB 4UMFA 2WVAA 2ZYSA 3NRJA 1EFVA 1YQEA 1N4AA 2JVKA 3V1NA 5BYAA 1KVRA 4WN9B 4GQBA 1G1AA 3MRSA 4V3CA 1WVIA 4QTXA 2VOJA 3MK31 5BN4B 3B82A 3L82B 5KTNA 1DTEA 3RSSA 3O26A 5JHGB 3IPXA 1MRSA 1KAMA 1H8ED 1X7HA 2C8KA 1VLMA 3Q6IA 5DYTA 5U4QA 1MX5A 3TUIC 5LLTA 5J1TB 2Q29A 1BXZA 2WD8A 1C4KA 1WP9A 3LM8A 3VTKA 1U1GA 3KJGA 1W5TA 1HZJA 2ZWVA 3TFWA 1SXJE 3N53A 1DT5A 4Y2YA 3Q6NA 5KNLA 3TLZA 4BO9A 4JQYA 1IXSB 1GQYA 2ZTVA 4PTZA 3TZKA 1FFYA 5L7YA 1QFMA 5FFFA 1WOYA 1DE0A 1ESEA 2N47A 1S2MA 1K3TA 3UMFA 2HRBA 5KYGA 2P2YA 1X7ZA 4DMUB 1UJBA 3L6UA 1DEAA 4LJ7A 1JV2B 4L0DA 4Y9DA 3X1JA 4RD1A 2IC5A 4UQLA 2H4FA 4KK4A 1M54A 3ANNA 3LNTA 2Q7DA 4G5RA 1TTTA 2H00A 2QRZA 1ZJYA 2WUGA 3CUSA 3E3AA 4ACBA 2Q8NA 5GJVC 1SAYA 3S2ZA 4NZ9A 4TVOA 2Y71A 4E30A 1KGSA 5CVCA 1PZHA 1GJRA 1W1IA 5K0FA 4XGKA 4Y0VA 2IYWA 2C54A 4HPXB 3ANSA 4OVKA 4NBKA 3TTUA 3QPVA 5FRDA 4FE7A 4X24A 3V2HA 2V03A 2O14A 2WV9A 2YS7A 3AP1A 1IXRC 4HATA 4MMXB 2MSDB 4S0XA 1YKFA 4EB3A 4OGKA 3PK0A 2A1TR 1AK9A 2ZE7A 3CA8A 4NAVA 5HRAA 2FPWA 5IASA 4IM7A 2JG3A 2FEPA 1ZM4A 3PQEA 4QGGA 4M37A 1L5HB 3B5EA 1AE1A 4UXJA 3VX4A 1JIJA 1NQUA 2JZNA 2NVWA 2VHCA 2YWCA 3QUSA 1IZ8A 2C2MA 4PO8A 4TXHA 5KYUB 5K4GA 1CWUA 2CXQA 2YMLA 1I2BA 3CQ9A 3QI2A 1A9XA 1SIBE 4GP9A 2D74A 4H7HA 3C5VA 5BSWA 1DCFA 1XXHE 2EGHA 2WJVA 1C7RA 2J41A 2VCHA 1WKBA 3IMGA 1H9BA 4D26A 1LV7A 3NHZA 4PR0A 4Q05A 4WASA 4ZI5A 2XB2A 3RVRA 4RPIA 2WTEA 4LJSA 1F14A 4C4PA 4FFDA 4B17A 5HP4A 4AN0A 1ZNZA 1VIVA 1MVOA 3HXKA 3IJPA 3FOAA 4TKMA 3EG5A 1BMFD 1HE2A 4MVYA 4HDMA 3BB1A 3ENNA 1M2VB 2EF0A 1U8UA 4EO7A 2A33A 3RK0A 5KYXA 1UKCA 3E8SA 3NKVA 4ATNA 2AMVA 1R0SA 2G7ZA 5EPUA 4AZVA 4C4OA 3FDZA 1EZ1A 2QSUA 3Q0EA 2Q49A 1XQWA 4PS0A 4XCXA 4NOMA 1EUDA 2IIQA 5TX7A 2CW5A 2H9IA 2WABA 4Q4HA 3CLSD 1Z5WA 3QPDA 4WECA 2C00A 3FDFA 3R44A 2Z6AA 1FUEA 1NUPA 4B4KA 4LC1A 1EBFA 3AIIA 3DL2A 2XYHA 1PJBA 2A14A 1YS1X 3CPJB 3N05A 3RNLA 4QRIA 3QBVA 5FOWA 2DPLA 4LNUB 3SXJA 1NRJB 4JC5A 2CBZA 3CX6A 1QE0A 1DWOA 2FEAA 4O29A 4UQOA 5KQSA 1APBA 4DPKA 1P45A 3TQTA 5AHXA 2O5CA 2WF9A 1L1QA 2GAFA 3GJTA 3QUAA 1TZBA 4TZ6A 3CCCA 3EY4A 1RXSA 4HH4A 1C2TA 1G6KA 1Y5IA 5E1MA 3GRYA 2RHMA 3VJKA 1G7CA 1I0IA 3M81A 4JX9A 4B43A 1PLLA 3RGGA 1ZC1A 3QX9A 4MCAA 2AEFA 5EZYA 1FSZA 3WAGA 1BVYF 3D7RA 3OCZA 5AK0A 1BROA 1CR2A 3DZKA 3I0ZA 3RHFA 3SIPA 4RVOA 4OJMX 3VSBA 1CQXA 3LDFA 5EXPA 1JR3A 3G88A 4NNOA 2HIHA 3U1TA 1RKXA 4GUAA 2W6JD 2C9BA 4XD7D 2PYDA 1ECPA 3NPAA 3W4IA 5JQGB 1JKJA 1Q0ZA 2JGRA 1ZHHA 3C6ZA 3FKSD 4RQTA 4LYEA 1PGOA 2VTKA 4CM1A 4DWVA 1OA0A 3VC2A 2SCUA 1NNI1 5BMOA 4CQMA 2IP2A 3R6GA 4Y8VA 4LPKA 2GA8A 3WMFA 4NSNA 1VSQA 2V74B 2ZJYA 2WZBA 3VVMA 2JRLA 4B3XA 4V0LA 1TPYA 2PV0A 4YFVA 3ZBQA 3JD4A 4H1VA 3IBYA 3A7EA 3BMCA 4YRGA 2P35A 3GNLA 2EG5A 2JFOA 2W6IA 3LE8A 4OXYA 4TS3A 2ZCUA 2OOSA 3UWKA 3B89A 4QU9A 2Z4RA 1T9KA 1FNMA 5K3SA 3W05A 3ZTYA 5C3MA 1FY2A 4BXOB 3ZEAA 1KQFA 1JG6A 2QPOA 3I1IA 4JP3A 5GIOE 3GUUA 3QKRA 4DARA 4AC9A 3R9XB 1YRYE 2HD4A 4UOQA 4DXHA 2VJYA 4QUKA 4IO0A 1Y42X 4B82A 5BVHA 3L4JA 3K05A 2G70A 1WUKS 5CNMA 3M1LA 4KN8A 2C4KA 3N6VA 5IMSA 4W5QA 1OASA 1TEZA 3UT5A 3T0GA 1PBNA 3TTYA 1ZJZA 1SVSA 4F1JA 2Y1LA 3BE5A 3OOEA 4EJ2A 1VRVA 3ECCA 4PO9A 1QHXA 2G1AA 2ZR9A 4IVNA 2XT6A 3DL7A 4O2BF 4BEBA 1GSIA 3QEJA 2R1ZA 2NTYC 1B1CA 3B7PA 1DX6A 3NT2A 4YP6A 4EUNA 1PSZA 1D4ZA 2P4SA 1N3LA 4YJKA 1DEXA 4A6XA 3G17A 3N7AA 2I78A 2PN1A 3NQ41 4CLXA 5L9AA 2Z8XA 4MPJA 1ANKA 1AQYA 5KQGA 4WUTA 1M2HA 2QRMA 1CQIB 2AN3A 5LXTA 2E48A 3SVZA 2IDKA 4L7QA 3G8AA 5HE8A 3AU8A 1WMFA 4TT3A 4O4JB 5EGNA 1XP5A 3ZWDA 1Y6GA 1DT3A 4G9BA 4DDHA 2BEKA 4PGHA 3ZTTA 1K98A 2O2CA 5C1IA 1QGYA 4DQDA 4ILEA 3JS5A 4G4GA 5BN3B 3ZV7A 4FNMA 4RU1A 4DC0A 2OXEA 1KFJB 2ZTHA 1B15A 1L4BA 2ZI9A 4P35A 4RENA 4CTJA 1KI2A 4EMTA 5L4NA 4IINA 4FQ8A 3F2VA 3EF3A 3O21A 3TL6A 3U31A 1ODSA 1BE1A 1KJJA 5AKGA 1NDUA 1MA0A 3VISA 1WUTA 5K45A 2ZB4A 3AEZA 4N0DA 4NIMA 1T5HX 2C95A 4GXTA 5BN5A 2Q5JA 5KYYA 5IWAB 2MSCB 4L02A 2JCBA 2Q7OE 5IARA 2IW3A 2K7FA 1VLZA 3OM8A 5ER9A 1P2TA 5EIEA 4AZSA 4M36A 1P7PA 1R66A 3K1ZA 2QTLA 2B1JA 5CXSA 1UXJA 4K1XA 3DYBA 5FLXA 1QS0A 2C5SA 1KJZA 1D4FA 2AG5A 2HMYB 2L0XA 3IQHX 4G6ZA 2PSJA 4RSHA 4AIIA 1ZM3A 1RXIA 4XTRA 3RE1A 3NG1A 2Q3JA 4JLWA 4MQEA 3U1BA 3TLGB 3ZWWA 2A94A 4RSRA 2EJTA 4MMZB 1AUQA 2P9FA 4EPRA 4G84A 2W7TA 3IAS6 3LT5A 2Y1XA 4L78A 5JS8A 4Q0MA 2OV4A 1V4VA 1ZD8A 3SBXA 3CF4G 3R0XA 4LHWA 2ZE8A 5K3CA 1MT0A 4NZPA 1XD2A 3MWLA 2X0DA 4KXWA 3WGQA 1WXEA 3ND6A 4ZXPA 4GU5A 4JK3A 1JQAA 3B38A 2QAIA 3BS4A 3GTOA 4LXTA 4TXNA 4A7PA 1EXDA 1A2BA 1LGYA 1NUAA 4DDKA 1BVUA 3OA0A 5JY6A 4PEVA 5FBHA 5CB4F 1O2DA 1MOQA 5DTIA 4N01A 4KV9A 1EDOA 3STVA 1ZM7A 2PLNA 1XYVA 2P7IA 4GBMA 3Q7IA 4K9LA 2J07A 1SUAA 3D6VA 4TWRA 1CXZA 1W0KA 1QP0A 1R88A 3M49A 1YS4A 1KY4A 1XA0A 5TT0A 1SFRA 5FBLB 4JJFA 4CKCA 2ZJ1A 4FD2A 1R74A 1JSCA 2HCTA 3A9VA 3P9IA 5EINA 3LLMA 4RY2A 4YECA 5G4KB 1RS0A 4AT1A 4Z49A 2CDRA 1X38A 1H8HD 3A6GA 3EW9A 2V7EA 3I3OA 3IPYA 4PQYA 4DS3A 2ZRPA 5C5CA 1YOBA 2HK6A 3RYFB 2YHIB 2XX3A 2WTUA 1HFKA 2NZJA 2L82A 3ZZTA 4OX9B 5TY0A 1G8AA 1GILA 1ZA2A 4C4TA 1K6EA 4K88A 4P7BA 1U0TA 1DG1G 3NYWA 3GLSA 4HQFA 1Y1KE 5KNDH 2FKNA 1E62A 3LOUA 2AHRA 3BB3A 4GWLA 4RA6B 4RF5A 4Q9JA 1Z6GA 4JC8A 4BAZA 2FUNB 3C97A 5H9VA 4HAXA 4YMIA 2RSLA 4P3NA 4YVFA 1PZNA 3W6ZA 4F7DA 4NFHA 5FI3A 3U0BA 1VL1A 3GZ4A 3CLUC 1Y6JA 5ILQA 3L4SO 3PV0A 3S7ZA 1SQ6A 4KNVA 3BFVA 4BO3A 4YCLA 3EZ2A 3S2SA 1TM4E 1UINA 4ENUA 2OSBA 4GL4A 1JQJC 3GC6A 2B35A 4LJLA 5BWCA 4PZLA 5LQRA 1LXCA 4BO7A 1PQFA 2D5IA 2RH9B 4LOAA 4JYZA 3GLUA 3U7JA 4JIGA 5F7OA 3VPHA 3TQHA 4FJ1A 3N1UA 4FYIA 2ZRQA 1W29A 3OTWA 4MI3A 4ZVNA 5AH0A 1RQ2A 4ON9A 4P36A 2ASEA 3PEUA 3KTOA 4EJMA 3HNOA 4Q82A 2PZ8A 1H2HA 5HF5A 3WGKA 5D7BA 1J0DA 4UM8B 5DCUA 4ZI7F 1YRBA 3QXCA 1C9JA 3T1QA 4ZK2A 4PLTA 2WY2D 2C2WA 1U3CA 3UMCA 4DIOA 3ZUGA 2D1YA 4MVJI 3RVLA 3OH8A 1PJ8A 1ESZA 4JKYA 1XVLA 2GPJA 2VNHA 2ZE5A 5K99A 1JGTA 4X1IA 4MQUA 4F6RB 5BSMA 2Q9UA 5BP7A 2FJUA 2FUEA 2BGMA 4OXNA 2LIVA 3ZX5A 5A4JA 2FX2A 4BLOA 5C7LO 1Z2AA 3MQFA 3DDZX 3O5AA 4KXQA 2FY8A 2KE5A 3IEPA 1QH8B 2OVFA 4ZGWA 5A5VA 1JQKA 2WSSD 3SJUA 1Y6RA 2EG9A 3QMVA 4CTKA 4D8WA 1AXGA 4U2GA 1KPIA 5EJFA 3KTAA 4NH4A 3U3RA 1OPRA 4WINA 3LXXA 5L4LA 2BZGA 3UHJA 3BTSA 5ALIA 2J3IA 1ECFA 3H5IA 3JQ7B 2XKAA 3CMMA 3K30A 3W0LB 1L5FA 1M0EA 2F17A 2ZXEA 10MHA 2H1FA 5M5BA 2V1XA 4QGSA 4M8SA 2VYFA 3MRXA 4EYKA 1NVVR 3DE5X 4PGAA 4KGZA 3RS4A 1ULUA 3M3PA 3X1WA 5IDVA 1BCRA 4BFUA 2XR1A 3KYBA 5JSFA 2O8DB 6NULA 4C7KA 1NHGA 4BHTA 4BUZA 4LF4B 4FCVA 2Q5FA 1XL1A 4TVSA 3G89A 4RVCA 3B53X 2WTXA 3TQIA 4GGOA 2JVJA 3KD3A 4RFSB 3ZJ4A 3EXHA 2EARA 4LJKA 2WWXA 4KBYA 3OUUA 2VJMA 3CCFA 3Q41A 3H4VA 4FJ0A 2HMVA 1U7XA 2X13A 1ZJ4A 1PCXA 5G2OA 5GONB 4MP3A 1MU0A 4WAUA 5A2GA 4O3MA 2H3EA 3D81A 4N5HX 1XTKA 3JQFA 2G5GX 1GZDA 1X7GA 2I1VB 4LSMA 3HCDA 3LX8A 5CK4A 1W581 4B7CA 1QHFA 1YZ3A 1NRWA 4DV0B 2ZWMA 3DV2A 4ZRNA 1N3BA 4LMRA 4YRBA 1FUIA 1T1GA 4KODA 3DFMA 3L7BA 1GL6A 1NSYA 1T5DX 1H1LA 2ZEJA 2ZS9A 3DNFA 4RXTA 4LE2A 4Q4JA 5BSEA 1G21A 5LA6F 4TTPA 3FW1A 3T9AA 3VU9B 3V8NA 3VRHA 4NF2A 5KQPA 2JZCA 2VJKA 1CTQA 2YZKA 4DV5B 3IHTA 3L0CA 1TVEA 1XZKA 4XM2A 2XOKD 1M1YE 2BV3A 2VDRB 2NX2A 3QJYA 1GPH1 1UFKA 4Z3DA 1WETA 1REQA 3H6GA 1RC1A 1L7QA 4QSMA 2ZKIA 3AZPA 5EWJA 4OXRA 4P54A 3TR5A 2GK7A 1YTLA 3EA5A 1JMYA 3UV3A 2EW2A 1E7RA 1QYXA 1ESCA 2DP4E 1CYDA 3NDIA 4LXUA 3SYTA 3IGFA 4HF7A 2R6DA 3PIDA 4RJKA 3PCXA 4ZQBA 2I6UA 2PUAA 1CF4A 5CA0A 1UZAA 3W6NA 4R5MA 1JLSA 2W71A 1BW9A 3ZWXA 3CU5A 2H57A 5CGQB 4YALA 4WXEA 3ZDBA 3U4CA 2PFKA 3KT3A 2GTPA 1E0JA 3KDPA 3VVCA 1EVJA 1JNXX 3EWAA 3TB6A 1GY8A 1YIAA 2VRCD 2Y93A 3H9QA 4CEJA 1OUMA 4S0ZA 2BFEA 2GDZA 4YJGB 4CPDA 1YH3A 2W98A 2R751 1JBQA 2YUTA 3RTAA 3GLHA 3LDHA 1AC5A 1XK6A 4NCIA 4CN8A 3G9TA 4L48A 1TJYA 4I50F 3U26A 1ZD9A 3AF5A 4MUXA 4E22A 3NDBB 3HBNA 2IHTA 4RIFA 8AT1A 3VTAA 3T9EA 3I72A 5GAJA 1I1QB 2GEDA 2ZI3A 1JR6A 3TXYA 3UJ9A 1FTNA 2AKYA 3FZYA 4N39A 4B2YA 4U39A 1CY6A 2RGBA 2I67A 2OLJA 3RSQA 4CRWB 1Z15A 3JWIA 1EVIA 4QOHA 5HF9A 3AVYA 2UVDA 1QVWA 1E7SA 1PF7E 3EQ7A 1W93A 2GKOA 1HC7A 1CK4A 1MX1A 1AY0A 2ZSIA 4PG6A 4J0KA 1WA5A 2LP4Y 1M2WA 4YCSA 1JRLA 2ZJ4A 4ZQIA 4MP6A 3UBMA 2GTHA 2OFWA 3TR6A 4EG3A 1BU5A 4U7WA 2GVDC 2VH1A 1SBNE 3EIXA 1UPBA 2QX7A 3HCCA 3P2EA 3A11A 4QA9A 3QOXA 2DF8A 1LJLA 1DB3A 1SU8A 3R4VA 721PA 4QUIA 2VHUA 2BI4A 1LX7A 1KYZA 1KI4A 5E38A 2Q7XA 3TTSA 3QEAZ 4GBED 1MUUA 1E89A 4DY4A 5JSUA 1W76A 2R2AA 5D7NA 3SR4A 1G18A 3DGFC 4UMDA 1M2NA 5H68A 1J8FA 4TYMA 2WNSA 4DQVA 5KNCA 4QM6A 3KKMA 2AE2A 3QYJA 2P68A 3N9IA 1S7GA 2Q8PA 3JV7A 5CLGA 4NBTA 1QM5A 1HMPA 5EVCA 5K3AA 1H85A 1L8FA 1NR5A 1T9HA 4H1TA 4HWKA 5AJYA 1AG9A 3ROPA 1NJ1A 1LBSA 5CIQA 1SXQA 5KQMA 2JFBA 4OI2A 4YYEA 3D8NA 2HRRA 1U7PA 1EGVB 1ZI9A 3DOOA 3Q98A 5DK4A 2VXBA 2D2IA 3K9CA 4TMWA 3SJAA 4JGIA 4JX8A 2L19A 3JYNA 2YRFA 4Q6BA 1I6KA 5ICSA 4IMPA 3T15A 4AY3A 5CU7A 1RTKA 1ZD1A 2CN1A 2NO6A 2B37A 1EWTA 4I66A 4HDSA 4K40A 1JQDA 4CL3A 3D7NA 4JB8A 4M89A 1CVRA 4HGQA 3H9GA 4N12A 4Y6OA 3M6WA 3QU2A 1GQOA 2RJOA 3T61A 4WZAE 5AVUA 4XH9B 5FNZA 3SDSA 4E0BA 4CMCA 3SQOA 4KQKA 2G6TA 4FZ3A 2JD2A 2NU6B 4O4IB 1SBTA 5IK2A 1KZ9A 4Q3LA 2H4ZA 3RI3A 1FNSA 3NOXA 1WXXA 1I7LA 2BFNA 2E1RA 2C0QA 3HB1A 5THQA 4LC9A 2O2HA 4R6WA 1E59A 4L7VA 5B64A 1D7AA 2IS2A 5IBCA 4IZIA 4XTCS 3TNFA 2C7OA 2FPOA 1HORA 2RKBA 4KMRA 1S89A 3F73A 1DUIA 1HYHA 3QOFA 4I4LA 1P5RA 4C7MA 3LSYA 1C9DB 1QTIA 1F0NA 3CVOA 2BBTA 4AZ0A 1DX9A 1NMYA 4BDSA 1IN1A 4ZHQA 4CL8A 1IQRA 2BP7A 4LYYA 3QMWA 4IIDA 5EJ7A 5CDYA 5CM2Z 1GV1A 5DX8A 1AT1A 3T34A 1XKTA 2QVGA 2QTHA 1A7UA 1ZISA 2FMHA 5COAA 2XTJA 1J2JA 1E1CB 1OAOA 4RGBA 4A10A 1T1EA 2XMZA 4CCSA 4DREA 9MHTA 4WADA 2W2VA 3G8BA 3QVTA 1FXWF 1UKEA 4A9AA 3TEJA 2QXUA 5AXAA 2R8XA 2FJ0A 2AFRA 3BF8A 4JKOA 2V4ZA 1IEXA 1RWOA 2HH9A 3B7GA 3PQ6A 2CXSA 3Q3GE 1OHHA 2QTZA 1AKMA 3N6RA 4PYMA 1T10A 4F45A 4DUYB 1U6IA 2GO1A 3H83A 1GTZA 1XVAA 1BIFA 1YDHA 2QJWA 2C88A 2WJGA 1UBMS 3CRVA 3LK7A 4WKBA 5EIHA 1KDZA 3HKZA 3TLKA 3WMWA 1FC0A 2X5KO 1NW5A 4KLZA 2CLSA 4L15A 3S40A 1RD4A 5AW1A 5LQUA 2WSYB 1G20A 1ZXBA 5EIOA 1GG5A 1PK7A 1Q74A 2B78A 1XDBA 2HLDA 3JWEA 2XDYA 4PLGA 3T1NA 1VA4A 4P7JA 1MB0A 2HMWA 2HWYA 2W6NA 4B1FA 2AB0A 1SO8A 3INTA 1FOEB 2HWUA 1TWGA 4V3BA 1KMQA 3SY8A 3TEMA 3STYA 4G5FA 2ZBRA 1NPYA 1XZIA 4IL5A 1QH1B 3PQCA 3EC2A 1A97A 1L5OA 2C7RA 4MV8A 2XUDA 2Q6OA 4FBGA 3TRFA 1N6IA 3SQLA 3VYSB 3BPSA 3NHUA 3KJXA 4X62B 2VHTA 4IDOA 4W82A 1DPFA 4LKRA 3NT4A 3OT1B 1QQ5A 4RGYA 4CCYA 2I8AA 5KMGB 4NEQA 5F3RA 4W5TA 4O0MA 3IQFA 4HDQB 3IE1A 5GIPE 3EPRA 1YJ5A 1G17A 3SJCA 4AIRA 5GZ3A 2QP3A 2XQGA 1D8TA 5CXQA 2Q1TA 1U9JA 2GF0A 1CUSA 2Q0XA 1PKEA 2EKBA 3QXJA 4MR7B 1N0HA 2WMYA 2XMGA 1NF9A 1P33A 2ODEA 2ECQA 1VMIA 4KE7A 3ERCA 3L18A 1M8JA 1VGQA 3BSSA 3N8KA 1GDTA 1X1DA 4RY0A 4KI0A 5M7EA 5IHPA 3G02A 1YB6A 4ZT6A 4OGLA 4TSRA 4P4UA 2AI3A 1IC6A 3OKFA 5DW3A 4IPTA 2VAWA 2VR1A 3K8YA 4JA2A 1X1CA 3EVBA 4G4SO 3MZ0A 4JOQA 1IPHA 2C5EA 2XMRA 3NBAA 3W6UA 1R4MB 4QTTB 1TK2A 5JNLA 4GSKA 4HAOA 1XDGA 1G2OA 4PZ0A 1I6LA 5DLPA 2FHSA 2I29A 2GLXA 5AOCA 1EDDA 1F8GA 3RARA 3P0RA 1WZNA 4HADA 2E2HA 2QUIA 4UAUA 4GZ3A 3MTIA 1AH2A 4X20A 4IZOA 1QO0A 4RKQA 2ATEA 3LQ1A 1AS2A 2X9NA 2QLJA 4YR7A 2P0EA 4REQA 1Y3DE 2C59A 5DLQC 1THZA 1SH7A 1G0OA 4JP7A 2HUNA 2DWCA 3IOEA 3OZVA 1NY5A 2QUHA 4AU1A 4TKVA 1K3UB 2HRQA 3V48A 1C0PA 2XODA 3D5QA 3D8UA 1Q1ZA 1SOMA 5D85A 1Z4PX 4XDZA 2H2AA 5GZ1A 5JPDA 4WK2B 3VC3A 4MS1A 4ALIA 2VS1A 5JH7A 5HNKA 3FMFA 3HSSA 3GRPA 2JIZD 3LBIA 2V5VA 3H7AA 3UJBA 4F2GA 1EFVB 2IHUA 1T4CA 3D1VA 1I2AA 3G5UA 4H3KB 4JFAA 4ZJYA 4IIJF 1URPA 3VNVA 3N0TA 4F3TA 1EGMB 2YV4A 3AGPA 4PAGA 5BT9A 2OPHA 4A2WA 5KYNA 2C20A 1P61B 5ALYA 5FHRA 1TJNA 2BGUA 3LCRA 1AQ6A 2Q50A 5HF6A 4EAQA 1Z83A 3I61A 1N5LA 1N5IA 1JKIA 3ONDA 3PPVA 1LNZA 3GCZA 4XWYA 3QVKA 4GYJA 4QIHA 1HDCA 1GTL1 4EJSC 4B5KA 3TMYA 4TRNA 2L69A 5EJEA 1CB7A 3ELYA 3OWXA 1ZIPA 4GE0A 1D1PA 2CF5A 1UBHS 3N2ZB 4FNGA 3GG9A 2C3MA 3JQDA 1SU7A 4QHSA 3TJMA 3Q7TA 1IBLB 8ABPA 2YC2C 1GA1A 4S35A 4EGQA 4OJNA 4Q3CA 2O8BA 3HFGA 2P9BA 1YR9A 1Z4QA 4JJOA 2GZ2A 3EEFA 1WCIA 4MUFA 5F2EA 4TLCA 1A27A 1EU1A 2C3UA 4YP0A 4BGDA 3F1KA 4AG3A 1I7NA 2P77A 2VHYA 1BX1A 5CYFA 3SI7A 3VR5H 1DJPA 1JFLA 1Z47A 4PLYA 4KUGA 5JRJA 3KETA 1FTGA 1ZHOA 4HEHA 1WHTB 2P67A 1E77A 2QW0X 2X9LA 3DO8A 4Q7JB 5IT0A 4XARA 3T4EA 3MRTA 1RRGA 2QMYA 4QU0A 4CUJA 4YUZA 5DM0A 4Y9UA 2Y1FA 3KLNA 5DEIA 4B6QA 4ESEA 1FRQA 1U6JA 1QE3A 5K3BA 1JP7A 1ABBA 2EEZA 3BDIA 3GWZA 1WEHA 2X2PA 4G25A 3EZYA 4DTCA 3VHLB 1TA9A 3F6CA 3MF4A 2HPZA 1WDLA 4P7GA 5EWLB 3IQXA 3FB1A 4U9IS 3VPBA 4Z3OA 1J25A 4ALLA 3CG0A 4FFTA 5IJ9A 3WGUA 2PTHA 3TUZC 3ILYA 4H77A 3WGVA 3LPNA 1KZGB 1A9XB 1GTG1 3MC1A 1DOZA 3MINB 3MTDA 3ZIDA 3C3PA 1PE0A 2I3GA 2X42A 4TMXA 3VGJA 4YRQA 2XUPA 3WB0A 3SAJA 1KK1A 1UK8A 3DV0B 4E3ZA 3DLBA 2QSZA 4M60A 1VBKA 2R66A 1EVYA 5H3HA 1ZMXA 1Z5GA 5CK5A 4BQQA 3QVUA 1RXWA 1XJWA 2Y9MB 3MD0A 4B31A 5GOZA 2QRKA 2HWWA 1D9XA 2ZWAA 5IULC 1M75A 3WRYA 2MJLA 4BJ3A 1E9SA 3D6HA 4HDMB 1D1QA 2ACEA 1P19A 2WKQA 1W1UA 4MPPA 5FPTA 5MN4A 4KE6A 4L9RA 2Y1GA 3QA9A 4FOSA 3A9WA 5KYXB 4AO6A 1XU7A 4GICA 1CRPA 4E5PA 1GRNA 1VYTA 4PHCA 3FDZB 1Z7WA 4LX8A 1U9ZA 1JTVA 4KN5A 2ZM6B 2EFYA 1JQ5A 1OAKA 3HFRA 4LN1A 2QEQA 4ZPJA 4Q4HB 3ECSA 3ZI0A 5JFTA 2XNDD 1Z88A 2AZMA 3R09A 4XCVA 3UAVA 5I8WA 4L8WB 3TNLA 2XKBA 1DOAA 4MA0A 1B6GA 1RZRD 5BPFA 2Z56A 3LT0A 5KPDA 1GTRA 3Q9SA 3WLEA 4HNSA 1M6NA 4BMSA 1TMYA 1KIFA 3K96A 1OBFO 4ITVA 1BEEA 5TF4A 3GGOA 5I9MA 5C7OO 1EP2B 4I4NA 3ZWAA 1Y6FA 3IEUA 4TM8A 3LUKA 4FYPA 5C32A 2N0SA 1OI7A 4KCGA 1PJLA 5EP3A 3LKBA 1XKXA 2ZUSA 3FZGA 1SXGA 3OEHD 1PEKE 3AGQA 4IHQA 3Q5GA 1XRRA 3HHPA 1DJNA 4MUBA 4ZIRA 1JEEA 1SBQA 1K86A 3G49A 4HEQA 2ODQA 1NFQA 4R2JA 2HT6A 1ZAYA 4P0PB 2I2CA 3SJ7A 1KI3A 2UAGA 3K5WA 3A4IA 2P4QA 1JT2A 2DU8A 3HZHA 1Y34E 2D7JA 1JKJB 4ZCPA 1BVRA 1EJ6A 3HU3A 2HK8A 2VZ0A 4OFZA 4U7FA 3UO8B 1I2ZA 3K15A 2BIFA 2SCUB 2ZYAA 1DRUA 3AM3A 1K75A 2O3TA 1CZKA 3WGZA 4I55A 4LTDA 2BFPA 3O03A 1DAPA 1HYEA 5KVSA 1YDGA 1OR8A 1Y5NA 3S29A 3PDUA 1ATZA 2A84A 1U0EA 2F62A 2XW6A 3LYAA 3G82C 4JXKA 1U2DC 1A9RA 3HJNA 3RUPA 1RAAA 3BMCB 3WLPA 1NPTO 1LW7A 2AEMA 3ZZ1A 5JNRA 4J16A 4AB1A 3W7AA 3RBXA 4C07A 4CTNA 4X92A 1Y8QA 2TECE 1KRXA 3HV0A 2C07A 3B1FA 3B6MA 1Y5RA 4OH7A 3UOAB 3D6TB 1E1DA 3GQVA 3LP5A 5COQA 1IW7D 4D41A 1Q1BA 2BR4A 1MBZA 1XLWA 1YK1A 3QKRB 4HQOA 4M1EA 4NYIQ 3UKOA 4DIDA 1P44A 2VQ6A 1E9DA 3G59A 2KPOA 3L5KA 4R7TA 4RDIA 1P18A 2NVBA 3Q88A 4ZU3A 5HIKA 1OC4A 4PWYA 1GAWA 4LSZA 1Y8ZA 2OESA 1G59A 4FFBA 2MWMA 3OQHA 4H15A 8LDHA 3AK4A 1BN6A 2PH3A 1ZJJA 3AR9A 4L73A 3UT5B 4C9BA 3MFYA 2UKDA 1WDMA 3AEKB 2DSNA 3OI7A 3LUPA 1DBRA 2POCA 3IE2A 5DHTA 3AVPA 4HXGA 3HKBA 1K89A 3PX7A 3M5PA 2ADOA 1JQEA 1TMKA 2ZVDA 1YDMA 1YZYA 3U9TA 3IP3A 5I7WA 1BFDA 4IHAA 3ZZNA 1UDBA 2X14A 1DI0A 3OIFA 1Y4ZA 1S4MA 1WXQA 3FYSA 1BD3A 4UTZA 4EI2A 4UASA 1H94A 2XMDA 5KUTA 3AB7A 4L0CA 4QXRA 4M9XA 2FPIA 2WM2A 4YRDA 5E3IA 4WNYA 5GV8A 1AUPA 3NALA 4R8MA 3W8RA 1PKXA 2XGSA 1CUUA 4TS1A 3C4JA 2ZSFA 3FHJA 1SRQA 2DAPA 3C3AA 3GVHA 3TD9A 4IHJF 1QPGA 1U8TA 2XJ4A 2XSZA 3UEOA 4OAOA 2HCFA 4UUNA 5CB4A 5I47A 3ZDCA 3O82A 2ADMA 1NX9A 2GPYA 1M2JA 4IAOA 2XZOA 1SXJC 3AVTA 3W8DA 5JNSA 1CQZA 4DQUA 3O4VA 4B85A 3SX0A 2UUPA 3AERA 4QUAA 3ZGOA 3LHFA 4PZYA 4QJ4A 3HWX1 2XDAA 4JEMA 1HE8B 4DPLA 5FTMA 4RADA 1SA0A 3BHMA 1NVMB 3D4OA 3MWGA 3PXDA 4NZMA 4CLRB 3QTBA 5CFRA 2H06A 5I4KA 3EC1A 3MWDA 2KYRA 5BN5B 4W5NA 4NICA 1LW6E 3TNJA 4IDBA 4KIFA 3WJAA 1PSWA 3IHKA 4KXNA 5BUCA 2XOXA 3K9FC 3CX3A 2QAJA 5LQKA 5DXJA 2OZEA 2EKDA 4L5AA 2PJHB 5DTRA 4UNNA 3E7DA 2AW5A 1T24A 3JD3A 4B3MB 1VJGA 2QUKA 1JA1A 2BWJA 1PT6A 3THYA 1YONA 3CN9A 2OG1A 4IWNA 5HRCA 2Q2OA 1PWYE 3PHHA 4WI1A 3CSUA 3OEWA 1F8XA 1FSGA 4G1MB 5K8IA 2Z04A 3BD7A 1L3CA 2J45A 4MQEB 2MT9A